Search Results

Search found 10620 results on 425 pages for 'perl module'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 211/425 | < Previous Page | 207 208 209 210 211 212 213 214 215 216 217 218  | Next Page >

  • negative regexp in Squirm (for Squid). Possible ?

    - by alex8657
    Did someone achieve to do negative regexp (or part of) with Squirm ? I tried negative lookahead things and ifthenelse regexps, but Squirm 1.26 fails to understand them. What i want to do is simply: * If the url begins by 'http://' and contains 'account', then rewrite/redirect to 301:https:// * It the url begins by 'https://' and does NOT contains 'account, then rewrite/redirect to 301:http:// So far, i do that using 2 lines of perl, but squirm redirectors would take less memory

    Read the article

  • Include a Class in another model / class / lib

    - by jaycode
    I need to use function "image_path" in my lib class. I tried this (and couple of other variations): class CustomHelpers::Base include ActionView::Helpers::AssetTagHelper def self.image_url(source) abs_path = image_path(source) unless abs_path =~ /^http/ abs_path = "#{request.protocol}#{request.host_with_port}#{abs_path}" end abs_path end end But it didn't work. Am I doing it right? Another question is, how do I find the right class to include? For example if I look at this module: http://api.rubyonrails.org/classes/ActionView/Helpers/AssetTagHelper.html is there a rule of thumb how to include that module in a model / library / class / anything else ?

    Read the article

  • Drupal Navigation Conundrum

    - by Vecta
    I'm attempting to set up navigation withing a Drupal site and am having a bit of trouble. I'm trying to have a series of pages that each have a set number of sub-pages. These pages will need to link to one another. All pages will contain similar content. For instance: Page 1 will have sub-pages a, b, c, d, e, and f all with content related to the topic of page 1 Page 2 will have sub-pages a, b, c, d, e, and f with content related to the topic of page 2 I'd like these links to appear in a horizontal nav bar on each page. Is it possible to accomplish this using the book module? I've also read some information about the taxonomy menu module that sounds promising, but I'm not really sure how that would work. What route should I look into? Thanks for any input!

    Read the article

  • How to run shell script with live feedback from PHP?

    - by Highway of Life
    How would I execute a shell script from PHP while giving constant/live feedback to the browser? I understand from the system function documentation: The system() call also tries to automatically flush the web server's output buffer after each line of output if PHP is running as a server module. I'm not clear on what they mean by running it as a 'server module'. I attempted to run the script in the cgi-bin, but either I'm doing it wrong, or that's not what they mean. Example PHP code: <?php system('/var/lib/script_test.sh'); Example shell code: #!/bin/bash echo "Start..." for i in {1..10} do echo "$i..." sleep 1 done echo "Done."

    Read the article

  • Python modules import error

    - by Choor
    Very strange for me: # uname -a Linux localhost.localdomain 2.6.18-194.3.1.el5 #1 SMP Thu May 13 13:09:10 EDT 2010 i686 i686 i386 GNU/Linux # pwd /root # python Python 2.6.5 (r265:79063, Apr 11 2010, 22:34:44) [GCC 4.1.2 20080704 (Red Hat 4.1.2-46)] on linux2 Type "help", "copyright", "credits" or "license" for more information. import dns [3]+ Stopped python # cd /home/user/dev/dns [root@localhost dns]# python Python 2.6.5 (r265:79063, Apr 11 2010, 22:34:44) [GCC 4.1.2 20080704 (Red Hat 4.1.2-46)] on linux2 Type "help", "copyright", "credits" or "license" for more information. import dns Traceback (most recent call last): File "", line 1, in File "dns.py", line 1, in import dns.resolver ImportError: No module named resolver [4]+ Stopped python # Summary: I can't import same python module from different path. Any ideas? 0_o P.S. SELINUX=disabled

    Read the article

  • nightmare with relative imports, how does pep 366 work?

