Search Results

Search found 5619 results on 225 pages for 'starts'.

Page 220/225 | < Previous Page | 216 217 218 219 220 221 222 223 224 225  | Next Page >

  • Need help modifying my Custom Replace code based on string passed to it

    - by fraXis
    Hello, I have a C# program that will open a text file, parse it for certain criteria using a RegEx statement, and then write a new text file with the changed criteria. For example: I have a text file with a bunch of machine codes in it such as: X0.109Y0Z1.G0H2E1 My C# program will take this and turn it into: X0.109Y0G54G0T3 G43Z1.H2M08 (Note: the T3 value is really the H value (H2 in this case) + 1). T = H + 1 It works great, because the line usually always starts with X so the RegEx statement always matches. My RegEx that works with my first example is as follows: //Regex pattern for: //- X(value)Y(value)Z(value)G(value)H(value)E(value) //- X(value)Y(value)Z(value)G(value)H(value)E(value)M(value) //- X(value)Y(value)Z(value)G(value)H(value)E(value)A(value) //- X(value)Y(value)Z(value)G(value)H(value)E(value)M(value)A(value) //value can be positive or negative, integer or floating point number with multiple decimal places or without any private Regex regReal = new Regex("^(X([-]|[.]|[-.]|[0-9])[0-9]*[.]*[0-9]*){1}(Y([-]|[.]|[-.]|[0-9])[0-9]*[.]*[0-9]*){1}(Z([-]|[.]|[-.]|[0-9])[0-9]*[.]*[0-9]*){1}(G([-]|[.]|[-.]|[0-9])[0-9]*[.]*[0-9]*){1}(H([-]|[.]|[-.]|[0-9])[0-9]*[.]*[0-9]*){1}(E([-]|[.]|[-.]|[0-9])[0-9]*[.]*[0-9]*){1}(M([-]|[.]|[-.]|[0-9])[0-9]*[.]*[0-9]*)?(A([-]|[.]|[-.]|[0-9])[0-9]*[.]*[0-9]*)?$"); This RegEx works great because sometimes the line of code could also have an M or A at the end such as: X0.109Y0Z1.G0H2E1A2 My problem is now I have run into some lines of code that have this: G90G0X1.5Y-0.036E1Z3.H1 and I need to turn it into this: G90G0X1.5Y-0.036G54T2 G43Z3.H1M08 Can someone please modify my RegEx and code to turn this: G90G0X1.5Y-0.036E1Z3.H1 into: G90G0X1.5Y-0.036G54T2 G43Z3.H1M08 But sometimes the values could be a little different such as: G(value)G(value)X(value)Y(value)E(value)Z(value)H(value) G(value)G(value)X(value)Y(value)E(value)Z(value)H(value)A(value) G(value)G(value)X(value)Y(value)E(value)Z(value)H(value)A(value)(M)value G(value)G(value)X(value)Y(value)E(value)Z(value)H(value)M(value)(A)value But also (this is where Z is moved to a different spot) G(value)G(value)X(value)Y(value)Z(value)E(value)H(value) G(value)G(value)X(value)Y(value)Z(value)E(value)H(value)A(value) G(value)G(value)X(value)Y(value)Z(value)E(value)H(value)A(value)(M)value G(value)G(value)X(value)Y(value)Z(value)E(value)H(value)M(value)(A)value Here is my code that needs to be changed (I did not include the open and saving of the text file since that is pretty standard stuff). //Regex pattern for: //- X(value)Y(value)Z(value)G(value)H(value)E(value) //- X(value)Y(value)Z(value)G(value)H(value)E(value)M(value) //- X(value)Y(value)Z(value)G(value)H(value)E(value)A(value) //- X(value)Y(value)Z(value)G(value)H(value)E(value)M(value)A(value) //value can be pozitive or negative, integer or floating point number with multiple decimal places or without any private Regex regReal = new Regex("^(X([-]|[.]|[-.]|[0-9])[0-9]*[.]*[0-9]*){1}(Y([-]|[.]|[-.]|[0-9])[0-9]*[.]*[0-9]*){1}(Z([-]|[.]|[-.]|[0-9])[0-9]*[.]*[0-9]*){1}(G([-]|[.]|[-.]|[0-9])[0-9]*[.]*[0-9]*){1}(H([-]|[.]|[-.]|[0-9])[0-9]*[.]*[0-9]*){1}(E([-]|[.]|[-.]|[0-9])[0-9]*[.]*[0-9]*){1}(M([-]|[.]|[-.]|[0-9])[0-9]*[.]*[0-9]*)?(A([-]|[.]|[-.]|[0-9])[0-9]*[.]*[0-9]*)?$"); private string CheckAndModifyLine(string line) { if (regReal.IsMatch(line)) //Check the first Regex with line string { return CustomReplace(line); } else { return line; } } private string CustomReplace(string input) { string returnValue = String.Empty; int zPos = input.IndexOf("Z"); int gPos = input.IndexOf("G"); int hPos = input.IndexOf("H"); int ePos = input.IndexOf("E"); int aPos = input.IndexOf("A"); int hValue = Int32.Parse(input.Substring(hPos + 1, ePos - hPos - 1)) + 1; //get H number //remove A value returnValue = ((aPos == -1) ? input : input.Substring(0, aPos)); //replace Z value returnValue = Regex.Replace(returnValue, "Z[-]?\\d*\\.*\\d*", "G54"); //replace H value returnValue = Regex.Replace(returnValue, "H\\d*\\.*\\d*", "T" + hValue.ToString() + ((aPos == -1) ? String.Empty : input.Substring(aPos, input.Length - aPos))); //replace E, or E and M value returnValue = Regex.Replace(returnValue, "E\\d*\\.*\\d(M\\d*\\.*\\d)?", Environment.NewLine + "G43" + input.Substring(zPos, gPos - zPos) + input.Substring(hPos, ePos - hPos) + "M08"); return returnValue; } I tried to modify the above code to match the new line of text I am encountering (and split into two lines like my first example) but I am failing miserably. Thanks so much.

    Read the article

  • HttpModule Init method is called several times - why?

    - by MartinF
    I was creating a http module and while debugging I noticed something which at first (at least) seemed like weird behaviour. When i set a breakpoint in the init method of the httpmodule i can see that the http module init method is being called several times even though i have only started up the website for debugging and made one single request (sometimes it is hit only 1 time, other times as many as 10 times). I know that I should expect several instances of the HttpApplication to be running and for each the http modules will be created, but when i request a single page it should be handled by a single http application object and therefore only fire the events associated once, but still it fires the events several times for each request which makes no sense - other than it must have been added several times within that httpApplication - which means it is the same httpmodule init method which is being called every time and not a new http application being created each time it hits my break point (see my code example at the bottom etc.). What could be going wrong here ? is it because i am debugging and set a breakpoint in the http module? It have noticed that it seems that if i startup the website for debugging and quickly step over the breakpoint in the httpmodule it will only hit the init method once and the same goes for the eventhandler. If I instead let it hang at the breakpoint for a few seconds the init method is being called several times (seems like it depends on how long time i wait before stepping over the breakpoint). Maybe this could be some build in feature to make sure that the httpmodule is initialised and the http application can serve requests , but it also seems like something that could have catastrophic consequences. This could seem logical, as it might be trying to finish the request and since i have set the break point it thinks something have gone wrong and try to call the init method again ? soo it can handle the request ? But is this what is happening and is everything fine (i am just guessing), or is it a real problem ? What i am specially concerned about is that if something makes it hang on the "production/live" server for a few seconds a lot of event handlers are added through the init and therefore each request to the page suddenly fires the eventhandler several times. This behaviour could quickly bring any site down. I have looked at the "original" .net code used for the httpmodules for formsauthentication and the rolemanagermodule etc but my code isnt any different that those modules uses. My code looks like this. public void Init(HttpApplication app) { if (CommunityAuthenticationIntegration.IsEnabled) { FormsAuthenticationModule formsAuthModule = (FormsAuthenticationModule) app.Modules["FormsAuthentication"]; formsAuthModule.Authenticate += new FormsAuthenticationEventHandler(this.OnAuthenticate); } } here is an example how it is done in the RoleManagerModule from the .NET framework public void Init(HttpApplication app) { if (Roles.Enabled) { app.PostAuthenticateRequest += new EventHandler(this.OnEnter); app.EndRequest += new EventHandler(this.OnLeave); } } Do anyone know what is going on? (i just hope someone out there can tell me why this is happening and assure me that everything is perfectly fine) :) UPDATE: I have tried to narrow down the problem and so far i have found that the Init method being called is always on a new object of my http module (contary to what i thought before). I seems that for the first request (when starting up the site) all of the HttpApplication objects being created and its modules are all trying to serve the first request and therefore all hit the eventhandler that is being added. I cant really figure out why this is happening. If i request another page all the HttpApplication's created (and their moduless) will again try to serve the request causing it to hit the eventhandler multiple times. But it also seems that if i then jump back to the first page (or another one) only one HttpApplication will start to take care of the request and everything is as expected - as long as i dont let it hang at a break point. If i let it hang at a breakpoint it begins to create new HttpApplication's objects and starts adding HttpApplications (more than 1) to serve/handle the request (which is already in process of being served by the HttpApplication which is currently stopped at the breakpoint). I guess or hope that it might be some intelligent "behind the scenes" way of helping to distribute and handle load and / or errors. But I have no clue. I hope some out there can assure me that it is perfectly fine and how it is supposed to be?

