Search Results

Search found 21155 results on 847 pages for 'free space'.

Page 210/847 | < Previous Page | 206 207 208 209 210 211 212 213 214 215 216 217  | Next Page >

• Variable length Blob in hibernate?

  - by Seth

  I have a byte[] member in one of my persistable classes. Normally, I'd just annotate it with @Lob and @Column(name="foo", size=). In this particular case, however, the length of the byte[] can vary a lot (from ~10KB all the way up to ~100MB). If I annotate the column with a size of 128MB, I feel like I'll be wasting a lot of space for the small and mid-sized objects. Is there a variable length blob type I can use? Will hibernate take care of all of this for me behind the scenes without wasting space? What's the best way to go about this? Thanks!

  Read the article

• increasing amazon root volume size

  - by OCD

  I have a default amazon ec2 instance with 8GB root volume size. I am running out of space. I have: Detach the current EBS volume in AWS Management Console (Web). Create snapshot of this volume. Created a new Volume with 50G space with my snapshot. Attach the new volume back to the instance to /dev/sda1 However, when I reconnect to the account with: > df -h I can see from the management console that my new Filesystem 1K-blocks Used Available Use% Mounted on /dev/xvda1 8256952 8173624 0 100% / tmpfs 308508 40 308468 1% /dev/shm It's still not using my new volume's size, how to make this work?

  Read the article

• Way to get VS 2008 to stop forcing indentation on namespaces?

  - by Earlz

  I've never really been a big fan of the way most editors handle namespaces. They always force you to add an extra pointless level of indentation. For instance, I have a lot of code in a page that I would much rather prefer formatted as namespace mycode{ class myclass{ void function(){ foo(); } void foo(){ bar(); } void bar(){ //code.. } } } and not something like namespace mycode{ class myclass{ void function(){ foo(); } void foo(){ bar(); } void bar(){ //code.. } } } Honestly, I don't really even like the class thing being indented most of the time because I usually only have 1 class per file. And it doesn't look as bad here, but when you get a ton of code and lot of scopes, you can easily have indentation that forces you off the screen, and plus here I just used 2-space tabs and not 4-space as is used by us. Anyway, is there some way to get Visual Studio to stop trying to indent namespaces for me like that?

  Read the article

• jquery ui modal dialog problems in IE

  - by JohnM2

  I use jquery ui dialog widget. Everything works fine in FF, Opera etc., except IE. The problem is that when dialog is opened in Internet Explorer, some space (not covered with that "modal gray layer") is added at the bottom of the document, and page is scrolled to the bottom. So I don't even see the dialog, I have to scroll up, to see it fully. Anyone had that problems? Any solutions? EDIT: now I see, that this "bottom space" is also added in FireFox, but it doesn't scroll to it like in IE.

  Read the article

• What Regex can strip e.g. "note:" and "firstName: " from the left of a string?

  - by Edward Tanguay

  I need to strip the "label" off the front of strings, e.g. note: this is a note needs to return: note and this is a note I've produced the following code example but am having trouble with the regexes. What code do I need in the two ???????? areas below so that I get the desired results shown in the comments? using System; using System.Collections.Generic; using System.Linq; using System.Text; using System.Text.RegularExpressions; namespace TestRegex8822 { class Program { static void Main(string[] args) { List<string> lines = new List<string>(); lines.Add("note: this is a note"); lines.Add("test: just a test"); lines.Add("test:\t\t\tjust a test"); lines.Add("firstName: Jim"); //"firstName" IS a label because it does NOT contain a space lines.Add("She said this to him: follow me."); //this is NOT a label since there is a space before the colon lines.Add("description: this is the first description"); lines.Add("description:this is the second description"); //no space after colon lines.Add("this is a line with no label"); foreach (var line in lines) { Console.WriteLine(StringHelpers.GetLabelFromLine(line)); Console.WriteLine(StringHelpers.StripLabelFromLine(line)); Console.WriteLine("--"); //note //this is a note //-- //test //just a test //-- //test //just a test //-- //firstName //Jim //-- // //She said this to him: follow me. //-- //description //this is the first description //-- //description //this is the first description //-- // //this is a line with no label //-- } Console.ReadLine(); } } public static class StringHelpers { public static string GetLabelFromLine(this string line) { string label = line.GetMatch(@"^?:(\s)"); //??????????????? if (!label.IsNullOrEmpty()) return label; else return ""; } public static string StripLabelFromLine(this string line) { return ...//??????????????? } public static bool IsNullOrEmpty(this string line) { return String.IsNullOrEmpty(line); } } public static class RegexHelpers { public static string GetMatch(this string text, string regex) { Match match = Regex.Match(text, regex); if (match.Success) { string theMatch = match.Groups[0].Value; return theMatch; } else { return null; } } } }