    - by pygabriel
    I have a "canonical file structure" like that (I'm giving sensible names to ease the reading): mainpack/ __main__.py __init__.py - helpers/ __init__.py path.py - network/ __init__.py clientlib.py server.py - gui/ __init__.py mainwindow.py controllers.py In this structure, for example modules contained in each package may want to access the helpers utilities through relative imports in something like: # network/clientlib.py from ..helpers.path import create_dir The program is runned "as a script" using the __main__.py file in this way: python mainpack/ Trying to follow the PEP 366 I've put in __main__.py these lines: ___package___ = "mainpack" from .network.clientlib import helloclient But when running: $ python mainpack Traceback (most recent call last): File "/usr/lib/python2.6/runpy.py", line 122, in _run_module_as_main "__main__", fname, loader, pkg_name) File "/usr/lib/python2.6/runpy.py", line 34, in _run_code exec code in run_globals File "path/mainpack/__main__.py", line 2, in <module> from .network.clientlib import helloclient SystemError: Parent module 'mainpack' not loaded, cannot perform relative import What's wrong? What is the correct way to handle and effectively use relative imports? I've tried also to add the current directory to the PYTHONPATH, nothing changes.

    Read the article

  • Spamassassin one-liner to tag & move mail with an X-Spam-Flag: YES to a new directory?

    - by ane
    Say you have a directory with tens of thousands of messages in it. And you want to separate the spam from the non-spam. Specifically, you would like to: Run spamassassin against the directory, tagging each message with an X-Spam-Flag: YES if it thinks it's spam Have a tcsh shell or perl one-liner grep all mail with the flag and move those mails to /tmp/spam What command can you run to accomplish this? For example, some pseudocode: /usr/local/bin/spamassassin -eL ./Maildir/cur/* | grep "X-Spam-Flag: YES" | mv %1 /tmp/spam

    Read the article

  • JPA Database strcture for internationalisation

    - by IrishDubGuy
    I am trying to get a JPA implementation of a simple approach to internationalisation. I want to have a table of translated strings that I can reference in multiple fields in multiple tables. So all text occurrences in all tables will be replaced by a reference to the translated strings table. In combination with a language id, this would give a unique row in the translated strings table for that particular field. For example, consider a schema that has entities Course and Module as follows :- Course int course_id, int name, int description Module int module_id, int name The course.name, course.description and module.name are all referencing the id field of the translated strings table :- TranslatedString int id, String lang, String content That all seems simple enough. I get one table for all strings that could be internationalised and that table is used across all the other tables. How might I do this in JPA, using eclipselink 2.4? I've looked at embedded ElementCollection, ala this... JPA 2.0: Mapping a Map - it isn't exactly what i'm after cos it looks like it is relating the translated strings table to the pk of the owning table. This means I can only have one translatable string field per entity (unless I add new join columns into the translatable strings table, which defeats the point, its the opposite of what I am trying to do). I'm also not clear on how this would work across entites, presumably the id of each entity would have to use a database wide sequence to ensure uniqueness of the translatable strings table. BTW, I tried the example as laid out in that link and it didn't work for me - as soon as the entity had a localizedString map added, persisting it caused the client side to bomb but no obvious error on the server side and nothing persisted in the DB :S I been around the houses on this about 9 hours so far, I've looked at this Internationalization with Hibernate which appears to be trying to do the same thing as the link above (without the table definitions it hard to see what he achieved). Any help would be gratefully achieved at this point... Edit 1 - re AMS anwser below, I'm not sure that really addresses the issue. In his example it leaves the storing of the description text to some other process. The idea of this type of approach is that the entity object takes the text and locale and this (somehow!) ends up in the translatable strings table. In the first link I gave, the guy is attempting to do this by using an embedded map, which I feel is the right approach. His way though has two issues - one it doesn't seem to work! and two if it did work, it is storing the FK in the embedded table instead of the other way round (I think, I can't get it to run so I can't see exactly how it persists). I suspect the correct approach ends up with a map reference in place of each text that needs translating (the map being locale-content), but I can't see how to do this in a way that allows for multiple maps in one entity (without having corresponding multiple columns in the translatable strings table)...

