Search Results

Search found 16333 results on 654 pages for 'exception safe'.

Page 206/654 | < Previous Page | 202 203 204 205 206 207 208 209 210 211 212 213  | Next Page >

  • How to add ACTIVE DOMAIN user to Sharepoint group

    - by standley-nguyen
    Hi all. I got an exception when executing this snippet code SPSecurity.RunWithElevatedPrivileges(delegate() { using (SPSite site = new SPSite(siteUrl.Trim())) { using (SPWeb web = site.OpenWeb()) { try { web.AllowUnsafeUpdates = true; SPUser spUser = web.AllUsers[userName]; if (spUser != null) { SPGroup spGroup = web.Groups[groupName]; if (spGroup != null) spGroup.AddUser(spUser); } } catch (Exception ex) { this.TraceData(LogLevel.Error, "Error at function Named [AddUserToSPGroupWidget.AddUserToGroup] . With Error Message: " + ex.ToString()); } finally { web.AllowUnsafeUpdates = false; } } } }); PLease guide me. Thanks in advance.

    Read the article

  • Handling exceptions raised in observers

    - by sparky
    I have a Rails (2.3.5) application where there are many groups, and each Group has_many People. I have a Group edit form where users can create new people. When a new person is created, they are sent an email (the email address is user entered on the form). This is accomplished with an observer on the Person model. The problem comes when ActionMailer throws an exception - for example if the domain does not exist. Clearly that cannot be weeded out with a validation. There would seem to be 2 ways to deal with this: A begin...rescue...end block in the observer around the mailer. The problem with this is that the only way to pass any feedback to the user would be to set a global variable - as the observer is out of the MVC flow, I can't even set a flash[:error] there. A rescue_from in the Groups controller. This works fine, but has 2 problems. Firstly, there is no way to know which person threw the exception (all I can get is the 503 exception, no way to know which person caused the problem). This would be useful information to be able to pass back to the user - at the moment, there is no way for me to let them know which email address is the problem - at the moment, I just have to chuck the lot back at them, and issue an unhelpful message saying that one of them is not correct. Secondly (and to a certain extent this make the first point moot) it seems that it is necessary to call a render in the rescue_from, or it dies with a rather bizarre "can't convert Array into String" error from webbrick, with no stack trace & nothing in the log. Thus, I have to throw it back to the user when I come across the first error and have to stop processing the rest of the emails. Neither of the solutions are optimal. It would seem that the only way to get Rails to do what I want is option 1, and loathsome global variables. This would also rely on Rails being single threaded. Can anyone suggest a better solution to this problem?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Can't add domain users to Reporting Services 2008

    - by Jeremy
    I have SSRS 2008 setup on the database server. The server is part of the domain. Reporting Services is running under NetworkService. When I try to add a domain user using the web interface (Site Settings -- Security -- New Role Assignment), the page posts back but the user is not in the list. The server's log file contains the following Unhandled Exception: ui!ReportManager_0-1!954!01/12/2009-10:14:52:: Unhandled exception: System.Security.Principal.IdentityNotMappedException: Some or all identity references could not be translated. at System.Security.Principal.SecurityIdentifier.Translate(IdentityReferenceCollection sourceSids, Type targetType, Boolean forceSuccess) at System.Security.Principal.SecurityIdentifier.Translate(Type targetType) at System.Security.Principal.WindowsIdentity.GetName() at System.Security.Principal.WindowsIdentity.get_Name() at ReportingServicesHttpRuntime.RsWorkerRequest.GetServerVariable(String name) at System.Web.Security.WindowsAuthenticationModule.OnEnter(Object source, EventArgs eventArgs) at System.Web.HttpApplication.SyncEventExecutionStep.System.Web.HttpApplication.IExecutionStep.Execute() at System.Web.HttpApplication.ExecuteStep(IExecutionStep step, Boolean& completedSynchronously) Any one have an idea on how to fix this?

    Read the article

  • Out-of-the-box Eclipse PDT (PHP Development Tool) not capable of debugging PHP, why?