    Read the article

  • Scala n00b: Critique my code

    - by Peter
    G'day everyone, I'm a Scala n00b (but am experienced with other languages) and am learning the language as I find time - very much enjoying it so far! Usually when learning a new language the first thing I do is implement Conway's Game of Life, since it's just complex enough to give a good sense of the language, but small enough in scope to be able to whip up in a couple of hours (most of which is spent wrestling with syntax). Anyhoo, having gone through this exercise with Scala I was hoping the Scala gurus out there might take a look at the code I've ended up with and provide feedback on it. I'm after anything - algorithmic improvements (particularly concurrent solutions!), stylistic improvements, alternative APIs or language constructs, disgust at the length of my function names - whatever feedback you've got, I'm keen to hear it! You should be able to run the following script via "scala GameOfLife.scala" - by default it will run a 20x20 board with a single glider on it - please feel free to experiment. // CONWAY'S GAME OF LIFE (SCALA) abstract class GameOfLifeBoard(val aliveCells : Set[Tuple2[Int, Int]]) { // Executes a "time tick" - returns a new board containing the next generation def tick : GameOfLifeBoard // Is the board empty? def empty : Boolean = aliveCells.size == 0 // Is the given cell alive? protected def alive(cell : Tuple2[Int, Int]) : Boolean = aliveCells contains cell // Is the given cell dead? protected def dead(cell : Tuple2[Int, Int]) : Boolean = !alive(cell) } class InfiniteGameOfLifeBoard(aliveCells : Set[Tuple2[Int, Int]]) extends GameOfLifeBoard(aliveCells) { // Executes a "time tick" - returns a new board containing the next generation override def tick : GameOfLifeBoard = new InfiniteGameOfLifeBoard(nextGeneration) // The next generation of this board protected def nextGeneration : Set[Tuple2[Int, Int]] = aliveCells flatMap neighbours filter shouldCellLiveInNextGeneration // Should the given cell should live in the next generation? protected def shouldCellLiveInNextGeneration(cell : Tuple2[Int, Int]) : Boolean = (alive(cell) && (numberOfAliveNeighbours(cell) == 2 || numberOfAliveNeighbours(cell) == 3)) || (dead(cell) && numberOfAliveNeighbours(cell) == 3) // The number of alive neighbours for the given cell protected def numberOfAliveNeighbours(cell : Tuple2[Int, Int]) : Int = aliveNeighbours(cell) size // Returns the alive neighbours for the given cell protected def aliveNeighbours(cell : Tuple2[Int, Int]) : Set[Tuple2[Int, Int]] = aliveCells intersect neighbours(cell) // Returns all neighbours (whether dead or alive) for the given cell protected def neighbours(cell : Tuple2[Int, Int]) : Set[Tuple2[Int, Int]] = Set((cell._1-1, cell._2-1), (cell._1, cell._2-1), (cell._1+1, cell._2-1), (cell._1-1, cell._2), (cell._1+1, cell._2), (cell._1-1, cell._2+1), (cell._1, cell._2+1), (cell._1+1, cell._2+1)) // Information on where the currently live cells are protected def xVals = aliveCells map { cell => cell._1 } protected def xMin = (xVals reduceLeft (_ min _)) - 1 protected def xMax = (xVals reduceLeft (_ max _)) + 1 protected def xRange = xMin until xMax + 1 protected def yVals = aliveCells map { cell => cell._2 } protected def yMin = (yVals reduceLeft (_ min _)) - 1 protected def yMax = (yVals reduceLeft (_ max _)) + 1 protected def yRange = yMin until yMax + 1 // Returns a simple graphical representation of this board override def toString : String = { var result = "" for (y <- yRange) { for (x <- xRange) { if (alive (x,y)) result += "# " else result += ". " } result += "\n" } result } // Equality stuff override def equals(other : Any) : Boolean = { other match { case that : InfiniteGameOfLifeBoard => (that canEqual this) && that.aliveCells == this.aliveCells case _ => false } } def canEqual(other : Any) : Boolean = other.isInstanceOf[InfiniteGameOfLifeBoard] override def hashCode = aliveCells.hashCode } class FiniteGameOfLifeBoard(val boardWidth : Int, val boardHeight : Int, aliveCells : Set[Tuple2[Int, Int]]) extends InfiniteGameOfLifeBoard(aliveCells) { override def tick : GameOfLifeBoard = new FiniteGameOfLifeBoard(boardWidth, boardHeight, nextGeneration) // Determines the coordinates of all of the neighbours of the given cell override protected def neighbours(cell : Tuple2[Int, Int]) : Set[Tuple2[Int, Int]] = super.neighbours(cell) filter { cell => cell._1 >= 0 && cell._1 < boardWidth && cell._2 >= 0 && cell._2 < boardHeight } // Information on where the currently live cells are override protected def xRange = 0 until boardWidth override protected def yRange = 0 until boardHeight // Equality stuff override def equals(other : Any) : Boolean = { other match { case that : FiniteGameOfLifeBoard => (that canEqual this) && that.boardWidth == this.boardWidth && that.boardHeight == this.boardHeight && that.aliveCells == this.aliveCells case _ => false } } override def canEqual(other : Any) : Boolean = other.isInstanceOf[FiniteGameOfLifeBoard] override def hashCode : Int = { 41 * ( 41 * ( 41 + super.hashCode ) + boardHeight.hashCode ) + boardWidth.hashCode } } class GameOfLife(initialBoard: GameOfLifeBoard) { // Run the game of life until the board is empty or the exact same board is seen twice // Important note: this method does NOT necessarily terminate!! def go : Unit = { var currentBoard = initialBoard var previousBoards = List[GameOfLifeBoard]() while (!currentBoard.empty && !(previousBoards contains currentBoard)) { print(27.toChar + "[2J") // ANSI: clear screen print(27.toChar + "[;H") // ANSI: move cursor to top left corner of screen println(currentBoard.toString) Thread.sleep(75) // Warning: unbounded list concatenation can result in OutOfMemoryExceptions ####TODO: replace with LRU bounded list previousBoards = List(currentBoard) ::: previousBoards currentBoard = currentBoard tick } // Print the final board print(27.toChar + "[2J") // ANSI: clear screen print(27.toChar + "[;H") // ANSI: move cursor to top left corner of screen println(currentBoard.toString) } } // Script starts here val simple = Set((1,1)) val square = Set((4,4), (4,5), (5,4), (5,5)) val glider = Set((2,1), (3,2), (1,3), (2,3), (3,3)) val initialBoard = glider (new GameOfLife(new FiniteGameOfLifeBoard(20, 20, initialBoard))).go //(new GameOfLife(new InfiniteGameOfLifeBoard(initialBoard))).go // COPYRIGHT PETER MONKS 2010 Thanks! Peter

    Read the article

  • android.view.InflateException: Binary XML file line #11

    - by kostas
    i have a listview with some items.when the user touch the first list item it starts a dialog activity with a photo and some text below.that happens for every list item.but unfortunately i m getting this android.view.InflateException: Binary XML file line #11 force down error..this is a part of my manifest: <activity android:name=".kalamaki" android:label="Beaches in Chania" android:screenOrientation="portrait" android:configChanges="orientation|keyboardHidden" android:theme="@android:style/Theme.Dialog" /> this is my .xml file: <?xml version="1.0" encoding="utf-8"?> <ScrollView xmlns:android="http://schemas.android.com/apk/res/android" android:layout_width="fill_parent" android:layout_height="fill_parent" android:background="#cfcfcc" > <LinearLayout android:orientation="vertical" android:layout_width="fill_parent" android:layout_height="fill_parent"> <ImageView android:layout_marginTop="5px" android:id="@+id/image" android:layout_width="wrap_content" android:layout_height="wrap_content" android:src="@+id/image" /> <TextView android:layout_marginTop="5px" android:id="@+id/text" android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="@+id/text" android:textColor="#262626" /> </LinearLayout> </ScrollView> and this is my logcat error: 04-30 19:08:34.433: ERROR/AndroidRuntime(405): Uncaught handler: thread main exiting due to uncaught exception 04-30 19:08:34.463: ERROR/AndroidRuntime(405): java.lang.RuntimeException: Unable to start activity ComponentInfo{kostas.menu.chania/kostas.menu.chania.sfinari}: android.view.InflateException: Binary XML file line #11: Error inflating class <unknown> 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:2454) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:2470) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.app.ActivityThread.access$2200(ActivityThread.java:119) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:1821) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.os.Handler.dispatchMessage(Handler.java:99) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.os.Looper.loop(Looper.java:123) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.app.ActivityThread.main(ActivityThread.java:4310) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at java.lang.reflect.Method.invokeNative(Native Method) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at java.lang.reflect.Method.invoke(Method.java:521) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:860) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:618) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at dalvik.system.NativeStart.main(Native Method) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): Caused by: android.view.InflateException: Binary XML file line #11: Error inflating class <unknown> 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.view.LayoutInflater.createView(LayoutInflater.java:513) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at com.android.internal.policy.impl.PhoneLayoutInflater.onCreateView(PhoneLayoutInflater.java:56) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.view.LayoutInflater.createViewFromTag(LayoutInflater.java:563) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.view.LayoutInflater.rInflate(LayoutInflater.java:618) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.view.LayoutInflater.rInflate(LayoutInflater.java:621) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.view.LayoutInflater.inflate(LayoutInflater.java:407) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.view.LayoutInflater.inflate(LayoutInflater.java:320) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.view.LayoutInflater.inflate(LayoutInflater.java:276) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at com.android.internal.policy.impl.PhoneWindow.setContentView(PhoneWindow.java:198) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.app.Activity.setContentView(Activity.java:1622) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at kostas.menu.chania.sfinari.onCreate(sfinari.java:15) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.app.Instrumentation.callActivityOnCreate(Instrumentation.java:1047) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:2417) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): ... 11 more 04-30 19:08:34.463: ERROR/AndroidRuntime(405): Caused by: java.lang.reflect.InvocationTargetException 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.widget.ImageView.<init>(ImageView.java:105) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at java.lang.reflect.Constructor.constructNative(Native Method) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at java.lang.reflect.Constructor.newInstance(Constructor.java:446) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.view.LayoutInflater.createView(LayoutInflater.java:500) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): ... 23 more 04-30 19:08:34.463: ERROR/AndroidRuntime(405): Caused by: android.content.res.Resources$NotFoundException: File res/drawable-mdpi/scrollbar_handle_vertical.9.png from drawable resource ID #0x7f050000 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.content.res.Resources.loadDrawable(Resources.java:1710) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.content.res.TypedArray.getDrawable(TypedArray.java:548) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.widget.ImageView.<init>(ImageView.java:115) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): ... 27 more 04-30 19:08:34.463: ERROR/AndroidRuntime(405): Caused by: java.io.FileNotFoundException: res/drawable-mdpi/scrollbar_handle_vertical.9.png 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.content.res.AssetManager.openNonAssetNative(Native Method) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.content.res.AssetManager.openNonAsset(AssetManager.java:391) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): at android.content.res.Resources.loadDrawable(Resources.java:1702) 04-30 19:08:34.463: ERROR/AndroidRuntime(405): ... 29 more