    Read the article

  • Python: Pickling highly-recursive objects without using `setrecursionlimit`

    - by cool-RR
    I've been getting RuntimeError: maximum recursion depth exceeded when trying to pickle a highly-recursive tree object. Much like this asker here. He solved his problem by setting the recursion limit higher with sys.setrecursionlimit. But I don't want to do that: I think that's more of a workaround than a solution. Because I want to be able to pickle my trees even if they have 10,000 nodes in them. (It currently fails at around 200.) (Also, every platform's true recursion limit is different, and I would really like to avoid opening this can of worms.) Is there any way to solve this at the fundamental level? If only the pickle module would pickle using a loop instead of recursion, I wouldn't have had this problem. Maybe someone has an idea how I can cause something like this to happen, without rewriting the pickle module? Any other idea how I can solve this problem will be appreciated.

    Read the article

  • Problem with number/type of arguments passed to an overloaded c++ constructor wrapped with swig.

    - by MiKo
    I am trying to wrap a c++ class (let's call it "Spam") written by someone else with swig to expose it to Python. After solving several problems, I am able to import the module in python, but when I try to create an object of such class I obtain the following error: foo = Spam.Spam('abc',3) Traceback (most recent call last): File "<stdin>", line 1, in <module> File "Spam.py", line 96, in __init__ this = _Spam.new_Spam(*args) NotImplementedError: Wrong number of arguments for overloaded function 'new_Spam'. Possible C/C++ prototypes are: Spam(unsigned char *,unsigned long,bool,unsigned int,SSTree::io_action,char const *) Spam(unsigned char *,unsigned long,bool,unsigned int,SSTree::io_action) Spam(unsigned char *,unsigned long,bool,unsigned int) Spam(unsigned char *,unsigned long,bool) Spam(unsigned char *,unsigned long) Googling around, I realized that the error is probably caused by the type of the arguments and not by the number (which is quite confusing), but I still cannot identify. I suspect the problem lies in passing a string as the first argument, but have no idea on how to fix it (keep in mind that I know almost no c/c++).

    Read the article

  • What's the preferred way to use helper methods in Ruby?

    - by DR
    Disclaimer: Although I'm asking in context of a Rails application, I'm not talking about Rails helpers (i.e. view helpers) Let's say I have a helper method/function: def dispatch_job(job = {}) #Do something end Now I want to use this from several places (mostly controllers, but also a few BackgrounDRb workers) What's the preferred way to do this? I can think of two possibilities: 1. Use a class and make the helper a static method: class MyHelper def self.dispatch_job(job = {}) end end class MyWorker def run MyHelper.dispatch_job(...) end end 2. Use a module and include the method into whatever class I need this functionality module MyHelper def self.dispatch_job(job = {}) end end class MyWorker include MyHelper def run dispatch_job(...) end end 3. Other possibilities I don't know yet ... The first one is more Java-like, but I'm not sure if the second one is really an appropriate use of Ruby's modules.

    Read the article

  • Spamassassin command to tag mail & move mail with a spam score of over 10 to a new folder?

    - by ane
    Have a maildir with tens of thousands of messages in it, about 70% of which are spam. Would like to: Run /usr/local/bin/spamassassin against it, tagging each message if the score is 10 or greater Have a tcsh shell or perl one-liner grep all mails with a spam score of over 10 and move those mails to /tmp/spam What commands can I run to accomplish this? Pseudocode: /usr/local/bin/spamassassin ./Maildir/cur/* -tagscore10 grep "X-Spam-Score: [10-100]" ./Maildir/cur/* | mv %1 /tmp/spam

    Read the article

  • Python accessing modules from package that is distributed over different directories