  Read the article

• HDFS some datanodes of cluster are suddenly disconnected while reducers are running

  - by user1429825

  I have 8 slave computers and 1 master computer for running Hadoop (ver 0.21) some datanodes of cluster are suddenly disconnected while I was running MapReduce code on 10GB data After all mappers finished and around 80% of reducers was processed, randomly one or more datanode disconned from network. and then the other datanodes start to disappear from network even if I killed the MapReduce job when I found some datanode was disconnected. I've tried to change dfs.datanode.max.xcievers to 4096, turned off fire-walls of all computing node, disabled selinux and increased the number of file open limit to 20000 but they didn't work at all... anyone have a idea to solve this problem? followings are error log from mapreduce 12/06/01 12:31:29 INFO mapreduce.Job: Task Id : attempt_201206011227_0001_r_000006_0, Status : FAILED java.io.IOException: Bad connect ack with firstBadLink as ***.***.***.148:20010 at org.apache.hadoop.hdfs.DFSOutputStream$DataStreamer.createBlockOutputStream(DFSOutputStream.java:889) at org.apache.hadoop.hdfs.DFSOutputStream$DataStreamer.nextBlockOutputStream(DFSOutputStream.java:820) at org.apache.hadoop.hdfs.DFSOutputStream$DataStreamer.run(DFSOutputStream.java:427) and followings are logs from datanode 2012-06-01 13:01:01,118 INFO org.apache.hadoop.hdfs.server.datanode.DataNode: Receiving block blk_-5549263231281364844_3453 src: /*.*.*.147:56205 dest: /*.*.*.142:20010 2012-06-01 13:01:01,136 INFO org.apache.hadoop.hdfs.server.datanode.DataNode: DatanodeRegistration(*.*.*.142:20010, storageID=DS-1534489105-*.*.*.142-20010-1337757934836, infoPort=20075, ipcPort=20020) Starting thread to transfer block blk_-3849519151985279385_5906 to *.*.*.147:20010 2012-06-01 13:01:19,135 WARN org.apache.hadoop.hdfs.server.datanode.DataNode: DatanodeRegistration(*.*.*.142:20010, storageID=DS-1534489105-*.*.*.142-20010-1337757934836, infoPort=20075, ipcPort=20020):Failed to transfer blk_-5797481564121417802_3453 to *.*.*.146:20010 got java.net.ConnectException: > Connection timed out at sun.nio.ch.SocketChannelImpl.checkConnect(Native Method) at sun.nio.ch.SocketChannelImpl.finishConnect(SocketChannelImpl.java:701) at org.apache.hadoop.net.SocketIOWithTimeout.connect(SocketIOWithTimeout.java:206) at org.apache.hadoop.net.NetUtils.connect(NetUtils.java:373) at org.apache.hadoop.hdfs.server.datanode.DataNode$DataTransfer.run(DataNode.java:1257) at java.lang.Thread.run(Thread.java:722) 2012-06-01 13:06:20,342 INFO org.apache.hadoop.hdfs.server.datanode.DataBlockScanner: Verification succeeded for blk_6674438989226364081_3453 2012-06-01 13:09:01,781 WARN org.apache.hadoop.hdfs.server.datanode.DataNode: DatanodeRegistration(*.*.*.142:20010, storageID=DS-1534489105-*.*.*.142-20010-1337757934836, infoPort=20075, ipcPort=20020):Failed to transfer blk_-3849519151985279385_5906 to *.*.*.147:20010 got java.net.SocketTimeoutException: 480000 millis timeout while waiting for channel to be ready for write. ch : java.nio.channels.SocketChannel[connected local=/*.*.*.142:60057 remote=/*.*.