    Read the article

  • Couldn't get connection factory client - fighting with Google Maps

    - by iie
    another day another problem, I finally managed to set up correctly google maps on my android application, or at least I thought I've done it, the whole progam starts, it even call the class which should "print" a map, but the only thing I can see is a grid with google label on it [ in the corner ]. I've checked the dalvik monitor and the error E/MapActivity(394): Couldn't get connection factory client occurs. I've find out on stackoverflow website that I should sent a gps signal or sth like this from dalvik monitor, and I've done it. Nothing happend, also I got the api key one more time, but nothing changed. here is map.xml <?xml version="1.0" encoding="utf-8"?> <!-- This file is /res/layout/mapview.xml --> <LinearLayout xmlns:android="http://schemas.android.com/apk/res/android" android:orientation="vertical" android:layout_width="fill_parent" android:layout_height="fill_parent"> <LinearLayout xmlns:android="http://schemas.android.com/apk/res/android" android:orientation="horizontal" android:layout_width="fill_parent" android:layout_height="wrap_content"> <Button android:id="@+id/zoomin" android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="+" android:onClick="myClickHandler" android:padding="12px" /> <Button android:id="@+id/zoomout" android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="-" android:onClick="myClickHandler" android:padding="12px" /> <Button android:id="@+id/sat" android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="Satellite" android:onClick="myClickHandler" android:padding="8px" /> <Button android:id="@+id/street" android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="Street" android:onClick="myClickHandler" android:padding="8px" /> <Button android:id="@+id/traffic" android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="Traffic" android:onClick="myClickHandler" android:padding="8px" /> <Button android:id="@+id/normal" android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="Normal" android:onClick="myClickHandler" android:padding="8px" /> </LinearLayout> <com.google.android.maps.MapView android:id="@+id/mapview" android:layout_width="fill_parent" android:layout_height="wrap_content" android:clickable="true" android:apiKey="0zPcz1VYRSpLusufJ2JoL0ffl2uxDMovgpW319w" /> </LinearLayout> here is a MapMapa.java public class MapMapa extends MapActivity { private MapView mapView; @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.map); mapView = (MapView)findViewById(R.id.mapview); } public void myClickHandler(View target) { switch(target.getId()) { case R.id.zoomin: mapView.getController().zoomIn(); break; case R.id.zoomout: mapView.getController().zoomOut(); break; case R.id.sat: mapView.setSatellite(true); break; case R.id.street: mapView.setStreetView(true); break; case R.id.traffic: mapView.setTraffic(true); break; case R.id.normal: mapView.setSatellite(false); mapView.setStreetView(false); mapView.setTraffic(false); break; } } @Override protected boolean isLocationDisplayed() { return false; } @Override protected boolean isRouteDisplayed() { return false; } manifest.xml <?xml version="1.0" encoding="utf-8"?> <manifest xmlns:android="http://schemas.android.com/apk/res/android" package="menu.dot" android:versionCode="1" ndroid:versionName="1.0"> <application android:label="@string/app_name" android:icon="@drawable/icon"> <uses-library android:name="com.google.android.maps" /> <activity android:name="MainActivity" android:label="@string/app_name"> <intent-filter> <action android:name="android.intent.action.MAIN" /> <category android:name="android.intent.category.LAUNCHER" /> </intent-filter> </activity> <activity android:name=".About"> android:label="@string/about_title" android:theme="@android:style/Theme.Dialog" > </activity> <activity android:name=".Exit"> andorid:label="@string/exit_title"> </activity> <activity android:name=".Options"> </activity> <activity android:name=".Start"> </activity> <activity android:name=".Create"> </activity> <activity android:name=".Where"> </activity> <activity android:name=".Proceed"> </activity> <activity android:name=".Finish"> </activity> <activity android:name=".Login"> </activity> <activity android:name=".OK"> </activity> <activity android:name=".UserPanel"> </activity> <activity android:name=".Managero"> </activity> <activity android:name=".Edition"> </activity> <activity android:name=".Done"> </activity> <activity android:name=".Delete"> </activity> <activity android:name=".MapMapa"> </activity> </application> <uses-permission android:name="android.permission.ACCESS_FINE_LOCATION"/> <uses-permission android:name="android.permission.ACCESS_COARSE_LOCATION"/> <uses-permission android:name="android.permission.INTERNET"/> <uses-sdk android:minSdkVersion="3" /> </manifest>

    Read the article

  • setIncludesSubentities: in an NSFetchRequest is broken for entities across multiple persistent store

    - by SG
    Prior art which doesn't quite address this: http://stackoverflow.com/questions/1774359/core-data-migration-error-message-model-does-not-contain-configuration-xyz I have narrowed this down to a specific issue. It takes a minute to set up, though; please bear with me. The gist of the issue is that a persistentStoreCoordinator (apparently) cannot preserve the part of an object graph where a managedObject is marked as a subentity of another when they are stored in different files. Here goes... 1) I have 2 xcdatamodel files, each containing a single entity. In runtime, when the managed object model is constructed, I manually define one entity as subentity of another using setSubentities:. This is because defining subentities across multiple files in the editor is not supported yet. I then return the complete model with modelByMergingModels. //Works! [mainEntity setSubentities:canvasEntities]; NSLog(@"confirm %@ is super for %@", [[[canvasEntities lastObject] superentity] name], [[canvasEntities lastObject] name]); //Output: "confirm Note is super for Browser" 2) I have modified the persistentStoreCoordinator method so that it sets a different store for each entity. Technically, it uses configurations, and each entity has one and only one configuration defined. //Also works! for ( NSString *configName in [[HACanvasPluginManager shared].registeredCanvasTypes valueForKey:@"viewControllerClassName"] ) { storeUrl = [NSURL fileURLWithPath:[[self applicationDocumentsDirectory] stringByAppendingPathComponent:[configName stringByAppendingPathExtension:@"sqlite"]]]; //NSLog(@"entities for configuration '%@': %@", configName, [[[self managedObjectModel] entitiesForConfiguration:configName] valueForKey:@"name"]); //Output: "entities for configuration 'HATextCanvasController': (Note)" //Output: "entities for configuration 'HAWebCanvasController': (Browser)" if (![persistentStoreCoordinator addPersistentStoreWithType:NSSQLiteStoreType configuration:configName URL:storeUrl options:options error:&error]) //etc 3) I have a fetchRequest set for the parent entity, with setIncludesSubentities: and setAffectedStores: just to be sure we get both 1) and 2) covered. When inserting objects of either entity, they both are added to the context and they both are fetched by the fetchedResultsController and displayed in the tableView as expected. // Create the fetch request for the entity. NSFetchRequest *fetchRequest = [[NSFetchRequest alloc] init]; [fetchRequest setEntity:entity]; [fetchRequest setIncludesSubentities:YES]; //NECESSARY to fetch all canvas types [fetchRequest setSortDescriptors:sortDescriptors]; [fetchRequest setFetchBatchSize:20]; // Set the batch size to a suitable number. [fetchRequest setAffectedStores:[[managedObjectContext persistentStoreCoordinator] persistentStores]]; [fetchRequest setReturnsObjectsAsFaults:NO]; Here is where it starts misbehaving: after closing and relaunching the app, ONLY THE PARENT ENTITY is fetched. If I change the entity of the request using setEntity: to the entity for 'Note', all notes are fetched. If I change it to the entity for 'Browser', all the browsers are fetched. Let me reiterate that during the run in which an object is first inserted into the context, it will appear in the list. It is only after save and relaunch that a fetch request fails to traverse the hierarchy. Therefore, I can only conclude that it is the storage of the inheritance that is the problem. Let's recap why: - Both entities can be created, inserted into the context, and viewed, so the model is working - Both entities can be fetched with a single request, so the inheritance is working - I can confirm that the files are being stored separately and objects are going into their appropriate stores, so saving is working - Launching the app with either entity set for the request works, so retrieval from the store is working - This also means that traversing different stores with the request is working - By using a single store instead of multiple, the problem goes away completely, so creating, storing, fetching, viewing etc is working correctly. This leaves only one culprit (to my mind): the inheritance I'm setting with setSubentities: is effective only for objects creating during the session. Either objects/entities are being stored stripped of the inheritance info, or entity inheritance as defined programmatically only applies to new instances, or both. Either of these is unacceptable. Either it's a bug or I am way, way off course. I have been at this every which way for two days; any insight is greatly appreciated. The current workaround - just using a single store - works completely, except it won't be future-proof in the event that I remove one of the models from the app etc. It also boggles the mind because I can't see why you would have all this infrastructure for storing across multiple stores and for setting affected stores in fetch requests if it by core definition (of setSubentities:) doesn't work.

    Read the article

  • Arduino - AdHoc Network Setup

    - by methodMan
    I`m currently working with an arduino trying to build an adhoc network to which a device can connect to and send web request to. The problem I am currently having is that I can only set up one connection and then when that connection is terminated (client.stop()) all subsequent connections are not picked up by the server, even a curl command just sits there spinning. The first connection I start when I reset the server works fine and I am able to talk to the server; but after that, the arduino can no longer find new clients (even though it's trying with the library given). I`m using the sparkfun library for the wifly shield cloned from github, along with an Arduino Uno. My current code is based off their default example 'WiFly_AdHoc_Example' but I had to remove a few things to get the network to start up which might be the cause of this problem. Here is the .ino file that I am running. #include <SPI.h> #include <WiFly.h> //#include <SoftwareSerial.h> //SoftwareSerial mySerial( 5, 4); //Part from example not used(see below) WiFlyServer server(80); void setup() { Serial.begin(9600); //The code below is from the example but when I run it the WiFly will hang // on Wifly.begin(). Without it the WiFly starts up fine but only works for // one request. //mySerial.begin(9600); //WiFly.setUart(&mySerial); // Tell the WiFly library that we are not //using the SPIUart Serial.println("**************Starting WiFly**************"); // Enable Adhoc mod WiFly.begin(true); Serial.println("WiFly started, creating network."); if (!WiFly.createAdHocNetwork("wifly")) { Serial.print("Failed to create ad hoc network."); while (1) { // Hang on failure. } } Serial.println("Network created"); Serial.print("IP: "); Serial.println(WiFly.ip()); Serial.println("Starting Server..."); server.begin(); Serial.print("Server started, waiting for client."); } void loop() { delay(200); WiFlyClient client = server.available(); if (client) { Serial.println("Client Found."); // a string to store received commands String current_command = ""; while (client.connected()) { if (client.available()) { //Gets a character from the sent request. char c = client.read(); if (c=='#' || c=='\n') //End of extraneous output { current_command = ""; } else if(c!= '\n') { current_command+=c; } if (current_command== "get") { // output the value of each analog input pin for (int i = 0; i < 6; i++) { client.print("analog input "); client.print(i); client.print(" is "); client.print(analogRead(i)); client.println("<br />"); } } else if(current_command== "hello") { client.println("Hello there, I'm still here."); } else if (current_command== "quit") { client.println("Goodbye..."); client.stop(); current_command == ""; break; } else if (current_command == "*OPEN*") { current_command == ""; } } } // give the web browser time to receive the data delay(200); // close the connection client.stop(); } } If anyone understands this better then I (I`m new to arduino) please leave some helpful comments. Or just help me out on getting this little web server up and running so that I can hit it with more then one request. If there is any other helpful information I can provide please let me know. Thanks for reading and hope you can help. EDIT: Using telnet I can successfully connect (the first time) and send commands to the arduino including one to terminate the connection (calls the client.stop() method). But when I try to reconnect though telnet, it says the connection was successful but on the arduino it's still looping thinking the client is still false. WHAT??? I know right, I'm getting mixed messages from telnet vs arduino. None of the commands work obviously since the ardunio is still looping waiting for a client that evaluates to true. I'm gonna take a look at WiFlyServer from the library I imported and see if I can dig up the problem because somehow that server.available() method isn't finding new clients. Noticing a lot of TODO's in the library code.... EDIT: So I found the reason for the problem, it was in WiFlyServer.cpp file from the sparkfun library. The code that was causing the reconnect issue was infact in the server.availible() method. Right at the top of the method, there is a check: // TODO: Ensure no active non-server client connection. if (!WiFly.serverConnectionActive) { activeClient._port = 0; } For some reason when I comment this out, I can reconnect fine and everything works as it should. I will now dive into the library and see if I can fix this, I'm not exactly sure what this is doing but it gets called when the server connection is not active and is somehow blocking subsequent connections. Does anyone have any ideas how I might get to the root of this problem without using this commenting hack? Please help, no-one has commented or answered yet! Don't you want to join in on the fun???