    - by Alex R
    I just finished reinstalling the "All-In-One Eclipse PDT" from zend.com. It's unable to debug even the simplest "Hello World" PHP script. How can such a major open-source app be released in such a bad shape? What am I doing wrong? This is the result of doing a "Debug As...": Problem signature: Problem Event Name: APPCRASH Application Name: php.exe Application Version: 5.2.9.9 Application Timestamp: 49dda267 Fault Module Name: ntdll.dll Fault Module Version: 6.0.6002.18005 Fault Module Timestamp: 49e03824 Exception Code: c0000130 Exception Offset: 0006f04e OS Version: 6.0.6002.2.2.0.768.3 Locale ID: 1033 Additional Information 1: 9d13 Additional Information 2: 1abee00edb3fc1158f9ad6f44f0f6be8 Additional Information 3: 9d13 Additional Information 4: 1abee00edb3fc1158f9ad6f44f0f6be8 Read our privacy statement: http://go.microsoft.com/fwlink/?linkid=50163&clcid=0x0409 I think it wants me to configure some additional stuff, but I have no clue what exactly to do.

    Read the article

  • Why do I get a nullpointerexception at line ds.getPort in class L1?

    - by Fred
    import java.awt.; import java.awt.event.; import javax.swing.; import java.io.; import java.net.; import java.util.; public class Draw extends JFrame { /* * Socket stuff */ static String host; static int port; static int localport; DatagramSocket ds; Socket socket; Draw d; Paper p = new Paper(ds); public Draw(int localport, String host, int port) { d = this; this.localport = localport; this.host = host; this.port = port; try { ds = new DatagramSocket(localport); InetAddress ia = InetAddress.getByName(host); System.out.println("Attempting to connect DatagramSocket. Local port " + localport + " , foreign host " + host + ", foreign port " + port + "..."); ds.connect(ia, port); System.out.println("Success, ds.localport: " + ds.getLocalPort() + ", ds.port: " + ds.getPort() + ", address: " + ds.getInetAddress()); Reciever r = new Reciever(ds); r.start(); } catch (Exception e) { e.printStackTrace(); } setDefaultCloseOperation(EXIT_ON_CLOSE); getContentPane().add(p, BorderLayout.CENTER); setSize(640, 480); setVisible(true); } public static void main(String[] args) { int x = 0; for (String s : args){ if (x==0){ localport = Integer.parseInt(s); x++; } else if (x==1){ host = s; x++; } else if (x==2){ port = Integer.parseInt(s); } } Draw d = new Draw(localport, host, port); } } class Paper extends JPanel { DatagramSocket ds; private HashSet hs = new HashSet(); public Paper(DatagramSocket ds) { this.ds=ds; setBackground(Color.white); addMouseListener(new L1(ds)); addMouseMotionListener(new L2()); } public void paintComponent(Graphics g) { super.paintComponent(g); g.setColor(Color.black); Iterator i = hs.iterator(); while(i.hasNext()) { Point p = (Point)i.next(); g.fillOval(p.x, p.y, 2, 2); } } private void addPoint(Point p) { hs.add(p); repaint(); } class L1 extends MouseAdapter { DatagramSocket ds; public L1(DatagramSocket ds){ this.ds=ds; } public void mousePressed(MouseEvent me) { addPoint(me.getPoint()); Point p = me.getPoint(); String message = Integer.toString(p.x) + " " + Integer.toString(p.y); System.out.println(message); try{ byte[] data = message.getBytes("UTF-8"); //InetAddress ia = InetAddress.getByName(ds.host); String convertedMessage = new String(data, "UTF-8"); System.out.println("The converted string is " + convertedMessage); DatagramPacket dp = new DatagramPacket(data, data.length); System.out.println(ds.getPort()); //System.out.println(message); //System.out.println(ds.toString()); //ds.send(dp); /*System.out.println("2Sending a packet containing data: " +data +" to " + ia + ":" + d.port + "...");*/ } catch (Exception e){ e.printStackTrace(); } } } class L2 extends MouseMotionAdapter { public void mouseDragged(MouseEvent me) { addPoint(me.getPoint()); Point p = me.getPoint(); String message = Integer.toString(p.x) + " " + Integer.toString(p.y); //System.out.println(message); } } } class Reciever extends Thread{ DatagramSocket ds; byte[] buffer; Reciever(DatagramSocket ds){ this.ds = ds; buffer = new byte[65507]; } public void run(){ try { DatagramPacket packet = new DatagramPacket(buffer, buffer.length); while(true){ try { ds.receive(packet); String s = new String(packet.getData()); System.out.println(s); } catch (Exception e) { e.printStackTrace(); } } } catch (Exception e) { e.printStackTrace(); } } }

