Search Results

Search found 9634 results on 386 pages for 'proxy pattern'.

Page 175/386 | < Previous Page | 171 172 173 174 175 176 177 178 179 180 181 182  | Next Page >

  • spring 3 mvc requestmapping dynamic param problem

    - by Faisal khan
    I have the following code which works fine with http://localhost:8080/HelloWorldSpring3/forms/helloworld but i want to have url have some thing like this http://localhost:8080/HelloWorldSpring3/forms/helloworld/locname_here/locid_here I found that adding this @RequestMapping("/helloworld/**") will work but when i try to access http://localhost:8080/HelloWorldSpring3/forms/helloworld/locname_here/locid_here it is not found. Web.xml entry as follows <servlet-mapping> <servlet-name>dispatcher</servlet-name> <url-pattern>/forms/*</url-pattern> </servlet-mapping> Mapping bean entry @RequestMapping("/helloworld/**") public ModelAndView helloWord(){ String message = "Hello World, Spring 3.0!"; return new ModelAndView("helloworld", "message",message); }

    Read the article

  • plist vs static array

    - by morticae
    Generally, I use static arrays and dictionaries for containing lookup tables in my classes. However, with the number of classes creeping quickly into the hundreds, I'm hesitant to continue using this pattern. Even if these static collections are initialized lazily, I've essentially got a bounded memory leak going on as someone uses my app. Most of these are arrays of strings so I can convert strings into NSInteger constants that can be used with switch statements, etc. I could just recreate the array/dictionary on every call, but many of these functions are used heavily and/or in tight loops. So I'm trying to come up with a pattern that is both performant and not persistent. If I store the information in a plist, does the iphoneOS do anything intelligent about caching those when loaded? Do you have another method that might be related?

    Read the article

  • javascript string exec strange behavior

    - by Michael
    have funciton in my object which is called regularly. parse : function(html) { var regexp = /...some pattern.../ var match = regexp.exec(html); while (match != null) { ... match = regexp.exec(html); } ... var r = /...pattern.../g; var m = r.exec(html); } with unchanged html the m returns null each other call. let's say parse(html);// ok parse(html);// m is null!!! parse(html);// ok parse(html);// m is null!!! // ...and so on... is there any index or somrthing that has to be reset on html ... I'm really confused. Why match always returns proper result?

    Read the article

  • Accessing constructor from abstract base class with reflection

    - by craesh
    Hi! I'm playing around with Java's Reflection. I have an abstract class Base with a constructor. abstract class Base { public Base( String foo ) { // do some magic } } I have some further classes extending Base. They don't contain much logic. I want to instantiate them with Base's constructor, without having to write some proxy contructors in those derived classes. And of course, I want to instantiate those derived classes with Reflection. Say: Class cls = SomeDerivedClass.class; Constructor constr; constr = cls.getConstructor( new Class[] { String.class } ); // will return null Class clsBase = Base.class; constr = clsBase.getConstructor( new Class[] { String.class } ); // ok Base obj = (Base) constr.newInstance( new Object[] { "foo" } ); // will throw InstantiationException because it belongs to an abstract class Any ideas, how I can instantiate a derived class with Base's constructor? Or must I declare those dumb proxy constructors?

    Read the article

  • handle when callback to a dealloced delegate?

    - by athanhcong
    Hi all, I implemented the delegate-callback pattern between two classes without retaining the delegate. But in some cases, the delegate is dealloced. (My case is that I have a ViewController is the delegate object, and when the user press back button to pop that ViewController out of the NavigationController stack) Then the callback method get BAD_EXE: if (self.delegate != nil && [self.delegate respondsToSelector:selector]) { [self.delegate performSelector:selector withObject:self withObject:returnObject]; } I know the delegate-callback pattern is implemented in a lot of application. What is your solution for this?