    Read the article

  • Modelling boost::Lockable with semaphore rather than mutex (previously titled: Unlocking a mutex fr

    - by dan
    I'm using the C++ boost::thread library, which in my case means I'm using pthreads. Officially, a mutex must be unlocked from the same thread which locks it, and I want the effect of being able to lock in one thread and then unlock in another. There are many ways to accomplish this. One possibility would be to write a new mutex class which allows this behavior. For example: class inter_thread_mutex{ bool locked; boost::mutex mx; boost::condition_variable cv; public: void lock(){ boost::unique_lock<boost::mutex> lck(mx); while(locked) cv.wait(lck); locked=true; } void unlock(){ { boost::lock_guard<boost::mutex> lck(mx); if(!locked) error(); locked=false; } cv.notify_one(); } // bool try_lock(); void error(); etc. } I should point out that the above code doesn't guarantee FIFO access, since if one thread calls lock() while another calls unlock(), this first thread may acquire the lock ahead of other threads which are waiting. (Come to think of it, the boost::thread documentation doesn't appear to make any explicit scheduling guarantees for either mutexes or condition variables). But let's just ignore that (and any other bugs) for now. My question is, if I decide to go this route, would I be able to use such a mutex as a model for the boost Lockable concept. For example, would anything go wrong if I use a boost::unique_lock< inter_thread_mutex for RAII-style access, and then pass this lock to boost::condition_variable_any.wait(), etc. On one hand I don't see why not. On the other hand, "I don't see why not" is usually a very bad way of determining whether something will work. The reason I ask is that if it turns out that I have to write wrapper classes for RAII locks and condition variables and whatever else, then I'd rather just find some other way to achieve the same effect. EDIT: The kind of behavior I want is basically as follows. I have an object, and it needs to be locked whenever it is modified. I want to lock the object from one thread, and do some work on it. Then I want to keep the object locked while I tell another worker thread to complete the work. So the first thread can go on and do something else while the worker thread finishes up. When the worker thread gets done, it unlocks the mutex. And I want the transition to be seemless so nobody else can get the mutex lock in between when thread 1 starts the work and thread 2 completes it. Something like inter_thread_mutex seems like it would work, and it would also allow the program to interact with it as if it were an ordinary mutex. So it seems like a clean solution. If there's a better solution, I'd be happy to hear that also. EDIT AGAIN: The reason I need locks to begin with is that there are multiple master threads, and the locks are there to prevent them from accessing shared objects concurrently in invalid ways. So the code already uses loop-level lock-free sequencing of operations at the master thread level. Also, in the original implementation, there were no worker threads, and the mutexes were ordinary kosher mutexes. The inter_thread_thingy came up as an optimization, primarily to improve response time. In many cases, it was sufficient to guarantee that the "first part" of operation A, occurs before the "first part" of operation B. As a dumb example, say I punch object 1 and give it a black eye. Then I tell object 1 to change it's internal structure to reflect all the tissue damage. I don't want to wait around for the tissue damage before I move on to punch object 2. However, I do want the tissue damage to occur as part of the same operation; for example, in the interim, I don't want any other thread to reconfigure the object in such a way that would make tissue damage an invalid operation. (yes, this example is imperfect in many ways, and no I'm not working on a game) So we made the change to a model where ownership of an object can be passed to a worker thread to complete an operation, and it actually works quite nicely; each master thread is able to get a lot more operations done because it doesn't need to wait for them all to complete. And, since the event sequencing at the master thread level is still loop-based, it is easy to write high-level master-thread operations, as they can be based on the assumption that an operation is complete when the corresponding function call returns. Finally, I thought it would be nice to use inter_thread mutex/semaphore thingies using RAII with boost locks to encapsulate the necessary synchronization that is required to make the whole thing work.

    Read the article

  • Fast multi-window rendering with C#

    - by seb
    I've been searching and testing different kind of rendering libraries for C# days for many weeks now. So far I haven't found a single library that works well on multi-windowed rendering setups. The requirement is to be able to run the program on 12+ monitor setups (financial charting) without latencies on a fast computer. Each window needs to update multiple times every second. While doing this CPU needs to do lots of intensive and time critical tasks so some of the burden has to be shifted to GPUs. That's where hardware rendering steps in, in another words DirectX or OpenGL. I have tried GDI+ with windows forms and figured it's way too slow for my needs. I have tried OpenGL via OpenTK (on windows forms control) which seemed decently quick (I still have some tests to run on it) but painfully difficult to get working properly (hard to find/program good text rendering libraries). Recently I tried DirectX9, DirectX10 and Direct2D with Windows forms via SharpDX. I tried a separate device for each window and a single device/multiple swap chains approaches. All of these resulted in very poor performance on multiple windows. For example if I set target FPS to 20 and open 4 full screen windows on different monitors the whole operating system starts lagging very badly. Rendering is simply clearing the screen to black, no primitives rendered. CPU usage on this test was about 0% and GPU usage about 10%, I don't understand what is the bottleneck here? My development computer is very fast, i7 2700k, AMD HD7900, 16GB ram so the tests should definitely run on this one. In comparison I did some DirectX9 tests on C++/Win32 API one device/multiple swap chains and I could open 100 windows spread all over the 4-monitor workspace (with 3d teapot rotating on them) and still had perfectly responsible operating system (fps was dropping of course on the rendering windows quite badly to around 5 which is what I would expect running 100 simultaneous renderings). Does anyone know any good ways to do multi-windowed rendering on C# or am I forced to re-write my program in C++ to get that performance (major pain)? I guess I'm giving OpenGL another shot before I go the C++ route... I'll report any findings here. Test methods for reference: For C# DirectX one-device multiple swapchain test I used the method from this excellent answer: Display Different images per monitor directX 10 Direct3D10 version: I created the d3d10device and DXGIFactory like this: D3DDev = new SharpDX.Direct3D10.Device(SharpDX.Direct3D10.DriverType.Hardware, SharpDX.Direct3D10.DeviceCreationFlags.None); DXGIFac = new SharpDX.DXGI.Factory(); Then initialized the rendering windows like this: var scd = new SwapChainDescription(); scd.BufferCount = 1; scd.ModeDescription = new ModeDescription(control.Width, control.Height, new Rational(60, 1), Format.R8G8B8A8_UNorm); scd.IsWindowed = true; scd.OutputHandle = control.Handle; scd.SampleDescription = new SampleDescription(1, 0); scd.SwapEffect = SwapEffect.Discard; scd.Usage = Usage.RenderTargetOutput; SC = new SwapChain(Parent.DXGIFac, Parent.D3DDev, scd); var backBuffer = Texture2D.FromSwapChain<Texture2D>(SC, 0); _rt = new RenderTargetView(Parent.D3DDev, backBuffer); Drawing command executed on each rendering iteration is simply: Parent.D3DDev.ClearRenderTargetView(_rt, new Color4(0, 0, 0, 0)); SC.Present(0, SharpDX.DXGI.PresentFlags.None); DirectX9 version is very similar: Device initialization: PresentParameters par = new PresentParameters(); par.PresentationInterval = PresentInterval.Immediate; par.Windowed = true; par.SwapEffect = SharpDX.Direct3D9.SwapEffect.Discard; par.PresentationInterval = PresentInterval.Immediate; par.AutoDepthStencilFormat = SharpDX.Direct3D9.Format.D16; par.EnableAutoDepthStencil = true; par.BackBufferFormat = SharpDX.Direct3D9.Format.X8R8G8B8; // firsthandle is the handle of first rendering window D3DDev = new SharpDX.Direct3D9.Device(new Direct3D(), 0, DeviceType.Hardware, firsthandle, CreateFlags.SoftwareVertexProcessing, par); Rendering window initialization: if (parent.D3DDev.SwapChainCount == 0) { SC = parent.D3DDev.GetSwapChain(0); } else { PresentParameters pp = new PresentParameters(); pp.Windowed = true; pp.SwapEffect = SharpDX.Direct3D9.SwapEffect.Discard; pp.BackBufferFormat = SharpDX.Direct3D9.Format.X8R8G8B8; pp.EnableAutoDepthStencil = true; pp.AutoDepthStencilFormat = SharpDX.Direct3D9.Format.D16; pp.PresentationInterval = PresentInterval.Immediate; SC = new SharpDX.Direct3D9.SwapChain(parent.D3DDev, pp); } Code for drawing loop: SharpDX.Direct3D9.Surface bb = SC.GetBackBuffer(0); Parent.D3DDev.SetRenderTarget(0, bb); Parent.D3DDev.Clear(ClearFlags.Target, Color.Black, 1f, 0); SC.Present(Present.None, new SharpDX.Rectangle(), new SharpDX.Rectangle(), HWND); bb.Dispose(); C++ DirectX9/Win32 API test with multiple swapchains and one device code is here: http://pastebin.com/tjnRvATJ It's a modified version from Kevin Harris's nice example code.

    Read the article

  • capturing video from ip camera

    - by Ruby
    I am trying to capture video from ip camera into my application , its giving exception com.sun.image.codec.jpeg.ImageFormatException: Not a JPEG file: starts with 0x0d 0x0a at sun.awt.image.codec.JPEGImageDecoderImpl.readJPEGStream(Native Method) at sun.awt.image.codec.JPEGImageDecoderImpl.decodeAsBufferedImage(Unknown Source) at test.AxisCamera1.readJPG(AxisCamera1.java:130) at test.AxisCamera1.readMJPGStream(AxisCamera1.java:121) at test.AxisCamera1.readStream(AxisCamera1.java:100) at test.AxisCamera1.run(AxisCamera1.java:171) at java.lang.Thread.run(Unknown Source) its giving exception at image = decoder.decodeAsBufferedImage(); Here is the code i am trying private static final long serialVersionUID = 1L; public boolean useMJPGStream = true; public String jpgURL = "http://ip here/video.cgi/jpg/image.cgi?resolution=640×480"; public String mjpgURL = "http://ip here /video.cgi/mjpg/video.cgi?resolution=640×480"; DataInputStream dis; private BufferedImage image = null; public Dimension imageSize = null; public boolean connected = false; private boolean initCompleted = false; HttpURLConnection huc = null; Component parent; /** Creates a new instance of AxisCamera */ public AxisCamera1(Component parent_) { parent = parent_; } public void connect() { try { URL u = new URL(useMJPGStream ? mjpgURL : jpgURL); huc = (HttpURLConnection) u.openConnection(); // System.out.println(huc.getContentType()); InputStream is = huc.getInputStream(); connected = true; BufferedInputStream bis = new BufferedInputStream(is); dis = new DataInputStream(bis); if (!initCompleted) initDisplay(); } catch (IOException e) { // incase no connection exists wait and try // again, instead of printing the error try { huc.disconnect(); Thread.sleep(60); } catch (InterruptedException ie) { huc.disconnect(); connect(); } connect(); } catch (Exception e) { ; } } public void initDisplay() { // setup the display if (useMJPGStream) readMJPGStream(); else { readJPG(); disconnect(); } imageSize = new Dimension(image.getWidth(this), image.getHeight(this)); setPreferredSize(imageSize); parent.setSize(imageSize); parent.validate(); initCompleted = true; } public void disconnect() { try { if (connected) { dis.close(); connected = false; } } catch (Exception e) { ; } } public void paint(Graphics g) { // used to set the image on the panel if (image != null) g.drawImage(image, 0, 0, this); } public void readStream() { // the basic method to continuously read the // stream try { if (useMJPGStream) { while (true) { readMJPGStream(); parent.repaint(); } } else { while (true) { connect(); readJPG(); parent.repaint(); disconnect(); } } } catch (Exception e) { ; } } public void readMJPGStream() { // preprocess the mjpg stream to remove the // mjpg encapsulation readLine(3, dis); // discard the first 3 lines readJPG(); readLine(2, dis); // discard the last two lines } public void readJPG() { // read the embedded jpeg image try { JPEGImageDecoder decoder = JPEGCodec.createJPEGDecoder(dis); image = decoder.decodeAsBufferedImage(); } catch (Exception e) { e.printStackTrace(); disconnect(); } } public void readLine(int n, DataInputStream dis) { // used to strip out the // header lines for (int i = 0; i < n; i++) { readLine(dis); } } public void readLine(DataInputStream dis) { try { boolean end = false; String lineEnd = "\n"; // assumes that the end of the line is marked // with this byte[] lineEndBytes = lineEnd.getBytes(); byte[] byteBuf = new byte[lineEndBytes.length]; while (!end) { dis.read(byteBuf, 0, lineEndBytes.length); String t = new String(byteBuf); System.out.print(t); // uncomment if you want to see what the // lines actually look like if (t.equals(lineEnd)) end = true; } } catch (Exception e) { e.printStackTrace(); } } public void run() { System.out.println("in Run..................."); connect(); readStream(); } @SuppressWarnings("deprecation") public static void main(String[] args) { JFrame jframe = new JFrame(); jframe.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); AxisCamera1 axPanel = new AxisCamera1(jframe); new Thread(axPanel).start(); jframe.getContentPane().add(axPanel); jframe.pack(); jframe.show(); } } Any suggestions what I am doing wrong here??