    Read the article

  • input file cannot be found

    - by Eric Smith
    I am just messing around with reading input files with java until I got stumped at the most basic of steps... finding the input file! The input.txt file is in the same directory as my class file that is calling it yet eclipse still gives me an error that it cant be found: "Exception in thread "main" java.lang.Error: Unresolved compilation problem: Unhandled exception type FileNotFoundException" My code: package pa; import java.util.Scanner; public class Project { public static void main(String[] args) { java.io.File file = new java.io.File("input.txt"); System.out.println(file.getAbsolutePath()); Scanner input = new Scanner(file); } } input.txt is in the same package, same folder and everything. I'm confused :(

    Read the article

  • Loading embedded resource on Windows 7

    - by Flack
    Hello, I have an app that works just fine on my WinXP machine. However, when I try running it on my Win7 machine, it fails whenever it tries to load an embedded resource. The resources are all there (I can see them using Reflector). The lines that fail are all of the form: Splash.Image = new Bitmap(typeof(ContainerForm).Assembly.GetManifestResourceStream("SplashTest.Resources.Logo.gif")); And they all fail with the same exception: Exception='System.ArgumentException: Parameter is not valid. at System.Drawing.Bitmap..ctor(Stream stream) I don't understand why this is not working on my Win7 machine but does on my usual WinXP dev machine. Any ideas?

    Read the article

  • jQuery effect on iframe parent document

    - by Jabes88
    Just wondering if anyone else has experienced this or knows why I am getting an error. I'm using javascript from within an iframe to call a parent dom element then use jQuery UI's effect core to shake it. Here is an example: $(document).ready(function(){ if ($("form").length>0) { $("form").submit(function(){ var oParentDoc = $(parent.document).find("div#element"); var action = $(this).attr("action"); var postdata = $(this).serialize(); $(oParentDoc).addClass("loading"); $.post(action,postdata,function(data){ $(oParentDoc).removeClass("loading").effect("shake",{"times":3,"distance":10},60); }); return false; }); } }); It works without the effect, but when I use an effect it gives me this error: uncaught exception: [Exception... "Component returned failure code: 0x80040111 (NS_ERROR_NOT_AVAILABLE) [nsIDOMCSSStyleDeclaration.getPropertyValue]" nsresult: "0x80040111 (NS_ERROR_NOT_AVAILABLE)" Thanks in advance for any insight :)

    Read the article

  • mpasdlta files -- what are they?

    - by Tmdean
    I noticed a bunch of folders in the root of my hard drive named with a string of hex digits that contain files named with a GUID ending with "mpasdlta.vdm" and "mpavdlta.vdm". From some Googling, I've determined that these files are spyware and virus definition files used by Microsoft Security Essentials. Are these files safe to delete? (Why doesn't Microsoft follow their own guidelines and store application data in the folders intended for that purpose? grumble grumble)

    Read the article

  • Adding/removing session variables on Page OnInit/OnLoad in C#

    - by MKS
    Hi Guys, I am using C#. I am having below code in C#: protected override void OnInit(EventArgs e) { try { if (Session["boolSignOn"].ToString() == "true".ToString()) { lblPanelOpen.Text = Session["panelOpen"].ToString(); } else { lblPanelOpen.Text = Session["panelOpen"].ToString(); } } catch (Exception ex) { Logger.Error("Error processing request:" + ex.Message); } } protected override void OnLoad(EventArgs e) { try { if (!string.IsNullOrEmpty(Session["panelOpen"].ToString())) { lblPanelOpen.Text = string.Empty; Session.Remove("panelOpen"); } } catch (Exception ex) { Logger.Error("Unable to remove the session variable:" + ex.Message); } } In above code I am having a Session["panelOpen"] variable which is created from another user control and once my page is trying to render, I am storing Session["panelOpen"] in my hidden lblPanelOpen.Text on page OnInit() method, however when page is loaded completely then I am trying to remove the session variable. Please suggest!

    Read the article

  • Resizing uploaded files in django using PIL

    - by Nikunj
    I am using PIL to resize an uploaded file using this method: def resize_uploaded_image(buf): imagefile = StringIO.StringIO(buf.read()) imageImage = Image.open(imagefile) (width, height) = imageImage.size (width, height) = scale_dimensions(width, height, longest_side=240) resizedImage = imageImage.resize((width, height)) return resizedImage I then use this method to get the resizedImage in my main view method: image = request.FILES['avatar'] resizedImage = resize_uploaded_image(image) content = django.core.files.File(resizedImage) acc = Account.objects.get(account=request.user) acc.avatar.save(image.name, content) However, this gives me the 'read' error. Trace: Exception Type: AttributeError at /myapp/editAvatar Exception Value: read Any idea how to fix this? I have been at it for hours! Thanks! Nikunj

    Read the article

  • Win7: could not find item upon creation?