    Read the article

  • How to combine designable components with dependency injection

    - by Wim Coenen
    When creating a designable .NET component, you are required to provide a default constructor. From the IComponent documentation: To be a component, a class must implement the IComponent interface and provide a basic constructor that requires no parameters or a single parameter of type IContainer. This makes it impossible to do dependency injection via constructor arguments. (Extra constructors could be provided, but the designer would ignore them.) Some alternatives we're considering: Service Locator Don't use dependency injection, instead use the service locator pattern to acquire dependencies. This seems to be what IComponent.Site.GetService is for. I guess we could create a reusable ISite implementation (ConfigurableServiceLocator?) which can be configured with the necessary dependencies. But how does this work in a designer context? Dependency Injection via properties Inject dependencies via properties. Provide default instances if they are necessary to show the component in a designer. Document which properties need to be injected. Inject dependencies with an Initialize method This is much like injection via properties but it keeps the list of dependencies that need to be injected in one place. This way the list of required dependencies is documented implicitly, and the compiler will assists you with errors when the list changes. Any idea what the best practice is here? How do you do it? edit: I have removed "(e.g. a WinForms UserControl)" since I intended the question to be about components in general. Components are all about inversion of control (see section 8.3.1 of the UMLv2 specification) so I don't think that "you shouldn't inject any services" is a good answer. edit 2: It took some playing with WPF and the MVVM pattern to finally "get" Mark's answer. I see now that visual controls are indeed a special case. As for using non-visual components on designer surfaces, I think the .NET component model is fundamentally incompatible with dependency injection. It appears to be designed around the service locator pattern instead. Maybe this will start to change with the infrastructure that was added in .NET 4.0 in the System.ComponentModel.Composition namespace.

    Read the article

  • Sharing beans from contextListener -- dispatcher servlet

    - by Ernest
    Hello! ok, i have another question now. I have a bunch of beans loaded succesfully in applicationContext.xml, which loads from web.xml: contextConfigLocation applicationContext.xml org.springframework.web.context.ContextLoaderListener Here are is the bean defined in applicationContext.xml that i want to share: it loads other beans (DAOs) which are initialized with hibernet. I need to acces catalogFacadeTarget from the dispatcherServlet, declared in web.xml: dispatcher org.springframework.web.servlet.DispatcherServlet 1 <servlet-mapping> <servlet-name>dispatcher</servlet-name> <url-pattern>*.htm</url-pattern> </servlet-mapping> and configured dispatcher-servlet.xml like this: welcome There! in the property called catalogFacadeImpl. If you need the entire applicationCOntext.xml, web.xml, and dispatcher-servlet.xml please let me know. From what i read, i should be able to share beans if i declared them in the contextConfigLocation configuration file. Thank you very much in advance.

    Read the article

  • Looking for Fiddler2 help. connection to gateway refused? Just got rid of a virus

    - by John Mackey
    I use Fiddler2 for facebook game items, and it's been a great success. I accessed a website to download some dat files I needed. I think it was eshare, ziddu or megaupload, one of those. Anyway, even before the rar file had downloaded, I got this weird green shield in the bottom right hand corner of my computer. It said a Trojan was trying to access my computer, or something to that extent. It prompted me to click the shield to begin anti-virus scanning. It turns out this rogue program is called Antivirus System Pro and is pretty hard to get rid of. After discovering the rogue program, I tried using Fiddler and got the following error: [Fiddler] Connection to Gateway failed.Exception Text: No connection could be made because the target machine actively refused it 127.0.0.1:5555 I ended up purchasing SpyDoctor + Antivirus, which I'm told is designed specifically for getting rid of these types of programs. Anyway, I did a quick-scan last night with spydoctor and malware bytes. Malware picked up 2 files, and Spydoctor found 4. Most were insignificant, but it did find a worm called Worm.Alcra.F, which was labeled high-priority. I don’t know if that’s the Anti-Virus Pro or not, but SpyDoctor said it got rid of all of those successfully. I tried to run Fiddler again before leaving home, but was still getting the "gateway failed" error. Im using the newest version of firefox. When I initially set up the Fiddler 2.2.8.6, I couldn’t get it to run at first, so I found this faq on the internet that said I needed to go through ToolsOptionsSettings and set up an HTTP Proxy to 127.0.0.1 and my Port to 8888. Once I set that up and downloaded this fiddler helper as a firefox add-on, it worked fine. When I turn on fiddler, it automatically takes my proxy setting from no proxy (default) to the 127.0.0.1 with Port 8888 set up. It worked fine until my computer detected this virus. Anyway, hopefully I've given you sufficient information to offer me your best advice here. Like I said, Spydoctor says the bad stuff is gone, so maybe the rogue program made some type of change in my fiddler that I could just reset or uncheck or something like that? Or will I need to completely remove fiddler and those dat files and rar files I downloaded? Any help would be greatly appreciated. Thanks for your time.