    Read the article

  • Graphics.MeasureCharacterRanges giving wrong size calculations in C#.Net?

    - by Owen Blacker
    I'm trying to render some text into a specific part of an image in a Web Forms app. The text will be user entered, so I want to vary the font size to make sure it fits within the bounding box. I have code that was doing this fine on my proof-of-concept implementation, but I'm now trying it against the assets from the designer, which are larger, and I'm getting some odd results. I'm running the size calculation as follows: StringFormat fmt = new StringFormat(); fmt.Alignment = StringAlignment.Center; fmt.LineAlignment = StringAlignment.Near; fmt.FormatFlags = StringFormatFlags.NoClip; fmt.Trimming = StringTrimming.None; int size = __startingSize; Font font = __fonts.GetFontBySize(size); while (GetStringBounds(text, font, fmt).IsLargerThan(__textBoundingBox)) { context.Trace.Write("MyHandler.ProcessRequest", "Decrementing font size to " + size + ", as size is " + GetStringBounds(text, font, fmt).Size() + " and limit is " + __textBoundingBox.Size()); size--; if (size < __minimumSize) { break; } font = __fonts.GetFontBySize(size); } context.Trace.Write("MyHandler.ProcessRequest", "Writing " + text + " in " + font.FontFamily.Name + " at " + font.SizeInPoints + "pt, size is " + GetStringBounds(text, font, fmt).Size() + " and limit is " + __textBoundingBox.Size()); I then use the following line to render the text onto an image I'm pulling from the filesystem: g.DrawString(text, font, __brush, __textBoundingBox, fmt); where: __fonts is a PrivateFontCollection, PrivateFontCollection.GetFontBySize is an extension method that returns a FontFamily RectangleF __textBoundingBox = new RectangleF(150, 110, 212, 64); int __minimumSize = 8; int __startingSize = 48; Brush __brush = Brushes.White; int size starts out at 48 and decrements within that loop Graphics g has SmoothingMode.AntiAlias and TextRenderingHint.AntiAlias set context is a System.Web.HttpContext (this is an excerpt from the ProcessRequest method of an IHttpHandler) The other methods are: private static RectangleF GetStringBounds(string text, Font font, StringFormat fmt) { CharacterRange[] range = { new CharacterRange(0, text.Length) }; StringFormat myFormat = fmt.Clone() as StringFormat; myFormat.SetMeasurableCharacterRanges(range); using (Graphics g = Graphics.FromImage(new Bitmap( (int) __textBoundingBox.Width - 1, (int) __textBoundingBox.Height - 1))) { g.SmoothingMode = System.Drawing.Drawing2D.SmoothingMode.AntiAlias; g.TextRenderingHint = System.Drawing.Text.TextRenderingHint.AntiAlias; Region[] regions = g.MeasureCharacterRanges(text, font, __textBoundingBox, myFormat); return regions[0].GetBounds(g); } } public static string Size(this RectangleF rect) { return rect.Width + "×" + rect.Height; } public static bool IsLargerThan(this RectangleF a, RectangleF b) { return (a.Width > b.Width) || (a.Height > b.Height); } Now I have two problems. Firstly, the text sometimes insists on wrapping by inserting a line-break within a word, when it should just fail to fit and cause the while loop to decrement again. I can't see why it is that Graphics.MeasureCharacterRanges thinks that this fits within the box when it shouldn't be word-wrapping within a word. This behaviour is exhibited irrespective of the character set used (I get it in Latin alphabet words, as well as other parts of the Unicode range, like Cyrillic, Greek, Georgian and Armenian). Is there some setting I should be using to force Graphics.MeasureCharacterRanges only to be word-wrapping at whitespace characters (or hyphens)? This first problem is the same as post 2499067. Secondly, in scaling up to the new image and font size, Graphics.MeasureCharacterRanges is giving me heights that are wildly off. The RectangleF I am drawing within corresponds to a visually apparent area of the image, so I can easily see when the text is being decremented more than is necessary. Yet when I pass it some text, the GetBounds call is giving me a height that is almost double what it's actually taking. Using trial and error to set the __minimumSize to force an exit from the while loop, I can see that 24pt text fits within the bounding box, yet Graphics.MeasureCharacterRanges is reporting that the height of that text, once rendered to the image, is 122px (when the bounding box is 64px tall and it fits within that box). Indeed, without forcing the matter, the while loop iterates to 18pt, at which point Graphics.MeasureCharacterRanges returns a value that fits. The trace log excerpt is as follows: Decrementing font size to 24, as size is 193×122 and limit is 212×64 Decrementing font size to 23, as size is 191×117 and limit is 212×64 Decrementing font size to 22, as size is 200×75 and limit is 212×64 Decrementing font size to 21, as size is 192×71 and limit is 212×64 Decrementing font size to 20, as size is 198×68 and limit is 212×64 Decrementing font size to 19, as size is 185×65 and limit is 212×64 Writing VENNEGOOR of HESSELINK in DIN-Black at 18pt, size is 178×61 and limit is 212×64 So why is Graphics.MeasureCharacterRanges giving me a wrong result? I could understand it being, say, the line height of the font if the loop stopped around 21pt (which would visually fit, if I screenshot the results and measure it in Paint.Net), but it's going far further than it should be doing because, frankly, it's returning the wrong damn results. Any and all help gratefully received. Thanks!

    Read the article

  • Users being forced to re-login randomly, before session and auth ticket timeout values are reached

    - by Don
    I'm having reports and complaints from my user that they will be using a screen and get kicked back to the login screen immediately on their next request. It doesn't happen all the time but randomly. After looking at the Web server the error that shows up in the application event log is: Event code: 4005 Event message: Forms authentication failed for the request. Reason: The ticket supplied has expired. Everything that I read starts out with people asking about web gardens or load balancing. We are not using either of those. We're a single Windows 2003 (32-bit OS, 64-bit hardware) Server with IIS6. This is the only website on this server too. This behavior does not generate any application exceptions or visible issues to the user. They just get booted back to the login screen and are forced to login. As you can imagine this is extremely annoying and counter-productive for our users. Here's what I have set in my web.config for the application in the root: <authentication mode="Forms"> <forms name=".TcaNet" protection="All" timeout="40" loginUrl="~/Login.aspx" defaultUrl="~/MyHome.aspx" path="/" slidingExpiration="true" requireSSL="false" /> </authentication> I have also read that if you have some locations setup that no longer exist or are bogus you could have issues. My path attributes are all valid directories so that shouldn't be the problem: <location path="js"> <system.web> <authorization> <allow users="*" /> </authorization> </system.web> </location> <location path="images"> <system.web> <authorization> <allow users="*" /> </authorization> </system.web> </location> <location path="anon"> <system.web> <authorization> <allow users="*" /> </authorization> </system.web> </location> <location path="App_Themes"> <system.web> <authorization> <allow users="*" /> </authorization> </system.web> </location> <location path="NonSSL"> <system.web> <authorization> <allow users="*" /> </authorization> </system.web> </location> The only thing I'm not clear on is if my timeout value in the forms property for the auth ticket has to be the same as my session timeout value (defined in the app's configuration in IIS). I've read some things that say you should have the authentication timeout shorter (40) than the session timeout (45) to avoid possible complications. Either way we have users that get kicked to the login screen a minute or two after their last action. So the session definitely should not be expiring. Update 2/23/09: I've since set the session timeout and authentication ticket timeout values to both be 45 and the problem still seems to be happening. The only other web.config in the application is in 1 virtual directory that hosts Community Server. That web.config's authentication settings are as follows: <authentication mode="Forms"> <forms name=".TcaNet" protection="All" timeout="40" loginUrl="~/Login.aspx" defaultUrl="~/MyHome.aspx" path="/" slidingExpiration="true" requireSSL="true" /> </authentication> And while I don't believe it applies unless you're in a web garden, I have both of the machine key values set in both web.config files to be the same (removed for convenience): <machineKey validationKey="<MYVALIDATIONKEYHERE>" decryptionKey="<MYDECRYPTIONKEYHERE>" validation="SHA1" /> <machineKey validationKey="<MYVALIDATIONKEYHERE>" decryptionKey="<MYDECRYPTIONKEYHERE>" validation="SHA1"/> Any help with this would be greatly appreciated. This seems to be one of those problems that yields a ton of Google results, none of which seem to be fitting into my situation so far.

    Read the article

  • What's a reliable and practical way to protect software with a user license ?

    - by Frank
    I know software companies use licenses to protect their softwares, but I also know there are keygen programs to bypass them. I'm a Java developer, if I put my program online for sale, what's a reliable and practical way to protect it ? How about something like this, would it work ? <1> I use ProGuard to protect the source code. <2> Sign the executable Jar file. <3> Since my Java program only need to work on PC [I need to use JDIC in it], I wrap the final executable Jar into an .exe file which makes it harder to decompile. <4> When a user first downloads and runs my app, it checks for a Pass file on his PC. <5> If the Pass file doesn't exist, run the app in demo mode, exits in 5 minutes. <6> When demo exits a panel opens with a "Buy Now" button. This demo mode repeats forever unless step <7> happens. <7> If user clicks the "Buy Now" button, he fills out a detailed form [name, phone, email ...], presses a "Verify Info" button to save the form to a Pass file, leaving license Key # field empty in this newly generated Pass file. <8> Pressing "Verify Info" button will take him to a html form pre-filled with his info to verify what he is buying, also hidden in the form's input filed is a license Key number. He can now press a "Pay Now" button to goto Paypal to finish the process. <9> The hidden license Key # will be passed to Paypal as product Id info and emailed to me. <10> After I got the payment and Paypal email, I'll add the license Key # to a valid license Key list, and put it on my site, only I know the url. The list is updated hourly. <11> Few hours later when the user runs the app again, it can find the Pass file on his PC, but the license Key # value is empty, so it goes to the valid list url to see if its license Key # is on the list, if so, write the license Key # into the Pass file, and the next time it starts again, it will find the valid license Key # and start in purchased mode without exiting in 5 minutes. <12> If it can't find its license Key # on the list from my url, run in demo mode. <13> In order to prevent a user from copying and using another paid user's valid Pass file, the license Key # is unique to each PC [I'm trying to find how], so a valid Pass file only works on one PC. Only after a user has paid will Paypal email me the valid license Key # with his payment. <14> The Id checking goes like this : Use the CPU ID : "CPU_01-02-ABC" for example, encrypt it to the result ID : "XeR5TY67rgf", and compare it to the list on my url, if "XeR5TY67rgf" is not on my valid user list, run in demo mode. If it exists write "XeR5TY67rgf" into the Pass File license field. In order to get a unique license Key, can I use his PC's CPU Id ? Or something unique and useful [ relatively less likely to change ]. If so let's say this CPU ID is "CPU_01-02-ABC", I can encrypt it to something like "XeR5TY67rgf", and pass it to Paypal as product Id in the hidden html form field, then I'll get it from Paypal's email notification, and add it to the valid license Key # list on the url. So, even if a hacker knows it uses CPU Id, he can't write it into the Pass file field, because only encrypted Ids are valid Ids. And only my program knows how to generate the encrypted Ids. And even if another hacker knows the encrypted Id is hidden in the html form input field, as long as it's not on my url list, it's still invalid. Can anyone find any flaw in the above system ? Is it practical ? And most importantly how do I get hold of this unique ID that can represent a user's PC ? Frank