    - by chaindriver
    Hi, I have a question regarding one single module that is distributed over multiple directories. Let's say I have these two file and directories: ~/lib/python xxx __init__.py util __init__.py module1.py module2.py ~/graphics/python xxx __init__.py misc __init__.py module3.py module4.py So then in my Python modules, I did this: import sys pythonlibpath = '~/lib/python' if pythonlibpath not in sys.path: sys.path.append(pythonlibpath) import xxx.util.module1 which works. Now, the problem is that I need xxx.misc.module3, so I did this: import sys graphicslibpath = '~/graphics/python' if graphicslibpath not in sys.path: sys.path.append(graphicslibpath) import xxx.misc.module3 but I get this error: ImportError: No module named misc.module3 It seems like it somehow still remembers that there was a xxx package in ~/lib/python and then tries to find misc.module3 from there. How do I get around this issue?

    Read the article

  • In Node.js, how can I load my modules once and then use them throughout the app?

    - by TIMEX
    I want to create one global module file, and then have all my files require that global module file. Inside that file, I would load all the modules once and export a dictionary of loaded modules. How can I do that? I actually tried creating this file...and every time I require('global_modules'), all the modules kept reloading. It's O(n). I want the file to be something like this (but it doesn't work): //global_modules.js - only load these one time var modules = { account_controller: '/account/controller.js', account_middleware: '/account/middleware.js', products_controller: '/products/controller.js', ... } exports.modules = modules;

    Read the article

  • ctypes import not working on python 2.5

    - by user551906
    Hi, I am trying to import ctypes, and I am using Python 2.5.5 installed using macports (on Mac OS X 10.6). I get an error saying "ImportError: No module named _ctypes" (see details below). As I understand it ctypes is supposed to come preinstalled for python 2.5. Any suggestions? thanks, Saurabh Error details: $ python Python 2.5.5 (r255:77872, Nov 30 2010, 00:05:47) [GCC 4.2.1 (Apple Inc. build 5659)] on darwin Type "help", "copyright", "credits" or "license" for more information. import ctypes Traceback (most recent call last): File "", line 1, in File "/opt/local/Library/Frameworks/Python.framework/Versions/2.5/lib/python2.5/ctypes/init.py", line 10, in from _ctypes import Union, Structure, Array ImportError: No module named _ctypes

    Read the article

  • file_get_contents not working with non english filenames in DRUPAL

    - by Novarg
    Hello. I have a problem. file_get_contents and other file functions (like file, fopen, glob etc) not working when i try to get file with non english symbols. I getting error that file not exist. It is going when i using any of that functions from my simple drupal module. But same time when i try to use file_get_contents outside drupal's code (just created separated php file) this function work as it should. Can you advice something?? What drupal doing so i can't use file functions on file with non english name from my module? Thanks.

    Read the article

  • MVC2 html dropdownlist is invisible

    - by Deb
    I am just trying to populate a html.dropdown list using mvc2 in VS2008. But the control is not displayed at all. Here is my code public ActionResult Index() { ViewData["Time"] = DateTime.Now.ToString(); var mdl = new List<SelectListItem>(); mdl.Add(new SelectListItem { Value = "1", Text = "Module One" }); mdl.Add(new SelectListItem { Value = "2", Text = "Module Two" }); ViewData["moduleList"] = new SelectList(mdl,"Value", "Text"); return View("MainMenu"); } and here is the markup <div> <%Html.DropDownList("moduleList", (IEnumerable<SelectListItem>)ViewData["moduleList"]); %> </div> Where did i go wrong ?

    Read the article

  • Python ctypes: loading DLL from from a relative path

    - by Frederick
    I have a Python module, wrapper.py, that wraps a C DLL. The DLL lies in the same folder as the module. Therefore, I use the following code to load it: myDll = ctypes.CDLL("MyCDLL.dll") This works if I execute wrapper.py from its own folder. If, however, I run it from elsewhere, ctypes goes looking for DLL in the current working directory and naturally fails. My question is, is there a way by which I can specify the DLL's path relative to the wrapper instead of the current working directory? This will enable me to ship the two together and allow the user to run/import the wrapper from anywhere.

    Read the article

  • What is /com/host?

