Search Results

Search found 70517 results on 2821 pages for 'file creation'.

Page 16/2821 | < Previous Page | 12 13 14 15 16 17 18 19 20 21 22 23  | Next Page >

  • Copy mdf file and use it in run time

    - by Anibas
    After I copy mdf file (and his log file) I tries to Insert data. I receive the following message: "An attempt to attach an auto-named database for file [fileName].mdf failed. A database with the same name exists, or specified file cannot be opened, or it is located on UNC share. When I copied the file manual everything worked normally. Is it correct the order File.Copy leaves the file engaged?

    Read the article

  • Designing a database file format

    - by RoliSoft
    I would like to design my own database engine for educational purposes, for the time being. Designing a binary file format is not hard nor the question, I've done it in the past, but while designing a database file format, I have come across a very important question: How to handle the deletion of an item? So far, I've thought of the following two options: Each item will have a "deleted" bit which is set to 1 upon deletion. Pro: relatively fast. Con: potentially sensitive data will remain in the file. 0x00 out the whole item upon deletion. Pro: potentially sensitive data will be removed from the file. Con: relatively slow. Recreating the whole database. Pro: no empty blocks which makes the follow-up question void. Con: it's a really good idea to overwrite the whole 4 GB database file because a user corrected a typo. I will sell this method to Twitter ASAP! Now let's say you already have a few empty blocks in your database (deleted items). The follow-up question is how to handle the insertion of a new item? Append the item to the end of the file. Pro: fastest possible. Con: file will get huge because of all the empty blocks that remain because deleted items aren't actually deleted. Search for an empty block exactly the size of the one you're inserting. Pro: may get rid of some blocks. Con: you may end up scanning the whole file at each insert only to find out it's very unlikely to come across a perfectly fitting empty block. Find the first empty block which is equal or larger than the item you're inserting. Pro: you probably won't end up scanning the whole file, as you will find an empty block somewhere mid-way; this will keep the file size relatively low. Con: there will still be lots of leftover 0x00 bytes at the end of items which were inserted into bigger empty blocks than they are. Rigth now, I think the first deletion method and the last insertion method are probably the "best" mix, but they would still have their own small issues. Alternatively, the first insertion method and scheduled full database recreation. (Probably not a good idea when working with really large databases. Also, each small update in that method will clone the whole item to the end of the file, thus accelerating file growth at a potentially insane rate.) Unless there is a way of deleting/inserting blocks from/to the middle of the file in a file-system approved way, what's the best way to do this? More importantly, how do databases currently used in production usually handle this?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Reading data from text file in C

    - by themake
    I have a text file which contains words separated by space. I want to take each word from the file and store it. So i have opened the file but am unsure how to assign the word to a char. FILE *fp; fp = fopen("file.txt", "r"); //then i want char one = the first word in the file char two = the second word in the file

    Read the article

  • opening and viewing a file in php

    - by Christian Burgos
    how do i open/view for editing an uploaded file in php? i have tried this but it doesn't open the file. $my_file = 'file.txt'; $handle = fopen($my_file, 'r'); $data = fread($handle,filesize($my_file)); i've also tried this but it wont work. $my_file = 'file.txt'; $handle = fopen($my_file, 'w') or die('Cannot open file: '.$my_file); $data = 'This is the data'; fwrite($handle, $data); what i have in mind is like when you want to view an uploaded resume,documents or any other ms office files like .docx,.xls,.pptx and be able to edit them, save and close the said file. edit: latest tried code... <?php // Connects to your Database include "configdb.php"; //Retrieves data from MySQL $data = mysql_query("SELECT * FROM employees") or die(mysql_error()); //Puts it into an array while($info = mysql_fetch_array( $data )) { //Outputs the image and other data //Echo "<img src=localhost/uploadfile/images".$info['photo'] ."> <br>"; Echo "<b>Name:</b> ".$info['name'] . "<br> "; Echo "<b>Email:</b> ".$info['email'] . " <br>"; Echo "<b>Phone:</b> ".$info['phone'] . " <hr>"; //$file=fopen("uploadfile/images/".$info['photo'],"r+"); $file=fopen("Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt","r") or exit("unable to open file");; } ?> i am getting the error: Warning: fopen(Applications/XAMPP/xamppfiles/htdocs/uploadfile/images/file.odt): failed to open stream: No such file or directory in /Applications/XAMPP/xamppfiles/htdocs/uploadfile/view.php on line 17 unable to open file the file is in that folder, i don't know it wont find it.