    Read the article

  • Google Web Toolkit Deferred Binding Issue

    - by snctln
    I developed a web app using GWT about 2 years ago, since then the application has evolved. In its current state it relies on fetching a single XML file and parsing the information from it. Overall this works great. A requirement of this app is that it needs to be able to be ran from the filesystem (file:///..) as well as the traditional model of running from a webserver (http://...) Fetching this file from a webserver works exactly as expected using a RequestBuilder object. When running the app from the filesystem Firefox, Opera, Safari, and Chrome all behave as expected. When running the app from the filesystem using IE7 or IE8 the RequestBuilder.send() call fails, the information about the error suggests that there is a problem accessing the file due to violating the same origin policy. The app worked as expected in IE6 but not in IE7 or IE8. So I looked at the source code of RequestBuilder.java and saw that the actual request was being executed with an XMLHttpRequest GWT object. So I looked at the source code for XMLHttpRequest.java and found out some information. Here is the code (starts at line 83 in XMLHttpRequest.java) public static native XMLHttpRequest create() /*-{ if ($wnd.XMLHttpRequest) { return new XMLHttpRequest(); } else { try { return new ActiveXObject('MSXML2.XMLHTTP.3.0'); } catch (e) { return new ActiveXObject("Microsoft.XMLHTTP"); } } }-*/; So basically if an XMLHttpRequest cannot be created (like in IE6 because it is not available) an ActiveXObject is used instead. I read up a little bit more on the IE implementation of XMLHttpRequest, and it appears that it is only supported for interacting with files on a webserver. I found a setting in IE8 (Tools-Internet Options-Advanced-Security-Enable native XMLHTTP support), when I uncheck this box my app works. I assume this is because I am more of less telling IE to not use their implementation of XmlHttpRequest, so GWT just uses an ActiveXObject because it doesn't think the native XmlHttpRequest is available. This fixes the problem, but is hardly a long term solution. I can currently catch a failed send request and verify that it was trying to fetch the XML file from the filesystem using normal GWT. What I would like to do in this case is catch the IE7 and IE8 case and have them use a ActiveXObject instead of a native XmlHttpRequest object. There was a posting on the GWT google group that had a supposed solution for this problem (link). Looking at it I can tell that it was created for an older version of GWT. I am using the latest release and think that this is more or less what I would like to do (use GWT deferred binding to detect a specific browser type and run my own implementation of XMLHttpRequest.java in place of the built in GWT implementation). Here is the code that I am trying to use package com.mycompany.myapp.client; import com.google.gwt.xhr.client.XMLHttpRequest; public class XMLHttpRequestIE7or8 extends XMLHttpRequest { // commented out the "override" so that eclipse and the ant build script don't throw errors //@Override public static native XMLHttpRequest create() /*-{ try { return new ActiveXObject('MSXML2.XMLHTTP.3.0'); } catch (e) { return new ActiveXObject("Microsoft.XMLHTTP"); } }-*/; // have an empty protected constructor so the ant build script doesn't throw errors // the actual XMLHttpRequest constructor is empty as well so this shouldn't cause any problems protected XMLHttpRequestIE7or8() { } }; And here are the lines that I added to my module xml <replace-with class="com.mycompany.myapp.client.XMLHttpRequestIE7or8"> <when-type-is class="com.google.gwt.xhr.client.XMLHttpRequest"/> <any> <when-property-is name="user.agent" value="ie7" /> <when-property-is name="user.agent" value="ie8" /> </any> </replace-with> From what I can tell this should work, but my code never runs. Does anyone have any idea of what I am doing wrong? Should I not do this via deferred binding and just use native javascript when I catch the fail case instead? Is there a different way of approaching this problem that I have not mentioned? All replies are welcome.

    Read the article

  • WCF 4: Fileless Activation Fails On XP (IIS 5) that has SSL port enabled.

    - by Richard Collette
    I have a service being hosted in IIS on XP via fileless activation. The service starts fine when there is no SSL port enabled for IIS but when the SSL port is enabled, I get the error message: System.ServiceModel.ServiceActivationException: The service '/SkillsPrototype.Web/services/Linkage.svc' cannot be activated due to an exception during compilation. The exception message is: A binding instance has already been associated to listen URI 'http://rcollet.hsb-corp.hsb.com/SkillsPrototype.Web/Services/Linkage.svc'. If two endpoints want to share the same ListenUri, they must also share the same binding object instance. The two conflicting endpoints were either specified in AddServiceEndpoint() calls, in a config file, or a combination of AddServiceEndpoint() and config. . ---> System.InvalidOperationException: A binding instance has already been associated to listen URI 'http://rcollet.hsb-corp.hsb.com/SkillsPrototype.Web/Services/Linkage.svc'. If two endpoints want to share the same ListenUri, they must also share the same binding object instance. The two conflicting endpoints were either specified in AddServiceEndpoint() calls, in a config file, or a combination of AddServiceEndpoint() and config. My service model configuration is <system.serviceModel> <diagnostics wmiProviderEnabled="true"> <messageLogging logEntireMessage="true" logMalformedMessages="true" logMessagesAtServiceLevel="true" logMessagesAtTransportLevel="true" maxMessagesToLog="3000"/> </diagnostics> <standardEndpoints> <webHttpEndpoint> <standardEndpoint name="" helpEnabled="true" automaticFormatSelectionEnabled="true" /> </webHttpEndpoint> </standardEndpoints> <behaviors> <serviceBehaviors> <behavior> <serviceMetadata httpGetEnabled="true"/> <serviceDebug includeExceptionDetailInFaults="true" /> </behavior> </serviceBehaviors> </behaviors> <bindings> <webHttpBinding> <binding> <security mode="None"> <transport clientCredentialType="None"/> </security> </binding> </webHttpBinding> </bindings> <protocolMapping> </protocolMapping> <services> </services> <serviceHostingEnvironment multipleSiteBindingsEnabled="false"> <serviceActivations> <clear/> <add factory="System.ServiceModel.Activation.WebScriptServiceHostFactory" service="SkillsPrototype.ServiceModel.Linkage" relativeAddress="~/Services/Linkage.svc"/> </serviceActivations> </serviceHostingEnvironment> </system.serviceModel> When you look in the svclog file, there two base addresses that are returned when SSL is enabled, one for http and one for https. I suspect that this is part of the issue but I am not sure how to resolve it. <E2ETraceEvent xmlns="http://schemas.microsoft.com/2004/06/E2ETraceEvent"> <System xmlns="http://schemas.microsoft.com/2004/06/windows/eventlog/system"> <EventID>524333</EventID> <Type>3</Type> <SubType Name="Information">0</SubType> <Level>8</Level> <TimeCreated SystemTime="2010-06-16T17:40:55.8168605Z" /> <Source Name="System.ServiceModel" /> <Correlation ActivityID="{95927f9a-fa90-46f4-af8b-721322a87aaa}" /> <Execution ProcessName="aspnet_wp" ProcessID="1888" ThreadID="5" /> <Channel/> <Computer>RCOLLET</Computer> </System> <ApplicationData> <TraceData> <DataItem> <TraceRecord xmlns="http://schemas.microsoft.com/2004/10/E2ETraceEvent/TraceRecord" Severity="Information"> <TraceIdentifier>http://msdn.microsoft.com/en-US/library/System.ServiceModel.ServiceHostBaseAddresses.aspx</TraceIdentifier> <Description>ServiceHost base addresses.</Description> <AppDomain>/LM/w3svc/1/ROOT/SkillsPrototype.Web-1-129211836532542949</AppDomain> <Source>System.ServiceModel.WebScriptServiceHost/49153359</Source> <ExtendedData xmlns="http://schemas.microsoft.com/2006/08/ServiceModel/CollectionTraceRecord"> <BaseAddresses> <Address>http://rcollet.hsb-corp.hsb.com/SkillsPrototype.Web/Services/Linkage.svc</Address> <Address>https://rcollet.hsb-corp.hsb.com/SkillsPrototype.Web/Services/Linkage.svc</Address> </BaseAddresses> </ExtendedData> </TraceRecord> </DataItem> </TraceData> </ApplicationData> </E2ETraceEvent> I can't post the full service log due to character limits on the post.

    Read the article

  • friendship and operator overloading help

    - by sil3nt
    hello there, I have the following class #ifndef Container_H #define Container_H #include <iostream> using namespace std; class Container{ friend bool operator==(const Container &rhs,const Container &lhs); public: void display(ostream & out) const; private: int sizeC; // size of Container int capacityC; // capacity of dynamic array int * elements; // pntr to dynamic array }; ostream & operator<< (ostream & out, const Container & aCont); #endif and this source file #include "container.h" /*----------------------------********************************************* note: to test whether capacityC and sizeC are equal, must i add 1 to sizeC? seeing as sizeC starts off with 0?? */ Container::Container(int maxCapacity){ capacityC = maxCapacity; elements = new int [capacityC]; sizeC = 0; } Container::~Container(){ delete [] elements; } Container::Container(const Container & origCont){ //copy constructor? int i = 0; for (i = 0; i<capacityC; i++){ //capacity to be used here? (*this).elements[i] = origCont.elements[i]; } } bool Container::empty() const{ if (sizeC == 0){ return true; }else{ return false; } } void Container::insert(int item, int index){ if ( sizeC == capacityC ){ cout << "\n*** Next: Bye!\n"; return; // ? have return here? } if ( (index >= 0) && (index <= capacityC) ){ elements[index] = item; sizeC++; } if ( (index < 0) && (index > capacityC) ){ cout<<"*** Illegal location to insert--"<< index << ". Container unchanged. ***\n"; }//error here not valid? according to original a3? have i implemented wrong? } void Container::erase(int index){ if ( (index >= 0) && (index <= capacityC) ){ //correct here? legal location? int i = 0; while (i<capacityC){ //correct? elements[index] = elements[index+1]; //check if index increases here. i++; } sizeC=sizeC-1; //correct? updated sizeC? }else{ cout<<"*** Illegal location to be removed--"<< index << ". Container unchanged. ***\n"; } } int Container::size()const{ return sizeC; //correct? } /* bool Container::operator==(const Container &rhs,const Container &lhs){ int equal = 0, i = 0; for (i = 0; i < capacityC ; i++){ if ( rhs.elements[i] == lhs.elements[i] ){ equal++; } } if (equal == sizeC){ return true; }else{ return false; } } ostream & operator<< (ostream & out, const Container & aCont){ int i = 0; for (i = 0; i<sizeC; i++){ out<< aCont.elements[i] << " " << endl; } } */ I dont have the other functions in the header file (just a quikie). Anyways, the last two functions in "/* */" I cant get to work, what am I doing wrong here? the first function is to see whether the two arrays are equal to one another