*.147:20010] at org.apache.hadoop.net.SocketIOWithTimeout.waitForIO(SocketIOWithTimeout.java:246) at org.apache.hadoop.net.SocketOutputStream.waitForWritable(SocketOutputStream.java:164) at org.apache.hadoop.net.SocketOutputStream.transferToFully(SocketOutputStream.java:203) at org.apache.hadoop.hdfs.server.datanode.BlockSender.sendChunks(BlockSender.java:388) at org.apache.hadoop.hdfs.server.datanode.BlockSender.sendBlock(BlockSender.java:476) at org.apache.hadoop.hdfs.server.datanode.DataNode$DataTransfer.run(DataNode.java:1284) at java.lang.Thread.run(Thread.java:722) hdfs-site.xml <configuration> <property> <name>dfs.name.dir</name> <value>/home/hadoop/data/name</value> </property> <property> <name>dfs.data.dir</name> <value>/home/hadoop/data/hdfs1,/home/hadoop/data/hdfs2,/home/hadoop/data/hdfs3,/home/hadoop/data/hdfs4,/home/hadoop/data/hdfs5</value> </property> <property> <name>dfs.replication</name> <value>3</value> </property> <property> <name>dfs.datanode.max.xcievers</name> <value>4096</value> </property> <property> <name>dfs.http.address</name> <value>0.0.0.0:20070</value> <description>50070 The address and the base port where the dfs namenode web ui will listen on. If the port is 0 then the server will start on a free port. </description> </property> <property> <name>dfs.datanode.http.address</name> <value>0.0.0.0:20075</value> <description>50075 The datanode http server address and port. If the port is 0 then the server will start on a free port. </description> </property> <property> <name>dfs.secondary.http.address</name> <value>0.0.0.0:20090</value> <description>50090 The secondary namenode http server address and port. If the port is 0 then the server will start on a free port. </description> </property> <property> <name>dfs.datanode.address</name> <value>0.0.0.0:20010</value> <description>50010 The address where the datanode server will listen to. If the port is 0 then the server will start on a free port. </description> <property> <name>dfs.datanode.ipc.address</name> <value>0.0.0.0:20020</value> <description>50020 The datanode ipc server address and port. If the port is 0 then the server will start on a free port. </description> </property> <property> <name>dfs.datanode.https.address</name> <value>0.0.0.0:20475</value> </property> <property> <name>dfs.https.address</name> <value>0.0.0.0:20470</value> </property> </configuration> mapred-site.xml <configuration> <property> <name>mapred.job.tracker</name> <value>masternode:29001</value> </property> <property> <name>mapred.system.dir</name> <value>/home/hadoop/data/mapreduce/system</value> </property> <property> <name>mapred.local.dir</name> <value>/home/hadoop/data/mapreduce/local</value> </property> <property> <name>mapred.map.tasks</name> <value>32</value> <description> default number of map tasks per job.</description> </property> <property> <name>mapred.tasktracker.map.tasks.maximum</name> <value>4</value> </property> <property> <name>mapred.reduce.tasks</name> <value>8</value> <description> default number of reduce tasks per job.</description> </property> <property> <name>mapred.map.child.java.opts</name> <value>-Xmx2048M</value> </property> <property> <name>io.sort.mb</name> <value>500</value> </property> <property> <name>mapred.task.timeout</name> <value>1800000</value> <!-- 30 minutes --> </property> <property> <name>mapred.job.tracker.http.address</name> <value>0.0.0.0:20030</value> <description> 50030 The job tracker http server address and port the server will listen on. If the port is 0 then the server will start on a free port. </description> </property> <property> <name>mapred.task.tracker.http.address</name> <value>0.0.0.0:20060</value> <description> 50060 </property> </configuration>