    Read the article

  • Copied a file with winscp; only winscp can see it

    - by nilbus
    I recently copied a 25.5GB file from another machine using WinSCP. I copied it to C:\beth.tar.gz, and WinSCP can still see the file. However no other app (including Explorer) can see the file. What might cause this, and how can I fix it? The details that might or might not matter WinSCP shows the size of the file (C:\beth.tar.gz) correctly as 27,460,124,080 bytes, which matches the filesize on the remote host Neither explorer, cmd (command line prompt w/ dir C:\), the 7Zip archive program, nor any other File Open dialog can see the beth.tar.gz file under C:\ I have configured Explorer to show hidden files I can move the file to other directories using WinSCP If I try to move the file to Users/, UAC prompts me for administrative rights, which I grant, and I get this error: Could not find this item The item is no longer located in C:\ When I try to transfer the file back to the remote host in a new directory, the transfer starts successfully and transfers data The transfer had about 30 minutes remaining when I left it for the night The morning after the file transfer, I was greeted with a message saying that the connection to the server had been lost. I don't think this is relevant, since I did not tell it to disconnect after the file was done transferring, and it likely disconnected after the file transfer finished. I'm using an old version of WinSCP - v4.1.8 from 2008 I can view the file properties in WinSCP: Type of file: 7zip (.gz) Location: C:\ Attributes: none (Ready-only, Hidden, Archive, or Ready for indexing) Security: SYSTEM, my user, and Administrators group have full permissions - everything other than "special permissions" is checked under Allow for all 3 users/groups (my user, Administrators, SYSTEM) What's going on?!

    Read the article

  • C++, Ifstream opens local file but not file on HTTP Server

    - by fammi
    Hi, I am using ifstream to open a file and then read from it. My program works fine when i give location of the local file on my system. for eg /root/Desktop/abc.xxx works fine But once the location is on the http server the file fails to open. for eg http://192.168.0.10/abc.xxx fails to open. Is there any alternate for ifstream when using a URL address? thanks. part of the code where having problem: bool readTillEof = (endIndex == -1) ? true : false; // Open the file in binary mode and seek to the end to determine file size ifstream file ( fileName.c_str ( ), ios::in|ios::ate|ios::binary ); if ( file.is_open ( ) ) { long size = (long) file.tellg ( ); long numBytesRead; if ( readTillEof ) { numBytesRead = size - startIndex; } else { numBytesRead = endIndex - startIndex + 1; } // Allocate a new buffer ptr to read in the file data BufferSptr buf (new Buffer ( numBytesRead ) ); mpStreamingClientEngine->SetResponseBuffer ( nextRequest, buf ); // Seek to the start index of the byte range // and read the data file.seekg ( startIndex, ios::beg ); file.read ( (char *)buf->GetData(), numBytesRead ); // Pass on the data to the SCE // and signal completion of request mpStreamingClientEngine->HandleDataReceived( nextRequest, numBytesRead); mpStreamingClientEngine->MarkRequestCompleted( nextRequest ); // Close the file file.close ( ); } else { // Report error to the Streaming Client Engine // as unable to open file AHS_ERROR ( ConnectionManager, " Error while opening file \"%s\"\n", fileName.c_str ( ) ); mpStreamingClientEngine->HandleRequestFailed( nextRequest, CONNECTION_FAILED ); } }

    Read the article

  • How do I open a file in such a way that if the file doesn't exist it will be created and opened automatically?

    - by snakile
    Here's how I open a file for writing+ : if( fopen_s( &f, fileName, "w+" ) !=0 ) { printf("Open file failed\n"); return; } fprintf_s(f, "content"); If the file doesn't exist the open operation fails. What's the right way to fopen if I want to create the file automatically if the file doesn't already exist? EDIT: If the file does exist, I would like fprintf to overwrite the file, not to append to it.

    Read the article

  • Problem with File uplolad in javascript.