    Read the article

  • javascript robot

    - by sarah
    hey guys! I need help making this robot game in javascript (notepad++) please HELP! I'm really confused by the functions <html> <head><title>Robot Invasion 2199</title></head> <body style="text-align:center" onload="newGame();"> <h2>Robot Invasion 2199</h2> <div style="text-align:center; background:white; margin-right: auto; margin-left:auto;"> <div style=""> <div style="width: auto; border:solid thin red; text-align:center; margin:10px auto 10px auto; padding:1ex 0ex;font-family: monospace" id="scene"></pre> </div> <div><span id="status"></span></div> <form style="text-align:center"> PUT THE CONTROL PANEL HERE!!! </form> </div> <script type="text/javascript"> // GENERAL SUGGESTIONS ABOUT WRITING THIS PROGRAM: // You should test your program before you've finished writing all of the // functions. The newGame, startLevel, and update functions should be your // first priority since they're all involved in displaying the initial state // of the game board. // // Next, work on putting together the control panel for the game so that you // can begin to interact with it. Your next goal should be to get the move // function working so that everything else can be testable. Note that all nine // of the movement buttons (including the pass button) should call the move // function when they are clicked, just with different parameters. // // All the remaining functions can be completed in pretty much any order, and // you'll see the game gradually improve as you write the functions. // // Just remember to keep your cool when writing this program. There are a // bunch of functions to write, but as long as you stay focused on the function // you're writing, each individual part is not that hard. // These variables specify the number of rows and columns in the game board. // Use these variables instead of hard coding the number of rows and columns // in your loops, etc. // i.e. Write: // for(i = 0; i < NUM_ROWS; i++) ... // not: // for(i = 0; i < 15; i++) ... var NUM_ROWS = 15; var NUM_COLS = 25; // Scene is arguably the most important variable in this whole program. It // should be set up as a two-dimensional array (with NUM_ROWS rows and // NUM_COLS columns). This represents the game board, with the scene[i][j] // representing what's in row i, column j. In particular, the entries should // be: // // "." for empty space // "R" for a robot // "S" for a scrap pile // "H" for the hero var scene; // These variables represent the row and column of the hero's location, // respectively. These are more of a conveniece so you don't have to search // for the "H" in the scene array when you need to know where the hero is. var heroRow; var heroCol; // These variables keep track of various aspects of the gameplay. // score is just the number of robots destroyed. // screwdrivers is the number of sonic screwdriver charges left. // fastTeleports is the number of fast teleports remaining. // level is the current level number. // Be sure to reset all of these when a new game starts, and update them at the // appropriate times. var score; var screwdrivers; var fastTeleports; var level; // This function should use a sonic screwdriver if there are still charges // left. The sonic screwdriver turns any robot that is in one of the eight // squares immediately adjacent to the hero into scrap. If there are no charges // left, then this function should instead pop up a dialog box with the message // "Out of sonic screwdrivers!". As with any function that alters the game's // state, this function should call the update function when it has finished. // // Your "Sonic Screwdriver" button should call this function directly. function screwdriver() { // WRITE THIS FUNCTION } // This function should move the hero to a randomly selected location if there // are still fast teleports left. This function MUST NOT move the hero on to // a square that is already occupied by a robot or a scrap pile, although it // can move the hero next to a robot. The number of fast teleports should also // be decreased by one. If there are no fast teleports left, this function // should just pop up a message box saying so. As with any function that alters // the game's state, this function should call the update function when it has // finished. // // HINT: Have a loop that keeps trying random spots until a valid one is found. // HINT: Use the validPosition function to tell if a spot is valid // // Your "Fast Teleport" button s

    Read the article

  • SetWindowHookEx and execution blocking

    - by Kalaz
    Hello, I just wonder... I mainly use .NET but now I started to investigate WINAPI calls. For example I am using this piece of code to hook to the API functions. It starts freezing, when I try to debug the application... using System; using System.Diagnostics; using System.Runtime.InteropServices; using System.Threading; using System.Windows.Forms; public class Keyboard { private const int WH_KEYBOARD_LL = 13; private const int WM_KEYDOWN = 0x0100; private static LowLevelKeyboardProc _proc = HookCallback; private static IntPtr _hookID = IntPtr.Zero; public static event Action<Keys,bool, bool> KeyDown; public static void Hook() { new Thread(new ThreadStart(()=> { _hookID = SetHook(_proc); Application.Run(); })).Start(); } public static void Unhook() { UnhookWindowsHookEx(_hookID); } private static IntPtr SetHook(LowLevelKeyboardProc proc) { using (Process curProcess = Process.GetCurrentProcess()) using (ProcessModule curModule = curProcess.MainModule) { return SetWindowsHookEx(WH_KEYBOARD_LL, proc, GetModuleHandle(curModule.ModuleName), 0); } } private delegate IntPtr LowLevelKeyboardProc( int nCode, IntPtr wParam, IntPtr lParam); private static IntPtr HookCallback( int nCode, IntPtr wParam, IntPtr lParam) { if (nCode >= 0 && wParam == (IntPtr)WM_KEYDOWN) { int vkCode = Marshal.ReadInt32(lParam); Keys k = (Keys) vkCode; if (KeyDown != null) { KeyDown.BeginInvoke(k, IsKeyPressed(VirtualKeyStates.VK_CONTROL), IsKeyPressed(VirtualKeyStates.VK_SHIFT),null,null); } } return CallNextHookEx(_hookID, nCode, wParam, lParam); } private static bool IsKeyPressed(VirtualKeyStates virtualKeyStates) { return (GetKeyState(virtualKeyStates) & (1 << 7))==128; } [DllImport("user32.dll", CharSet = CharSet.Auto, SetLastError = true)] private static extern IntPtr SetWindowsHookEx(int idHook, LowLevelKeyboardProc lpfn, IntPtr hMod, uint dwThreadId); [DllImport("user32.dll", CharSet = CharSet.Auto, SetLastError = true)] [return: MarshalAs(UnmanagedType.Bool)] private static extern bool UnhookWindowsHookEx(IntPtr hhk); [DllImport("user32.dll", CharSet = CharSet.Auto, SetLastError = true)] private static extern IntPtr CallNextHookEx(IntPtr hhk, int nCode, IntPtr wParam, IntPtr lParam); [DllImport("kernel32.dll", CharSet = CharSet.Auto, SetLastError = true)] private static extern IntPtr GetModuleHandle(string lpModuleName); [DllImport("user32.dll")] static extern short GetKeyState(VirtualKeyStates nVirtKey); } enum VirtualKeyStates : int { VK_LBUTTON = 0x01, VK_RBUTTON = 0x02, VK_CANCEL = 0x03, VK_MBUTTON = 0x04, // VK_XBUTTON1 = 0x05, VK_XBUTTON2 = 0x06, // VK_BACK = 0x08, VK_TAB = 0x09, // VK_CLEAR = 0x0C, VK_RETURN = 0x0D, // VK_SHIFT = 0x10, VK_CONTROL = 0x11, VK_MENU = 0x12, VK_PAUSE = 0x13, VK_CAPITAL = 0x14, // VK_KANA = 0x15, VK_HANGEUL = 0x15, /* old name - should be here for compatibility */ VK_HANGUL = 0x15, VK_JUNJA = 0x17, VK_FINAL = 0x18, VK_HANJA = 0x19, VK_KANJI = 0x19, // VK_ESCAPE = 0x1B, // VK_CONVERT = 0x1C, VK_NONCONVERT = 0x1D, VK_ACCEPT = 0x1E, VK_MODECHANGE = 0x1F, // VK_SPACE = 0x20, VK_PRIOR = 0x21, VK_NEXT = 0x22, VK_END = 0x23, VK_HOME = 0x24, VK_LEFT = 0x25, VK_UP = 0x26, VK_RIGHT = 0x27, VK_DOWN = 0x28, VK_SELECT = 0x29, VK_PRINT = 0x2A, VK_EXECUTE = 0x2B, VK_SNAPSHOT = 0x2C, VK_INSERT = 0x2D, VK_DELETE = 0x2E, VK_HELP = 0x2F, // VK_LWIN = 0x5B, VK_RWIN = 0x5C, VK_APPS = 0x5D, // VK_SLEEP = 0x5F, // VK_NUMPAD0 = 0x60, VK_NUMPAD1 = 0x61, VK_NUMPAD2 = 0x62, VK_NUMPAD3 = 0x63, VK_NUMPAD4 = 0x64, VK_NUMPAD5 = 0x65, VK_NUMPAD6 = 0x66, VK_NUMPAD7 = 0x67, VK_NUMPAD8 = 0x68, VK_NUMPAD9 = 0x69, VK_MULTIPLY = 0x6A, VK_ADD = 0x6B, VK_SEPARATOR = 0x6C, VK_SUBTRACT = 0x6D, VK_DECIMAL = 0x6E, VK_DIVIDE = 0x6F, VK_F1 = 0x70, VK_F2 = 0x71, VK_F3 = 0x72, VK_F4 = 0x73, VK_F5 = 0x74, VK_F6 = 0x75, VK_F7 = 0x76, VK_F8 = 0x77, VK_F9 = 0x78, VK_F10 = 0x79, VK_F11 = 0x7A, VK_F12 = 0x7B, VK_F13 = 0x7C, VK_F14 = 0x7D, VK_F15 = 0x7E, VK_F16 = 0x7F, VK_F17 = 0x80, VK_F18 = 0x81, VK_F19 = 0x82, VK_F20 = 0x83, VK_F21 = 0x84, VK_F22 = 0x85, VK_F23 = 0x86, VK_F24 = 0x87, // VK_NUMLOCK = 0x90, VK_SCROLL = 0x91, // VK_OEM_NEC_EQUAL = 0x92, // '=' key on numpad // VK_OEM_FJ_JISHO = 0x92, // 'Dictionary' key VK_OEM_FJ_MASSHOU = 0x93, // 'Unregister word' key VK_OEM_FJ_TOUROKU = 0x94, // 'Register word' key VK_OEM_FJ_LOYA = 0x95, // 'Left OYAYUBI' key VK_OEM_FJ_ROYA = 0x96, // 'Right OYAYUBI' key // VK_LSHIFT = 0xA0, VK_RSHIFT = 0xA1, VK_LCONTROL = 0xA2, VK_RCONTROL = 0xA3, VK_LMENU = 0xA4, VK_RMENU = 0xA5, // VK_BROWSER_BACK = 0xA6, VK_BROWSER_FORWARD = 0xA7, VK_BROWSER_REFRESH = 0xA8, VK_BROWSER_STOP = 0xA9, VK_BROWSER_SEARCH = 0xAA, VK_BROWSER_FAVORITES = 0xAB, VK_BROWSER_HOME = 0xAC, // VK_VOLUME_MUTE = 0xAD, VK_VOLUME_DOWN = 0xAE, VK_VOLUME_UP = 0xAF, VK_MEDIA_NEXT_TRACK = 0xB0, VK_MEDIA_PREV_TRACK = 0xB1, VK_MEDIA_STOP = 0xB2, VK_MEDIA_PLAY_PAUSE = 0xB3, VK_LAUNCH_MAIL = 0xB4, VK_LAUNCH_MEDIA_SELECT = 0xB5, VK_LAUNCH_APP1 = 0xB6, VK_LAUNCH_APP2 = 0xB7, // VK_OEM_1 = 0xBA, // ';:' for US VK_OEM_PLUS = 0xBB, // '+' any country VK_OEM_COMMA = 0xBC, // ',' any country VK_OEM_MINUS = 0xBD, // '-' any country VK_OEM_PERIOD = 0xBE, // '.' any country VK_OEM_2 = 0xBF, // '/?' for US VK_OEM_3 = 0xC0, // '`~' for US // VK_OEM_4 = 0xDB, // '[{' for US VK_OEM_5 = 0xDC, // '\|' for US VK_OEM_6 = 0xDD, // ']}' for US VK_OEM_7 = 0xDE, // ''"' for US VK_OEM_8 = 0xDF, // VK_OEM_AX = 0xE1, // 'AX' key on Japanese AX kbd VK_OEM_102 = 0xE2, // "<>" or "\|" on RT 102-key kbd. VK_ICO_HELP = 0xE3, // Help key on ICO VK_ICO_00 = 0xE4, // 00 key on ICO // VK_PROCESSKEY = 0xE5, // VK_ICO_CLEAR = 0xE6, // VK_PACKET = 0xE7, // VK_OEM_RESET = 0xE9, VK_OEM_JUMP = 0xEA, VK_OEM_PA1 = 0xEB, VK_OEM_PA2 = 0xEC, VK_OEM_PA3 = 0xED, VK_OEM_WSCTRL = 0xEE, VK_OEM_CUSEL = 0xEF, VK_OEM_ATTN = 0xF0, VK_OEM_FINISH = 0xF1, VK_OEM_COPY = 0xF2, VK_OEM_AUTO = 0xF3, VK_OEM_ENLW = 0xF4, VK_OEM_BACKTAB = 0xF5, // VK_ATTN = 0xF6, VK_CRSEL = 0xF7, VK_EXSEL = 0xF8, VK_EREOF = 0xF9, VK_PLAY = 0xFA, VK_ZOOM = 0xFB, VK_NONAME = 0xFC, VK_PA1 = 0xFD, VK_OEM_CLEAR = 0xFE } It works well even if you put messagebox into the event or something that blocks execution. But it gets bad if you try to put breakpoint into the event. Why? I mean event is not run in the same thread that the windows hook is. That means that It shouldn't block HookCallback. It does however... I would really like to know why is this happening. My theory is that Visual Studio when breaking execution temporarily stops all threads and that means that HookCallback is blocked... Is there any book or valuable resource that would explain concepts behind all of this threading?