    Read the article

  • Graphics glitch when drawing to a Cairo context obtained from a gtk.DrawingArea inside a gtk.Viewport.

    - by user410023
    I am trying to redraw the part of the DrawingArea that is visible in the Viewport in the expose-event handler. However, it seems that I am doing something wrong with the coordinates that are passed to the event handler because there is garbage at the edge of the Viewport when scrolling. Can anyone tell what I am doing wrong? Here is a small example: import pygtk pygtk.require("2.0") import gtk from numpy import array from math import pi class Circle(object): def init(self, position = [0., 0.], radius = 0., edge = (0., 0., 0.), fill = None): self.position = position self.radius = radius self.edge = edge self.fill = fill def draw(self, ctx): rect = array(ctx.clip_extents()) rect[2] -= rect[0] rect[3] -= rect[1] center = rect[2:4] / 2 ctx.arc(center[0], center[1], self.radius, 0., 2. * pi) if self.fill != None: ctx.set_source_rgb(*self.fill) ctx.fill_preserve() ctx.set_source_rgb(*self.edge) ctx.stroke() class Scene(object): class Proxy(object): directory = {} def init(self, target, layers = set()): self.target = target self.layers = layers Scene.Proxy.directory[target] = self def __init__(self, viewport): self.objects = {} self.layers = [set()] self.viewport = viewport self.signals = {} def draw(self, ctx): x = self.viewport.get_hadjustment().value y = self.viewport.get_vadjustment().value ctx.set_source_rgb(1., 1., 1.) ctx.paint() ctx.translate(x, y) for obj in self: obj.draw(ctx) def add(self, item, layer = 0): item = Scene.Proxy(item, layers = set((layer,))) assert(hasattr(item.target, "draw")) assert(isinstance(layer, int)) item.layers.add(layer) while not layer < len(self.layers): self.layers.append(set()) self.layers[layer].add(item) if not item in self.objects: self.objects[item] = set() self.objects[item].add(layer) def remove(self, item, layers = None): item = Scene.Proxy.directory[item] if layers == None: layers = self.objects[item] for layer in layers: layer.remove(item) item.layers.remove(layer) if len(item.layers) == 0: self.objects.remove(item) def __iter__(self): for layer in self.layers: for item in layer: yield item.target class App(object): def init(self): signals = { "canvas_exposed": self.update_canvas, "gtk_main_quit": gtk.main_quit } self.builder = gtk.Builder() self.builder.add_from_file("graphics_glitch.glade") self.window = self.builder.get_object("window") self.viewport = self.builder.get_object("viewport") self.canvas = self.builder.get_object("canvas") self.scene = Scene(self.viewport) signals.update(self.scene.signals) self.builder.connect_signals(signals) self.window.show() def update_canvas(self, widget, event): ctx = self.canvas.window.cairo_create() self.scene.draw(ctx) ctx.clip() if name == "main": app = App() scene = app.scene scene.add(Circle((0., 0.), 10.)) gtk.main() And the Glade file "graphics_glitch.glade": <?xml version="1.0"?> <interface> <requires lib="gtk+" version="2.16"/> <!-- interface-naming-policy project-wide --> <object class="GtkWindow" id="window"> <property name="width_request">200</property> <property name="height_request">200</property> <property name="visible">True</property> <signal name="destroy" handler="gtk_main_quit"/> <child> <object class="GtkScrolledWindow" id="scrolledwindow1"> <property name="visible">True</property> <property name="can_focus">True</property> <property name="hadjustment">h_adjust</property> <property name="vadjustment">v_adjust</property> <property name="hscrollbar_policy">automatic</property> <property name="vscrollbar_policy">automatic</property> <child> <object class="GtkViewport" id="viewport"> <property name="visible">True</property> <property name="resize_mode">queue</property> <child> <object class="GtkDrawingArea" id="canvas"> <property name="width_request">640</property> <property name="height_request">480</property> <property name="visible">True</property> <signal name="expose_event" handler="canvas_exposed"/> </object> </child> </object> </child> </object> </child> </object> <object class="GtkAdjustment" id="h_adjust"> <property name="lower">-1000</property> <property name="upper">1000</property> <property name="step_increment">1</property> <property name="page_increment">25</property> <property name="page_size">25</property> </object> <object class="GtkAdjustment" id="v_adjust"> <property name="lower">-1000</property> <property name="upper">1000</property> <property name="step_increment">1</property> <property name="page_increment">25</property> <property name="page_size">25</property> </object> </interface> Thanks! --Dan