    - by grawity
    The Perl documentation for Sys::Hostname contains: Attempts several methods of getting the system hostname [...]. It tries the first available of [blah blah] , and the file /com/host. If all that fails it croaks. What systems is this /com/host used on? It's a very ungooglable filename, and this is the first time I have heard of it.

    Read the article

  • Making an asynchronous interface appear synchronous to mod_python users

    - by Trey
    I have a Python-driven web interface powered by Apache 2.2 with mod_python and Python 2.4. I need to make an asynchronous process appear synchronous to users of this web interface. When users access one module on this website: An external SOAP interface will be contacted with a unique identifier and will respond with a number N The external interface will respond asynchronously by contacting a SOAP server on my machine between 1 and 10 times (the number N tells us how many responses we will receive) I need to somehow aggregate these responses and pass them to the original module which will display the information back to the user. The goal is to make the process appear synchronous to the user. What is the best way to handle this synchronization issue? Is this something Twisted would be well-suited for? I am not restricting myself to Python for the solution, though it is preferred because everything else on the server is in Python. I prefer a solution that is both scalable and will take a minimal amount of programming time (though I understand that these attributes are somewhat at odds).

    Read the article

  • using spl_autoload_register to load classes that extends to another class

    - by Fred Gustavo
    Well, i got this oop: abstract class TestSystemUtils { abstract public function __run(); /* utils funcs */ } class TestSystem extends TestSystemUtils { protected $body; protected $out; function __construct() { } public function __run() { } } I got a directory with many modules, each module is a class that extends TestSystem but i don't want to include all them modules then in method __run i make a dbconnection get these modules that will be used, but in this point idk the right way to 'include' these files i can use __autoload func but idk if i should call these classes inside the class TestSystem or not, all modules need to use these two variables 'body' and 'out' ... Well what's the right way to do it? someone could help me please. Module classes look like: class mod01 extends TestSystem { } thanks.

    Read the article

  • Google App Engine dev_appserver can't find PIL (I've installed it)

    - by goggin13
    I recently upgraded my Google App Engine launcher on my Mac, running OSX 10.5.8, and afterwards my projects that work with images stopped working locally. It seems to be the same problem that I had when first using GAE locally to work with images, before I installed PIL. Here is the error I get: SystemError: Parent module 'PIL' not loaded I have PIL installed. When I run python normally, I can access it and work with it as expected. I also checked to ensure that dev_appserver.py was running the same version of Python. If I open the interpreter and type sys.version I get this back: 2.5 (r25:51918, Sep 19 2006, 08:49:13) [GCC 4.0.1 (Apple Computer, Inc. build 5341)] This is identical to what I get when I display the sys.version from my projects running through dev_appserver. Any thoughts on why dev_appserver can't find the PIL module? I have been banging my head against this for a bit. Thank you!

    Read the article

  • Identify Deprecated Rules on Checkpoint Firewall

    - by Basa
    I've been asked to find the deprecated rules among the thousands of rules in our Checkpoint firewall. I could do it by writing a perl program to analyze the log and lists of objects & rules, but i wanted to know if anybody knows of an easier way before reinventing the wheel. I have access to SmartView Monitor et SmartView Tracker and i wanted to know if anybody knew of a way to achieve my goal with those tools.

    Read the article

  • sed or grep or awk to match very very long lines

    - by yael
    more file param1=" 1,deerfntjefnerjfntrjgntrjnvgrvgrtbvggfrjbntr*rfr4fv*frfftrjgtrignmtignmtyightygjn 2,3,4,5,6,7,8, rfcmckmfdkckemdio8u548384omxc,mor0ckofcmineucfhcbdjcnedjcnywedpeodl40fcrcmkedmrikmckffmcrffmrfrifmtrifmrifvysdfn" need to match the content of $param1 in the file but its not work for example sed -n "/$param1/p" file or any grep $param1 file etc... any other solutions? maybe with perl?

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 207 208 209 210 211 212 213 214 215 216 217 218  | Next Page >