  Read the article

• Design PDF template and populate data at runtime using java,xml etc..

  - by Samant

  well i have been looking for a java based PDF solutions...we dont have a clean way i guess-still.. all solutions are primitive and kind of workarounds... No easy solution for this requirement - 1. Designing a PDF template using a IDE (eg. Livecycle designer ..which is not free) 2. Then at runtime using java, populate data into this PDF template...either using xml or other datasources... such a simple requirement and NONE has a good "open-source and free" solution yet ! Is anyone aware of any ? I have been searching for since 3-4 years now..for a clean way out... Eclipse BIRT comes close.. but does not handle Barcode elements ..OOB. Jasper - ireport is also good but that tool does not have a table concept and is kind of annoying ! Also barcode support is not good. XSL-FO has not free IDE for design . Looking for a better answer .. got one ?

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• SQL: ATER COLUMN to shorter CHAR(n) type

  - by Rising Star

  I'm working with MS SQL SERVER 2003. I want to change a column in one of my tables to have fewer characters in the entries. This is identical to this question: http://stackoverflow.com/questions/2281336/altering-a-table-column-to-accept-more-characters except for the fact that I want fewer characters instead of more. I have a column in one of my tables that holds nine-digit entries. A developer previously working on the table mistakenly set the column to hold ten-digit entries. I need to change the type from CHAR(10) to CHAR(9). Following the instructions from the discussion linked above, I wrote the statement ALTER TABLE [MY_TABLE] ALTER COLUMN [MY_COLUMN] CHAR(9); This returns the error message "String or binary data would be truncated". I see that my nine-digit strings have a space appended to make them ten digits. How do I tell SQL Server to discard the extra space and convert my column to a CHAR(9) type?

  Read the article

• Portable way of finding total disk size in Java (pre java 6)

  - by Wouter Lievens

  I need to find the total size of a drive in Java 5 (or 1.5, whatever). I know that Java 6 has a new method in java.io.File, but I need it to work in Java 5. Apache Commons IO has org.apache.commons.io.FileSystemUtils to provide the free disk space, but not the total disk space. I realize this is OS dependant and will need to depend on messy command line invocation. I'm fine with it working on "most" systems, i.e. windows/linux/macosx. Preferably I'd like to use an existing library rather than write my own variants. Any thoughts? Thanks.

  Read the article

• Building Paypal based membership website - total noob - would appreciate help

  - by Ali

  this is a follow up on my question on paypal integration. I'm working ona membership site for racing fans. My membership site has 3 membership levels - free, gold and premium. When a user signs up he/she can gets a free membership on the spot but has the option to upgrade to a gold membership for 4 Dollars a month or a premium membership for 10 Dollars a month. I've gone through the paypal integration guide a few times though and have a vague understanding of how to get this to work. I think the recurring payments option would be fine enough - however I don't know how do I implement this in my system. Like when a user decides to go for a paid account i.e. Gold or premium from basic - what should I do on both my code side and on the paypal account side - I'd really appreciate if anyone would outline what I'd have to do here. Plus when a user decides to upgrade from lets say a Gold to a premium account - there is the issue of computing how much should be charged to upgrade his/her account eg: a user has been billed for 4 dollars and the next day opts to go for a premium account so assuming that the surplus for the rest of the month is 5 dollars and further from that all payments would be recurring 10 dollars monthly - how do I implement this? And in case a user decides to downgrade from a premium account of 10 dollars a month to a gold account of 4 dollars a month - how do I handle the surplus which would have to be refunded for that month alone and changing the membership? And like wise if someone wishes to cancel membership and go to having a free account - how do I refund whatever is owed and cancel the subscription. I'm sorry if it sounds like I'm asking to be spoon fed :( I'm quite new to this and this is for a client and I would really appreciate all the help here and really have to get this working right. Thanks again everyone - waiting for all your replies.

  Read the article

• HTML list wrapping problem

  - by Daniel

  I have a HTML list with this style: font-weight: bold; padding: 0px; margin: 0px; list-style-type: none; display: block; width:700px; font-size: 14px; white-space: pre-wrap; and the cells have this style: display: inline; and I have spacer cells between each cell with this style: padding-right: 20px; display: inline; My problem is that when the list is too long for its 700 pixels, it wraps. I want this, but I dont want the objects to be on two separate lines. I have tried the CSS white-space property, but nothing seems to work. Any ideas?

  Read the article

• how Can we get the output format to CSV instead of HTML in Alfresco using webscripts?