    Read the article

  • Observing an NSMutableArray for insertion/removal

    - by Adam Ernst
    A class has a property (and instance var) of type NSMutableArray with synthesized accessors (via @property). If you observe this array using: [myObj addObserver:self forKeyPath:@"theArray" options:0 context:NULL]; And then insert an object in the array like this: [[myObj theArray] addObject:[NSString string]]; An observeValueForKeyPath... notification is not sent. However, the following does send the proper notification: [[myObj mutableArrayValueForKey:@"theArray"] addObject:[NSString string]]; This is because mutableArrayValueForKey returns a proxy object that takes care of notifying observers. But shouldn't the synthesized accessors automatically return such a proxy object? What's the proper way to work around this--should I write a custom accessor that just invokes [super mutableArrayValueForKey...]?

    Read the article

  • HOWTO: Deserialize WCF message using OperationContract

    - by Stefan
    Hi, I succeeded in building a WCF client generated by svcutil.exe from the WSDL. Using the generated client proxy class I can call the web service of an external service supplier. I also succeeded in coding a message inspector, as I need to log both raw XML request and response as full SOAP message to the database. For an emergency szenario I also need to be able to "import" a raw XML response. I found many hints on using XMLSerializer or deserializing WCF messages based on the message contract. But how can I deserialize a raw XML response based on an operation contract? For a first test I use one of the logged raw responses, save it to a file and now try to deserialize it to the response type as generated in the client proxy. Somehow I must succeed in calling DeserializeReply() from class ClientOperation. But how to get there? I happily acced any help as I'm quite new to WCF... TIA, Stefan

    Read the article

  • Dealing with dependencies between WCF services when using Castle Windsor

    - by Georgia Brown
    I have several WCF services which use castle windsor to resolve their dependencies. Now I need some of these services to talk to each other. The typical structure is service -- Business Logic -- DAL The calls to the other services need to occur at Business Logic level. What is the best approach for implementing this? Should I simply inject a service proxy into the business logic? Is this wasteful if for example, only one of two method from my service need to use this proxy? What if the services need to talk to each other? - Will castle windsor get stuck in a loop trying to resolve each services dependencies?

    Read the article

  • Unit Testing functions within repository interfaces - ASP.net MVC3 & Moq

    - by RawryLions
    I'm getting into writing unit testing and have implemented a nice repository pattern/moq to allow me to test my functions without using "real" data. So far so good.. However.. In my repository interface for "Posts" IPostRepository I have a function: Post getPostByID(int id); I want to be able to test this from my Test class but cannot work out how. So far I am using this pattern for my tests: [SetUp] public void Setup() { mock = new Mock<IPostRepository>(); } [Test] public void someTest() { populate(10); //This populates the mock with 10 fake entries //do test here } In my function "someTest" I want to be able to call/test the function GetPostById. I can find the function with mock.object.getpostbyid but the "object" is null. Any help would be appreciated :) iPostRepository: public interface IPostRepository { IQueryable<Post> Posts {get;} void SavePost(Post post); Post getPostByID(int id); }