    - by Nikhil
    I have used javascript to upload more than one file. when user clicks on 'add more' javascript appends new object to older div using innerHTML. Now the problem is if I select a file and then click on "add more" then new file button exist but older selected file removes and two blank file buttons display. I want this old file must be selected when user add new file button. If anybody can, Help Plz!!! tnX.

    Read the article

  • 1st Issue of GIMP Magazine now Available [Free Download]

    - by Asian Angel
    Are you ready for an awesome (and free) magazine that is all about GIMP? Then GIMP Magazine is the publication that you have been looking for! This free quarterly magazine focuses on photography, digital arts, tips and tricks, step by step tutorials, master classes, help desk questions, and so much more. You can access the 1st issue in three ways: As a direct PDF download As a Bit-Torrent download View it online at Issuu Choose the option that works best for you! Note: The PDF file is 47.1 MB in size. A sample page from the magazine for your viewing pleasure… HTG Explains: Is ReadyBoost Worth Using? HTG Explains: What The Windows Event Viewer Is and How You Can Use It HTG Explains: How Windows Uses The Task Scheduler for System Tasks

    Read the article

  • excel cannot open the file xxx.xlsx' because the file format is not valid error

    - by Yavuz
    I have difficulty open opening word and excel files suddenly. Only particular office file give me the problem. These files were previously scanned by combo fix and I believe they were damaged. The error response that I from office is Excel cannot open the file xxx.xlsx because the file format is not valid. Verify that the file has not been corrupted and that the file extension matches the format of the file. This is for excel and a similar kind of error response comes for word. The file looks fine. I mean the size vise... Please help me with this problem. I really appreciate your help and time....

    Read the article

  • Upon clicking on a file, excel opens but not the file itself

    - by william
    Platform: Windows XP SP2, Excel 2007 Problem description: Upon clicking on a file in Windows Explorer (file is either .xls or .xlsx) Excel 2007 opens, but does not open the file itself. I need either to click on a file again in Windows Explorer or open it manually with File/Open ... from Excel. Does anyone know what could cause this rather strange behaviour ? The old versions of Excel worked "normally" ... i.e. upon clicking on a file, an Excel would open along with the file. Please, help !

    Read the article

  • How to write files in specific order?

    - by Bernie
    Okay, here's a weird problem -- My wife just bought a 2014 Nissan Altima. So, I took her iTunes library and converted the .m4a files to .mp3, since the car audio system only supports .mp3 and .wma. So far so good. Then I copied the files to a DOS FAT-32 formatted USB thumb drive, and connected the drive to the car's USB port, only to find all of the tracks were out of sequence. All tracks begin with a two digit numeric prefix, i.e., 01, 02, 03, etc. So you would think they would be in order. So I called Nissan Connect support and the rep told me that there is a known problem with reading files in the correct order. He said the files are read in the same order they are written. So, I manually copied a few albums with the tracks in a predetermined order, and sure enough he was correct. So I copied about 6 albums for testing, then changed to the top level directory and did a "find . music.txt". Then I passed this file to rsync like this: rsync -av --files-from=music.txt . ../Marys\ Music\ Sequenced/ The files looked like they were copied in order, but when I listed the files in order of modified time, they were in the same sequence as the original files: ../Marys Music Sequenced/Air Supply/Air Supply Greatest Hits ls -1rt 01 Lost In Love.mp3 04 Every Woman In The World.mp3 03 Chances.mp3 02 All Out Of Love.mp3 06 Here I Am (Just When I Thought I Was Over You).mp3 05 The One That You Love.mp3 08 I Want To Give It All.mp3 07 Sweet Dreams.mp3 11 Young Love.mp3 So the question is, how can I copy files listed in a file named music.txt, and copy them to a destination, and ensure the modification times are in the same sequence as the files are listed?