  - by pavan123

  how Can we change the output format to CSV instead of HTML in Alfresco using webscripts? below are the my corresponding FTL and Webscript files recursive.get.html.ftl <#macro recurse_macro node depth> <#if node.isContainer> <tr> <td> ${node.properties.name} </td> <td></td> </tr> <#list node.children as child> <#if child.isContainer> <@recurse_macro node=child depth=depth+1/> <#list child.children as child2> <#if child2.isDocument> <tr><td></td><td>${child2.properties.name}</td></tr> </#if> </#list> </#if> </#list> </#if> </#macro> Recursive Listing of Spaces & Documents: Space Document recursive.get.desc.xml <webscript> <shortname>recurcive</shortname> <description>Recursive</description> <url>/sample/recursive/{recursive}</url> <format default="html">extension</format> <authentication>guest</authentication> </webscript> and html output is Recursive Listing of Spaces & Documents: Space Document Company Home Data Dictionary Space Templates Software Engineering Project Documentation Drafts Pending Approval Published Samples system-overview.html Discussions UI Design Presentations Quality Assurance Presentation Templates doc_info.ftl localizable.ftl my_docs.ftl my_spaces.ftl my_summary.ftl translatable.ftl recent_docs.ftl general_example.ftl my_docs_inline.ftl show_audit.ftl readme.ftl Email Templates notify_user_email.ftl invite_user_email.ftl RSS Templates RSS_2.0_recent_docs.ftl Saved Searches admin Scripts backup.js example test script.js backup and log.js append copyright.js alfresco docs.js test return value.js Web Scripts org alfresco sample blogsearch.get.js blogsearch.get.atom.ftl blogsearch.get.desc.xml blogsearch.get.html.ftl blogsearch.get.html.400.ftl blogsearch.get.atom.400.ftl categorysearch.get.js categorysearch.get.atom.ftl categorysearch.get.desc.xml categorysearch.get.html.ftl categorysearch.get.html.404.ftl categorysearch.get.atom.404.ftl folder.get.js folder.get.atom.ftl folder.get.desc.xml folder.get.html.ftl avmstores.get.desc.xml avmstores.get.html.ftl avmbrowse.get.js avmbrowse.get.desc.xml avmbrowse.get.html.ftl recursive.get.desc.xml recursive.get.html.ftl sgs.get.desc.xml sgs.get.csv.ftl sample1.get.desc.xml sample1.get.csv.ftl first.get.desc.xml first.get.text.ftl rag.get.html.ftl rag.get.desc.xml new1.get.desc.xml new1.get.html.ftl excel.get.html.ftl excel.get.desc.xml sgs1.get.desc.xml one.get.html.ftl one.get.desc.xml one.get.js readme.html Web Scripts Extensions readme.html Guest Home Alfresco-Tutorial.pdf User Homes isabel Users Home

  Read the article

• Licensing iPhone apps per user in existing system

  - by Alxandr

  I've been asked by my job to write a iPhone app for an existing system for managing worktasks. This system is proprietary and costs money, so in order to login you need to be a customer. Now, I've got two questions about the legality of licensing iPhone apps with this system: My company would like to be able to sell the app for profit, but not as a one-time payment, but as a added subscription-fee to the already existing one. Is it legal for us (according with the terms of distributing an iPhone app on the Apple App Store) to do this? That way we'll just add another field to the users-database saying weather or not iPhone is enabled for them, and distribute the app as a free app on App Store. If the previous question is not legal, we'd like to just create a free app and distribute it as part of the existing system. In other words, no extra fee for using the iPhone app for the users, but still free distribution trough App Store. Due to our company not being american or having an office in the U.S. at all enterprice account is not an option. Please let me know if there is anything wrong with any of the above approaches.

  Read the article

• Error in Print Function in Bubble Sort MIPS?