    Read the article

  • Cant access websites [closed]

    - by LiveEn
    Recently i have some problems accessing websites. When i try to access it says This webpage is not available. I tried accessing the site through FireFox, Internet Explorer and Chrome. I also tried with using a web proxy but still the same problem. This problem is only in my Desktop PC, all the websites works fine in my laptop Currently i cant access, yahoo.com download.com bing.com proxy.org daniweb.com aol.com and many forums I check with the host file but nothing is blocked in that. Can some one please suggest what is wrong?? Thanks

    Read the article

  • Sorting based on existing elements in xslt

    - by Teelo
    Hi , I want to sort in xslt based on existing set of pattern . Let me explain with the code: <Types> <Type> <Names> <Name>Ryan</Name> </Names> <Address>2344</Address> </Type> <Type> <Names> </Name>Timber</Name> </Names> <Address>1234</Address> </Type> <Type> <Names> </Name>Bryan</Name> </Names> <Address>34</Address> </Type> </Types> Right now I m just calling it and getting it like (all hyperlinks) Ryan Timber Bryan Now I don't want sorting on name but I have existing pattern how I want it to get displayed.Like Timber Bryan Ryan (Also I don't want to lose the url attached to my names earlier while doing this) I was thinking of putting earlier value in some array and sort based on the other array where I will store my existing pattern. But I am not sure how to achieve that.. My xslt looks like this now(there can be duplicate names also) <xsl:for-each select="/Types/Type/Names/Name/text()[generate-id()=generate-id(key('Name',.)[1])]"> <xsl:call-template name="typename"> </xsl:call-template> </xsl:for-each> <xsl:template name="typename"> <li> <a href="somelogicforurl"> <xsl:value-of select="."/> </a> </li> </xsl:template> I am using xsl 1.0

    Read the article

  • How do I consume a COM+ local server from C#?

    - by Mystere Man
    I have a web application from a company that has gone out of business. We're looking to extend the web app a bit with some asp.net functionality. The web app was written as an ISAPI application in Delphi, and uses COM+ to talk to the SQL Server and handles things like session management and authentication. So, in order to get the current user and other details, I have to use the undocument COM+ components. I was able to dig out the type library and auto generated IDL, but at this point i'm lost in creating a .NET proxy class for this. Is there a way to autogenerate the .net COM+ proxy either from the .dll itself (extracting the typelib info) or from the IDL? Note: These seem to be simple COM style objects hosted in COM+ servers, no subscriptions or transaction monitoring..

    Read the article

  • google map in android emulator problem

    - by Hiren Dabhi
    Hi, instead of it displaying google map it only display grid view. - i followed all the steps that are in following sites examples http://mobiforge.com/developing/story/using-google-maps-android or http://www.androidpeople.com/android-google-map-application-example/ - i also set the proxy server run -- run configuration.. -- myapplication--target tab-- additional command line -http-proxy http://192.68.100.101:8080/ Still i am not getting the google map. NOTE: i tried this in my mobile it works fine but not display in android emulator. where i made mistake plz help me. thank in advance

    Read the article

  • How to display a DateTime with chosen date parts, but in the order of the FormatProvider?

    - by Stephane
    I want to display the date in the order that the culture provides, but with the elements I want only. The DateTime.Tostring() method has a list of patterns that are very useful but I would like a very small change in it. The CultureInfo used in the following the following code are chosen as example, I don't want to rely on a specific list of CultureInfo, if possible var now = DateTime.Now; string nowString = now.ToString("m", CultureInfo.GetCultureInfo("en-us")); Console.WriteLine(nowString); nowString = now.ToString("m", CultureInfo.GetCultureInfo("fr-FR")); Console.WriteLine(nowString); displays : April 12 12 avril I would like a pattern that display the abbreviation of the month and the day, but that keeps the correct order from the specified CultureInfo. using the pattern "MMM dd" will always display the month's abbreviation first, followed by the day, breaking the french order for example. Any way to achieve that without too much custom code?