    - by FLX
    Hello, I'm getting the following error every time I try to create a folder: http://flx.me/imgdump/flx457.png When I press try again it actually does create it. So far I did a complete disk check of C:\ and I've tried safe mode. Both result in the same error. Any ideas? Thanks, Dennis

    Read the article

  • Wiping a laptop from Bios

    - by joshuahornby10
    I am trying to wipe an old laptops hard drive, it doesn't have a CD drive so have been using a USB to try and wipe the hard drive from the BIOS. I have been using http://www.dban.org/ which I installed as an ISO on the USB Stick. When ever I try to boot into this I get an error saying 'No operating system' Does anyone know of a way to wipe a hard drive? I also tried to boot into safe mode but I just stay on a constant loop. Thanks

    Read the article

  • unique_ptr boost equivalent?

    - by wowus
    Is there some equivalent class for C++1x's std::unique_ptr in the boost libraries? The behavior I'm looking for is being able to have an exception-safe factory function, like so... std::unique_ptr<Base> create_base() { return std::unique_ptr<Base>(new Derived); } void some_other_function() { std::unique_ptr<Base> b = create_base(); // Do some stuff with b that may or may not throw an exception... // Now b is destructed automagically. }

    Read the article

  • How to document thrown exceptions in c#/.net

    - by Arnold Zokas
    I am currently writing a small framework that will be used internally by other developers within the company. I want to provide good Intellisense information, but I am not sure how to document thrown exceptions. In the following example: public void MyMethod1() { MyMethod2(); // also may throw InvalidOperationException } public void MyMethod2() { System.IO.File.Open(somepath...); // this may throw FileNotFoundException // also may throw DivideByZeroException } I know the markup for documenting exceptions is: /// <exception cref="SomeException">when things go wrong.</exception> What I don't understand is how to document exceptions thrown by code called by MyMethod1()? Should I document exceptions thrown by MyMethod2() Should I document exceptions thrown by File.Open() ? What would be the best way to document possible exceptions?

    Read the article

  • Letters seem to be rendered incorrectly in Firefox

    - by BloodPhilia
    So, when I'm browsing in firefox, some letters look grainy or glowing, does anyone know what might be causing this? It doesn't show on all websites, only some. It almost looks like Firefox is trying to render different font colours on top of each other and blends them in the process somehow. Using Firefox 3.6.13 on Windows 7 Ultimate 64 bits and the problems also arrise when running Firefox in safe mode. http://facelift.mawhorter.net/ (top menu) IE 8: FF 3: https://student.ru.nl/portal/dt (center notification) IE 8: FF 3:

    Read the article

  • Different kinds of doubles in vb.net?

    - by Jonathan
    Hey all- I'm using QBFC to generate invoices in a Quickbooks integrating app. I'm getting an exception thrown for lineItem.Amount.SetValue(val as Double) when I try to enter a programmatically generated double. The following does not work: lineItem = invoice.ORInvoiceLineAddList.Append.InvoiceLineAdd Dim amount as Double amount = summary.dailySold * summary.dailyRate loggingTxtBox.AppendText("Amount is " & amount & vbNewLine) lineItem.Amount.SetValue(amount) The exception I receive is System.Runtime.InteropServices.COMException (0x80040305): Invalid Amount format. at Interop.QBFC8.IQBAmountType.SetValue(Double val) The following works: lineItem.Amount.SetValue(20.3) Any suggestions? Is .NET interpretting a hard-coded double differently than a programmatically calculated one? Thanks- Jonathan

    Read the article

  • Class Destructor Problem

    - by user279691
    I am making a simple class that contains a StreamWrite class Logger { private StreamWriter sw; private DateTime LastTime; public Logger(string filename) { LastTime = DateTime.Now; sw = new StreamWriter(filename); } public void Write(string s) { sw.WriteLine((DateTime.Now-LastTime).Ticks/10000+":"+ s); LastTime = DateTime.Now; } public void Flush() { sw.Flush(); } ~Logger() { sw.Close();//Raises Exception! } } But when I close this StreamWriter in the destructor, it raises an exception that the StreamWriter was already deleted? Why? And how to make it work such that when the Logger class is deleted, the StreamWriter is closed before deletion? Thanks!