  - by m00nbeam360

  Sorry that this is such a long block of code, but do you see any obvious syntax errors in this? I feel like the problem is that the code isn't printing correctly since the sort and swap methods were from my textbook. Please help if you can! .data save: .word 1,2,4,2,5,6 size: .word 6 .text swap: sll $t1, $a1, 2 #shift bits by 2 add $t1, $a1, $t1 #set $t1 address to v[k] lw $t0, 0($t1) #load v[k] into t1 lw $t2, 4($t1) #load v[k+1] into t1 sw $t2, 0($t1) #swap addresses sw $t0, 4($t1) #swap addresses jr $ra #return sort: addi $sp, $sp, -20 #make enough room on the stack for five registers sw $ra, 16($sp) #save the return address on the stack sw $s3, 12($sp) #save $s3 on the stack sw $s2, 8($sp) #save Ss2 on the stack sw $s1, 4($sp) #save $s1 on the stack sw $s0, 0($sp) #save $s0 on the stack move $s2, $a0 #copy the parameter $a0 into $s2 (save $a0) move $s3, $a1 #copy the parameter $a1 into $s3 (save $a1) move $s0, $zero #start of for loop, i = 0 for1tst: slt $t0, $s0, $s3 #$t0 = 0 if $s0 S $s3 (i S n) beq $t0, $zero, exit1 #go to exit1 if $s0 S $s3 (i S n) addi $s1, $s0, -1 #j - i - 1 for2tst: slti $t0, $s1, 0 #$t0 = 1 if $s1 < 0 (j < 0) bne $t0, $zero, exit2 #$t0 = 1 if $s1 < 0 (j < 0) sll $t1, $s1, 2 #$t1 = j * 4 (shift by 2 bits) add $t2, $s2, $t1 #$t2 = v + (j*4) lw $t3, 0($t2) #$t3 = v[j] lw $t4, 4($t2) #$t4 = v[j+1] slt $t0, $t4, $t3 #$t0 = 0 if $t4 S $t3 beq $t0, $zero, exit2 #go to exit2 if $t4 S $t3 move $a0, $s2 #1st parameter of swap is v(old $a0) move $a1, $s1 #2nd parameter of swap is j jal swap #swap addi $s1, $s1, -1 j for2tst #jump to test of inner loop j print exit2: addi $s0, $s0, 1 #i = i + 1 j for1tst #jump to test of outer loop exit1: lw $s0, 0($sp) #restore $s0 from stack lw $s1, 4($sp) #resture $s1 from stack lw $s2, 8($sp) #restore $s2 from stack lw $s3, 12($sp) #restore $s3 from stack lw $ra, 16($sp) #restore $ra from stack addi $sp, $sp, 20 #restore stack pointer jr $ra #return to calling routine .data space:.asciiz " " # space to insert between numbers head: .asciiz "The sorted numbers are:\n" .text print:add $t0, $zero, $a0 # starting address of array add $t1, $zero, $a1 # initialize loop counter to array size la $a0, head # load address of print heading li $v0, 4 # specify Print String service syscall # print heading out: lw $a0, 0($t0) # load fibonacci number for syscall li $v0, 1 # specify Print Integer service syscall # print fibonacci number la $a0, space # load address of spacer for syscall li $v0, 4 # specify Print String service syscall # output string addi $t0, $t0, 4 # increment address addi $t1, $t1, -1 # decrement loop counter bgtz $t1, out # repeat if not finished jr $ra # return

  Read the article

• Internet Explorer changes brightness

  - by Sale

  I have a very annoying problem with IE8 on Vista: My screen brightness changes when I view a page with IE. It slowly dimms brightness some 20% - enough to be noticeable. This seems to be dependent on the OVERALL brightness of the page viewed or of the amount of bright space on the page... sometimes it dimms down if the page is bright, sometimes the complete different, it dimms when lot of dark space is on the page. I know this sounds weird, I cannot describe it better. It takes about one,two seconds from on brightness level to the other. This ONLY occurs in IE - not in Word or any other application. Please help! This dimming is very stressfull for my eyes.

  Read the article

• Shrink database after removing extra data

  - by Sergey Osypchuk

  We have a need to fit database in 4G in order to use ms sql express edition. I started from 7G database, and found a lot of not needed records, and deleted them. After Shrink database size is 4.6G, and 748MB is free (according to database properties). However, when i execute exec sp_spaceused i am having interesting results: DatabaseName Database_size unallocation space xxxxxx 4726.50 MB 765.42 MB Reserved Data index_size unused 3899472 KB 1608776 KB 1448400 KB 842296 KB Any ideas, how can i bite at least some of this unused space? Also I know table, which occupied it. update: is it worth to try to rebuild table indexes? ALTER INDEX ALL ON Production.Product REBUILD

  Read the article

• Question about WeakHashMap

  - by michael

  Hi, In the Javadoc of "http://java.sun.com/j2se/1.4.2/docs/api/java/util/WeakHashMap.html", it said "Each key object in a WeakHashMap is stored indirectly as the referent of a weak reference. Therefore a key will automatically be removed only after the weak references to it, both inside and outside of the map, have been cleared by the garbage collector." And then Note that a value object may refer indirectly to its key via the WeakHashMap itself; that is, a value object may strongly refer to some other key object whose associated value object, in turn, strongly refers to the key of the first value object. But should not both Key and Value should be used weak reference in WeakHashMap? i.e. if there is low on memory, GC will free the memory held by the value object (since the value object most likely take up more memory than key object in most cases)? And if GC free the Value object, the Key Object can be free as well? Basically, I am looking for a HashMap which will reduce memory usage when there is low memory (GC collects the value and key objects if necessary). Is it possible in Java? Thank you.