    Read the article

  • rename files with the same name

    - by snorpey
    Hi. I use the following function to rename thumbnails. For example, if I upload a file called "image.png" to an upload folder, and this folder already has a file named "image.png" in it, the new file automatically gets renamed to "image-copy-1.png". If there also is a file called "image-copy-1.png" it gets renamed to "image-copy-2.png" and so on. The following function returns the new filename. At least that's what it is supposed to do... The renaming doesn't seeem to work correctly, though. Sometimes it produces strange results, like: 1.png 1-copy-1.png 1-copy-2.png 1-copy-2-copy-1.png 1-copy-2-copy-3.png I hope you understand my problem, despite my description being somewhat complex... Can you tell me what went wrong here? (bonus question: Is regular expressions the right tool for doing this kind of stuff?) <?php function renameDuplicates($path, $file) { $fileName = pathinfo($path . $file, PATHINFO_FILENAME); $fileExtension = "." . pathinfo($path . $file, PATHINFO_EXTENSION); if(file_exists($path . $file)) { $fileCopy = $fileName . "-copy-1"; if(file_exists($path . $fileCopy . $fileExtension)) { if ($contains = preg_match_all ("/.*?(copy)(-)(\\d+)/is", $fileCopy, $matches)) { $copyIndex = $matches[3][0]; $fileName = substr($fileCopy, 0, -(strlen("-copy-" . $copyIndex))) . "-copy-" . ($copyIndex + 1); } } else { $fileName .= "-copy-1"; } } $returnValue = $fileName . $fileExtension; return $returnValue; }?>

    Read the article

  • Enhance GIMP’s Image Editing Power with Gimp Paint Studio

    - by Asian Angel
    Does your GIMP installation need a little super-charging? Using Gimp Paint Studio you can add a wonderful set of brushes, tools, and more to GIMP and take your work up to the next level. For our example we chose to install the beta version of Gimp Paint Studio on Ubuntu 10.10. Once you download the .zip file and unzip it, all that you need to do is manually transfer the contents shown here to the appropriate GIMP folders on your system. You can see the location of the destination folders here on our system… Note: Make certain to make a back-up copy of the “sessionrc and toolrc files” before you transfer Gimp Paint Studio into your installation (in case you would like to or need to revert back to the originals later). When you finish transferring the files start GIMP up and get ready to have fun. And if your experience is like ours then you should see a noticeable difference in window size and arrangement from the default settings. Here are some samples of the exceptional artwork done by Ramon Miranda and Mozart Couto using Gimp Paint Studio. Really impressive! Artwork by Ramon Miranda & Mozart Couto. Watch the introduction video and see Gimp Paint Studio in action. Download Gimp Paint Studio for Linux, Windows, and Mac [Gimp Paint Studio Homepage] *Keep in mind that there are stable and beta releases available, so choose the version that you are most comfortable with using. View the Installation Guides for Gimp Paint Studio *Page contains wonderful “video and written” versions for adding/installing Gimp Paint Studio to your system. Gimp Paint Studio Video Tutorials Library Visit the Gimp Paint Studio Gallery Latest Features How-To Geek ETC Should You Delete Windows 7 Service Pack Backup Files to Save Space? What Can Super Mario Teach Us About Graphics Technology? Windows 7 Service Pack 1 is Released: But Should You Install It? How To Make Hundreds of Complex Photo Edits in Seconds With Photoshop Actions How to Enable User-Specific Wireless Networks in Windows 7 How to Use Google Chrome as Your Default PDF Reader (the Easy Way) Enhance GIMP’s Image Editing Power with Gimp Paint Studio Reclaim Vertical UI Space by Moving Your Tabs to the Side in Firefox Wind and Water: Puzzle Battles – An Awesome Game for Linux and Windows How Star Wars Changed the World [Infographic] Tabs Visual Manager Adds Thumbnailed Tab Switching to Chrome Daisies and Rye Swaying in the Summer Wind Wallpaper

    Read the article

  • SQL SERVER – Guest Post by Sandip Pani – SQL Server Statistics Name and Index Creation