    Read the article

  • SWT Composite consructor throws IllegalArgumentException on a non-null argument

    - by Alexey Romanov
    This piece of code (in Scala) val contents = { assert(mainWindow.detailsPane != null) new Composite(mainWindow.detailsPane, SWT.NONE) } throws an exception: Exception occurred java.lang.IllegalArgumentException: Argument not valid at org.eclipse.swt.SWT.error(Unknown Source) at org.eclipse.swt.SWT.error(Unknown Source) at org.eclipse.swt.SWT.error(Unknown Source) at org.eclipse.swt.widgets.Widget.error(Unknown Source) at org.eclipse.swt.widgets.Widget.checkParent(Unknown Source) at org.eclipse.swt.widgets.Widget.<init>(Unknown Source) at org.eclipse.swt.widgets.Control.<init>(Unknown Source) at org.eclipse.swt.widgets.Scrollable.<init>(Unknown Source) at org.eclipse.swt.widgets.Composite.<init>(Unknown Source) at main.scala.NodeViewPresenter$NodeViewImpl.<init>(NodeViewPresenter.scala:41) According to the documentation, IllegalArgumentException should only be thrown when the parent is null, but I am checking for that. detailsPane is a CTabFolder. Can anybody say why this could happen?

    Read the article

  • how to filter data from xml file for displaying only selected as nodes in treeview

    - by michale
    I have an xml file named "books.xml" provided in the link "http://msdn.microsoft.com/en-us/library/windows/desktop/ms762271(v=vs.85).aspx". What my requirement was to disaplay only the <title> from xml information as nodes in tree view. But when i did the following coding its displaying all the values as nodes like "catalog" as rootnode, book as parent node for all then author,title,genre etc as nodes but i want only root node catalogue and title as nodes not even book. Can any body guide me what modification i need to do in the exisitng logic for displaying title as nodes OpenFileDialog dlg = new OpenFileDialog(); dlg.Title = "Open XML document"; dlg.Filter = "XML Files (*.xml)|*.xml"; dlg.FileName = Application.StartupPath + "\\..\\..\\Sample.xml"; if (dlg.ShowDialog() == DialogResult.OK) { try { //Just a good practice -- change the cursor to a //wait cursor while the nodes populate this.Cursor = Cursors.WaitCursor; //First, we'll load the Xml document XmlDocument xDoc = new XmlDocument(); xDoc.Load(dlg.FileName); //Now, clear out the treeview, //and add the first (root) node treeView1.Nodes.Clear(); treeView1.Nodes.Add(new TreeNode(xDoc.DocumentElement.Name)); TreeNode tNode = new TreeNode(); tNode = (TreeNode)treeView1.Nodes[0]; //We make a call to addTreeNode, //where we'll add all of our nodes addTreeNode(xDoc.DocumentElement, tNode); //Expand the treeview to show all nodes treeView1.ExpandAll(); } catch (XmlException xExc) //Exception is thrown is there is an error in the Xml { MessageBox.Show(xExc.Message); } catch (Exception ex) //General exception { MessageBox.Show(ex.Message); } finally { this.Cursor = Cursors.Default; //Change the cursor back } }} //This function is called recursively until all nodes are loaded private void addTreeNode(XmlNode xmlNode, TreeNode treeNode) { XmlNode xNode; TreeNode tNode; XmlNodeList xNodeList; if (xmlNode.HasChildNodes) //The current node has children { xNodeList = xmlNode.ChildNodes; for (int x = 0; x <= xNodeList.Count - 1; x++) //Loop through the child nodes { xNode = xmlNode.ChildNodes[x]; treeNode.Nodes.Add(new TreeNode(xNode.Name)); tNode = treeNode.Nodes[x]; addTreeNode(xNode, tNode); } } else //No children, so add the outer xml (trimming off whitespace) treeNode.Text = xmlNode.OuterXml.Trim(); }

    Read the article

  • What happened to my EEE PC keyboard?

    - by etheros
    I was using my EEE PC 1000H running Windows XP and out of the blue, the keyboard stopped working - pressing keys does absolutely nothing. It does not appear to be a hardware issue, as I am able to enter BIOS configuration with no issues. I've tried: 'Safe mode' 'Last known good configuration' Reinstalling the generic keyboard driver Removing all power sources and holding down the power button, as suggested by popular forums. What could the problem be, and what could I try?

    Read the article

< Previous Page | 202 203 204 205 206 207 208 209 210 211 212 213  | Next Page >