  Read the article

• File sizing issue in DOS/FAT

  - by Heather

  I've been tasked with writing a data collection program for a Unitech HT630, which runs a proprietary DOS operating system that can run executables compiled for 16-bit MS DOS with some restrictions. I'm using the Digital Mars C/C++ compiler, which is working well thus far. One of the application requirements is that the data file must be human-readable plain text, meaning the file can be imported into Excel or opened by Notepad. I'm using a variable length record format much like CSV that I've successfully implemented using the C standard library file I/O functions. When saving a record, I have to calculate whether the updated record is larger or smaller than the version of the record currently in the data file. If larger, I first shift all records immediately after the current record forward by the size difference calculated before saving the updated record. EOF is extended automatically by the OS to accommodate the extra data. If smaller, I shift all records backwards by my calculated offset. This is working well, however I have found no way to modify the EOF marker or file size to ignore the data after the end of the last record. Most of the time records will grow in size because the data collection program will be filling some of the empty fields with data when saving a record. Records will only shrink in size when a correction is made on an existing entry, or on a normal record save if the descriptive data in the record is longer than what the program reads in memory. In the situation of a shrinking record, after the last record in the file I'm left with whatever data was sitting there before the shift. I have been writing an EOF delimiter into the file after a "shrinking record save" to signal where the end of my records are and space-filling the remaining data, but then I no longer have a clean file until a "growing record save" extends the size of the file over the space-filled area. The truncate() function in unistd.h does not work (I'm now thinking this is for *nix flavors only?). One proposed solution I've seen involves creating a second file and writing all the data you wish to save into that file, and then deleting the original. Since I only have 4MB worth of disk space to use, this works if the file size is less than 2MB minus the size of my program executable and configuration files, but would fail otherwise. It is very likely that when this goes into production, users would end up with a file exceeding 2MB in size. I've looked at Ralph Brown's Interrupt List and the interrupt reference in IBM PC Assembly Language and Programming and I can't seem to find anything to update the file size or similar. Is reducing a file's size without creating a second file even possible in DOS?

  Read the article

• Which are the RDBMS that minimize the server roundtrips? Which RDBMS are better (in this area) than

  - by user193655

  When the latency is high ("when pinging the server takes time") the server roundtrips make the difference. Now I don't want to focus on the roundtrips created in programming, but the roundtrips that occur "under the hood" in the DB engine, so the roundtrips that are 100% dependant on how the RDBMS is written itself. I have been told that FireBird has more roundtrips than MySQL. But this is the only information I know. I am currently supporting MS SQL but I'd like to change RDBMS (because I use Express Editions and in my scenario they are quite limiting from the performance point of view), so to make a wise choice I would like to include also this point into "my RDBMS comparison feature matrix" to understand which is the best RDBMS to choose as an alternative to MS SQL. So the bold sentence above would make me prefer MySQL to Firebird (for the roundtrips concept, not in general), but can anyone add informations? And MS SQL where is it located? Is someone able to "rank" the roundtrip performance of the main RDBMS, or at least: MS SQL, MySql, Postegresql, Firebird (I am not interested in Oracle since it is not free, and if I have to change I would change to a free RDBMS). Anyway MySql (as mentioned several times on stackoverflow) has a not clear future and a not 100% free license. So my final choice will probably dall on PostgreSQL or Firebird. Additional info: somehow you can answer my question by making a simple list like: MSSQL:3; MySQL:1; Firebird:2; Postgresql:2 (where 1 is good, 2 average, 3 bad). Of course if you can post some links where the roundtrips per RDBMSs are compared it would be great

  Read the article

• Invoices for Printing in MS-Access

  - by Nitrodist

  The application that I'm currently working on has a funky set up for the invoices that they print. The form is the invoice that is printed out. I took a look at the Northwind DB and what it does is and it actually generates a report based on the record's information. What are the limitations of using Forms vs. Reports for printing out reports? One of the limitations that I've run into so far is that the printed page is jam packed with information (all required) to fit on a single page, yet there is lots of wasted space for some stuff since elements on the page don't shrink or grow due to what's inputted into the textboxes. How are invoices designed for your applications? How do you handle space restraints for creating invoices?