    - by pinaldave
    Sometimes something very small or a common error which we observe in daily life teaches us new things. SQL Server Expert Sandip Pani (winner of Joes 2 Pros Contests) has come across similar experience. Sandip has written a guest post on an error he faced in his daily work. Sandip is working for QSI Healthcare as an Associate Technical Specialist and have more than 5 years of total experience. He blogs at SQLcommitted.com and contribute in various forums. His social media hands are LinkedIn, Facebook and Twitter. Once I faced following error when I was working on performance tuning project and attempt to create an Index. Mug 1913, Level 16, State 1, Line 1 The operation failed because an index or statistics with name ‘Ix_Table1_1′ already exists on table ‘Table1′. The immediate reaction to the error was that I might have created that index earlier and when I researched it further I found the same as the index was indeed created two times. This totally makes sense. This can happen due to many reasons for example if the user is careless and executes the same code two times as well, when he attempts to create index without checking if there was index already on the object. However when I paid attention to the details of the error, I realize that error message also talks about statistics along with the index. I got curious if the same would happen if I attempt to create indexes with the same name as statistics already created. There are a few other questions also prompted in my mind. I decided to do a small demonstration of the subject and build following demonstration script. The goal of my experiment is to find out the relation between statistics and the index. Statistics is one of the important input parameter for the optimizer during query optimization process. If the query is nontrivial then only optimizer uses statistics to perform a cost based optimization to select a plan. For accuracy and further learning I suggest to read MSDN. Now let’s find out the relationship between index and statistics. We will do the experiment in two parts. i) Creating Index ii) Creating Statistics We will be using the following T-SQL script for our example. IF (OBJECT_ID('Table1') IS NOT NULL) DROP TABLE Table1 GO CREATE TABLE Table1 (Col1 INT NOT NULL, Col2 VARCHAR(20) NOT NULL) GO We will be using following two queries to check if there are any index or statistics on our sample table Table1. -- Details of Index SELECT OBJECT_NAME(OBJECT_ID) AS TableName, Name AS IndexName, type_desc FROM sys.indexes WHERE OBJECT_NAME(OBJECT_ID) = 'table1' GO -- Details of Statistics SELECT OBJECT_NAME(OBJECT_ID) TableName, Name AS StatisticsName FROM sys.stats WHERE OBJECT_NAME(OBJECT_ID) = 'table1' GO When I ran above two scripts on the table right after it was created it did not give us any result which was expected. Now let us begin our test. 1) Create an index on the table Create following index on the table. CREATE NONCLUSTERED INDEX Ix_Table1_1 ON Table1(Col1) GO Now let us use above two scripts and see their results. We can see that when we created index at the same time it created statistics also with the same name. Before continuing to next set of demo – drop the table using following script and re-create the table using a script provided at the beginning of the table. DROP TABLE table1 GO 2) Create a statistic on the table Create following statistics on the table. CREATE STATISTICS Ix_table1_1 ON Table1 (Col1) GO Now let us use above two scripts and see their results. We can see that when we created statistics Index is not created. The behavior of this experiment is different from the earlier experiment. Clean up the table setup using the following script: DROP TABLE table1 GO Above two experiments teach us very valuable lesson that when we create indexes, SQL Server generates the index and statistics (with the same name as the index name) together. Now due to the reason if we have already had statistics with the same name but not the index, it is quite possible that we will face the error to create the index even though there is no index with the same name. A Quick Check To validate that if we create statistics first and then index after that with the same name, it will throw an error let us run following script in SSMS. Make sure to drop the table and clean up our sample table at the end of the experiment. -- Create sample table CREATE TABLE TestTable (Col1 INT NOT NULL, Col2 VARCHAR(20) NOT NULL) GO -- Create Statistics CREATE STATISTICS IX_TestTable_1 ON TestTable (Col1) GO -- Create Index CREATE NONCLUSTERED INDEX IX_TestTable_1 ON TestTable(Col1) GO -- Check error /*Msg 1913, Level 16, State 1, Line 2 The operation failed because an index or statistics with name 'IX_TestTable_1' already exists on table 'TestTable'. */ -- Clean up DROP TABLE TestTable GO While creating index it will throw the following error as statistics with the same name is already created. In simple words – when we create index the name of the index should be different from any of the existing indexes and statistics. Reference: Pinal Dave (http://blog.SQLAuthority.com) Filed under: PostADay, SQL, SQL Authority, SQL Error Messages, SQL Index, SQL Query, SQL Server, SQL Tips and Tricks, T SQL, Technology Tagged: SQL Statistics

    Read the article

  • Exchange 2010 DAG Creation and Configuration – Part 1

    If you’re using Exchange 2010, then you’re probably interested in using the new Database Availability Group feature for your High Availability needs. The DAG is superbly powerful technology, but you’d better make sure yours is 100% correctly configured. Neil Hobson walks us through what we need to know, using a two-node DAG as an example.

    Read the article

< Previous Page | 12 13 14 15 16 17 18 19 20 21 22 23  | Next Page >