    Read the article

  • PDF text search and split library

    - by Horace Ho
    I am look for a server side PDF library (or command line tool) which can: split a multi-page PDF file into individual PDF files, based on a search result of the PDF file content Examples: Search "Page ???" pattern in text and split the big PDF into 001.pdf, 002,pdf, ... ???.pdf A server program will scan the PDF, look for the search pattern, save the page(s) which match the patten, and save the file in the disk. It will be nice with integration with PHP / Ruby. Command line tool is also acceptable. It will be a server side (linux or win32) batch processing tool. GUI/login is not supported. i18n support will be nice but no required. Thanks~

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • PHP regex help -- reverse search?

    - by Ian Silber
    So, I have a regex that searches for HTML tags and modifies them slightly. It's working great, but I need to do something special with the last closing HTML tag I find. Not sure of the best way to do this. I'm thinking some sort of reverse reg ex, but haven't found a way to do that. Here's my code so far: $html = "<div id="test"><p style="hello_world">This is a test.</p></div>"; $pattern = array('/<([A-Z][A-Z0-9]*)(\b[^>]*)>/i'); $replace = array('<tag>'); $html = preg_replace($pattern,$replace,$html); // Outputs: <tag><tag>This is a test</p></div> I'd like to replace the last occurance of "" with something special, say for example, "". Any ideas?

    Read the article

  • Python: using a regular expression to match one line of HTML

    - by skylarking
    This simple Python method I put together just checks to see if Tomcat is running on one of our servers. import urllib2 import re import sys def tomcat_check(): tomcat_status = urllib2.urlopen('http://10.1.1.20:7880') results = tomcat_status.read() pattern = re.compile('<body>Tomcat is running...</body>',re.M|re.DOTALL) q = pattern.search(results) if q == []: notify_us() else: print ("Tomcat appears to be running") sys.exit() If this line is not found : <body>Tomcat is running...</body> It calls : notify_us() Which uses SMTP to send an email message to myself and another admin that Tomcat is no longer runnning on the server... I have not used the re module in Python before...so I am assuming there is a better way to do this... I am also open to a more graceful solution with Beautiful Soup ... but haven't used that either.. Just trying to keep this as simple as possible...

    Read the article

  • Using free function as pseudo-constructors to exploit template parameter deduction

    - by Poita_
    Is it a common pattern/idiom to use free functions as pseudo-constructors to avoid having to explicitly specify template parameters? For example, everyone knows about std::make_pair, which uses its parameters to deduce the pair types: template <class A, class B> std::pair<A, B> make_pair(A a, B b) { return std::pair<A, B>(a, b); } // This allows you to call make_pair(1, 2), // instead of having to type pair<int, int>(1, 2) // as you can't get type deduction from the constructor. I find myself using this quite often, so I was just wondering if many other people use it, and if there is a name for this pattern?

    Read the article

  • Mapping java.util.Date to xs:date instead of xs:dateTime in JAX-WS

    - by Larsing
    Hi all, We hav an EJB, jws-anotated as a web service. It has a pretty complex pojo-model that generates an equally complex xsd. The pojos contain numerous java.util.Date. These all map to xs:dateTime. This service is used as "business service" in Oracle(BEA) OSB(AquaLogic). We also have a "proxy service" which we map to the BS with XQuery (the OSB/AquaLogic way). The proxy service's xsd has xs:date for the corresponding fields. For some reason, Oracle's implementation of XQuery does not support casting from xs:date to xs:dateTime(!). I could solve this by casting to xs:string and concat:ing with "T00:00:00", however, i would rather try to get JAX-WS to generate an xsd with xs:date instead. Only, I can't find any info on how to do this (anotations?). Can anyone give me a hint? Kind regards, Lars

    Read the article

< Previous Page | 171 172 173 174 175 176 177 178 179 180 181 182  | Next Page >