  Read the article

• how does fgets internally works?

  - by Registered User

  Well it is a basic question but I seem confused enough. #include<stdio.h> int main() { char a[100]; printf("Enter a string\n"); scanf("%s",a); } Basically the above is what I want to achieve. If I enter a string James Bond then I want that to be stored in array a. But the problem is because of presence of a blank space in between only James word is stored. So how can I solve this one. UPDATE After the replies given below I understand fgets() would be a better choice. I want to know internal working of fgets as why is it able to store the string with space where as scanf is not able to do the same.

  Read the article

• How should I build a privacy drop-down (select) menu?

  - by animuson

  I'm trying to build something similar to Facebook's privacy selection menu, except without the 'custom' option. It will only list a few options such as 'show to all', 'show to friends only', or 'completely hidden'. Right now I'm thinking of using simple JavaScript to change a hidden input field to the new value they click on, so if they clicked on the division for 'show to friends only' it would change the corresponding field, say 'email_privacy', to 1. Is there a better way to do this or am I pretty much on track? P.S. I am not planning on using a select element, I was planning on building a custom drop-down menu using CSS since select elements are so highly non-customizable. I'm doing it this way to save space, rather than having this massive selection menu at the right which takes up a bunch of space. Note: I'm not really interested in using jQuery, that's just extra libraries and crap that I don't want to load. I can do it in JavaScript just as easily so I might as well use that.

  Read the article

• Placing an background image with padding in h2 tag

  - by Cedar Jensen

  I want to create a headline (h2) with an image at the right-most area of the bounding box. I have the layout almost right except I can't push the image a little bit to the right of the element's bounding box -- how would I tweak my css so it is displayed correctly? I'm trying to do something like this: [{someHeadLineText}{dynamic space }{image}{5px space}] where the [] indicate the total available width of my content. Html: <div class="primaryHeader"> <h2>News</h2> </div> Css: .primaryHeader h2 { background-color: green; /* the header looks like a box */ color: black; background: transparent url(../images/edit.png) no-repeat right center; border: 1px solid red; } I am placing the image to the right of my h2 element and centered vertically -- but how do I adjust the placement of the background image?

  Read the article

• gdb: Cannot find new threads: generic error

  - by Alexander Gladysh

  When I run GDB against a program which loads a .so which is linked to pthreads, GDB reports error "Cannot find new threads: generic error". I probably miss something in my Ubuntu configuration (as it was installed from minimal install). Any clues? $ gdb --args lua -lluarocks.require GNU gdb (GDB) 7.0-ubuntu Copyright (C) 2009 Free Software Foundation, Inc. License GPLv3+: GNU GPL version 3 or later This is free software: you are free to change and redistribute it. There is NO WARRANTY, to the extent permitted by law. Type "show copying" and "show warranty" for details. This GDB was configured as "x86_64-linux-gnu". For bug reporting instructions, please see: <http://www.gnu.org/software/gdb/bugs/>... Reading symbols from /usr/bin/lua...(no debugging symbols found)...done. (gdb) run Starting program: /usr/bin/lua -lluarocks.require Lua 5.1.4 Copyright (C) 1994-2008 Lua.org, PUC-Rio require 'ev' [Thread debugging using libthread_db enabled] Cannot find new threads: generic error (gdb) q A debugging session is active. Inferior 1 [process 4986] will be killed. Quit anyway? (y or n) y This function gets called on require 'ev': http://github.com/brimworks/lua-ev/blob/master/lua_ev.c#L25-65 Additional information about my system: $ uname -a Linux localhost 2.6.31-20-generic #58-Ubuntu SMP Fri Mar 12 04:38:19 UTC 2010 x86_64 GNU/Linux $ lsb_release -a No LSB modules are available. Distributor ID: Ubuntu Description: Ubuntu 9.10 Release: 9.10 Codename: karmic

  Read the article

< Previous Page | 206 207 208 209 210 211 212 213 214 215 216 217  | Next Page >