    Read the article

  • Convert Decimal to ASCII

    - by Dan Snyder
    I'm having difficulty using reinterpret_cast. Before I show you my code I'll let you know what I'm trying to do. I'm trying to get a filename from a vector full of data being used by a MIPS I processor I designed. Basically what I do is compile a binary from a test program for my processor, dump all the hex's from the binary into a vector in my c++ program, convert all of those hex's to decimal integers and store them in a DataMemory vector which is the data memory unit for my processor. I also have instruction memory. So When my processor runs a SYSCALL instruction such as "Open File" my C++ operating system emulator receives a pointer to the beginning of the filename in my data memory. So keep in mind that data memory is full of ints, strings, globals, locals, all sorts of stuff. When I'm told where the filename starts I do the following: Convert the whole decimal integer element that is being pointed to to its ASCII character representation, and then search from left to right to see if the string terminates, if not then just load each character consecutively into a "filename" string. Do this until termination of the string in memory and then store filename in a table. My difficulty is generating filename from my memory. Here is an example of what I'm trying to do: C++ Syntax (Toggle Plain Text) 1.Index Vector NewVector ASCII filename 2.0 240faef0 128123792 'abc7' 'a' 3.0 240faef0 128123792 'abc7' 'ab' 4.0 240faef0 128123792 'abc7' 'abc' 5.0 240faef0 128123792 'abc7' 'abc7' 6.1 1234567a 243225 'k2s0' 'abc7k' 7.1 1234567a 243225 'k2s0' 'abc7k2' 8.1 1234567a 243225 'k2s0' 'abc7k2s' 9. //EXIT LOOP// 10.1 1234567a 243225 'k2s0' 'abc7k2s' Index Vector NewVector ASCII filename 0 240faef0 128123792 'abc7' 'a' 0 240faef0 128123792 'abc7' 'ab' 0 240faef0 128123792 'abc7' 'abc' 0 240faef0 128123792 'abc7' 'abc7' 1 1234567a 243225 'k2s0' 'abc7k' 1 1234567a 243225 'k2s0' 'abc7k2' 1 1234567a 243225 'k2s0' 'abc7k2s' //EXIT LOOP// 1 1234567a 243225 'k2s0' 'abc7k2s' Here is the code that I've written so far to get filename (I'm just applying this to element 1000 of my DataMemory vector to test functionality. 1000 is arbitrary.): C++ Syntax (Toggle Plain Text) 1.int i = 0; 2.int step = 1000;//top->a0; 3.string filename; 4.char *temp = reinterpret_cast<char*>( DataMemory[1000] );//convert to char 5.cout << "a0:" << top->a0 << endl;//pointer supplied 6.cout << "Data:" << DataMemory[top->a0] << endl;//my vector at pointed to location 7.cout << "Data(1000):" << DataMemory[1000] << endl;//the element I'm testing 8.cout << "Characters:" << &temp << endl;//my temporary char array 9. 10.while(&temp[i]!=0) 11.{ 12. filename+=temp[i];//add most recent non-terminated character to string 13. i++; 14. if(i==4)//when 4 chatacters have been added.. 15. { 16. i=0; 17. step+=1;//restart loop at the next element in DataMemory 18. temp = reinterpret_cast<char*>( DataMemory[step] ); 19. } 20. } 21. cout << "Filename:" << filename << endl; int i = 0; int step = 1000;//top-a0; string filename; char *temp = reinterpret_cast( DataMemory[1000] );//convert to char cout << "a0:" << top-a0 << endl;//pointer supplied cout << "Data:" << DataMemory[top-a0] << endl;//my vector at pointed to location cout << "Data(1000):" << DataMemory[1000] << endl;//the element I'm testing cout << "Characters:" << &temp << endl;//my temporary char array while(&temp[i]!=0) { filename+=temp[i];//add most recent non-terminated character to string i++; if(i==3)//when 4 chatacters have been added.. { i=0; step+=1;//restart loop at the next element in DataMemory temp = reinterpret_cast( DataMemory[step] ); } } cout << "Filename:" << filename << endl; So the issue is that when I do the conversion of my decimal element to a char array I assume that 8 hex #'s will give me 4 characters. Why isn't this this case? Here is my output: C++ Syntax (Toggle Plain Text) 1.a0:0 2.Data:0 3.Data(1000):4428576 4.Characters:0x7fff5fbff128 5.Segmentation fault

    Read the article

  • SSL confirmation dialog popup auto closes in IE8 when re-accessing a JNLP file

    - by haylem
    I'm having this very annoying problem to troubleshoot and have been going at it for way too many days now, so have a go at it. The Environment We have 2 app-servers, which can be located on either the same machine or 2 different machines, and use the same signing certificate, and host 2 different web-apps. Though let's say, for the sake of our study case here, that they are on the same physical machine. So, we have: https://company.com/webapp1/ https://company.com/webapp2/ webapp1 is GWT-based rich-client which contains on one of its screens a menu with an item that is used to invoke a Java WebStart Client located on webapp2. It does so by performing a simple window.open call via this GWT call: Window.open("https://company.com/webapp2/app.jnlp", "_blank", null); Expected Behavior User merrilly goes to webapp1 User navigates to menu entry to start the WebStart app and clicks on it browser fires off a separate window/dialog which, depending on the browser and its security settings, will: request confirmation to navigate to this secure site, directly download the file, and possibly auto-execute a javaws process if there's a file association, otherwise the user can simply click on the file and start the app (or go about doing whatever it takes here). If you close the app, close the dialog, and re-click the menu entry, the same thing should happen again. Actual Behavior On Anything but God-forsaken IE 8 (Though I admit there's also all the god-forsaken pre-IE8 stuff, but the Requirements Lords being merciful we have already recently managed to make them drop these suckers. That was close. Let's hold hands and say a prayer of gratitude.) Stuff just works. JNLP gets downloaded, app executes just fine, you can close the app and re-do all the steps and it will restart happily. People rejoice. Puppies are safe and play on green hills in the sunshine. Developers can go grab a coffee and move on to more meaningful and rewarding tasks, like checking out on SO questions. Chrome doesn't want to execute the JNLP, but who cares? Customers won't get RSI from clicking a file every other week. On God-forsaken IE8 On the first visit, the dialog opens and requests confirmation for the user to continue to webapp2, though it could be unsafe (here be dragons, I tell you). The JNLP downloads and auto-opens, the app start. Your breathing is steady and slow. You close the app, close that SSL confirmation dialog, and re-click the menu entry. The dialog opens and auto-closes. Nothing starts, the file wasn't downloaded to any known location and Fiddler just reports the connection was closed. If you close IE and reach that menu item to click it again, it is now back to working correctly. Until you try again during the same session, of course. Your heart-rate goes up, you get some more coffee to make matters worse, and start looking for plain tickets online and a cheap but heavy golf-club on an online auction site to go clubbing baby polar seals to avenge your bloodthirst, as the gates to the IE team in Redmond are probably more secured than an ice block, as one would assume they get death threats often. Plus, the IE9 and IE10 teams are already hard at work fxing the crap left by their predecessors, so maybe you don't want to be too hard on them, and you don't have money to waste on a PI to track down the former devs responsible for this mess. Added Details I have come across many problems with IE8 not downloading files over SSL when it uses a no-cache header. This was indeed one of our problems, which seems to be worked out now. It downloads files fine, webapp2 uses the following headers to serve the JNLP file: response.setHeader("Cache-Control", "private, must-revalidate"); // IE8 happy response.setHeader("Pragma", "private"); // IE8 happy response.setHeader("Expires", "0"); // IE8 happy response.setHeader("Access-Control-Allow-Origin", "*"); // allow to request via cross-origin AJAX response.setContentType("application/x-java-jnlp-file"); // please exec me As you might have inferred, we get some confirmation dialog because there's something odd with the SSL certificate. Unfortunately I have no control over that. Assuming that's only temporary and for development purposes as we usually don't get our hands on the production certs. So the SSL cert is expired and doesn't specify the server. And the confirmation dialog. Wouldn't be that bad if it weren't for IE, as other browsers don't care, just ask for confirmation, and execute as expected and consistantly. Please, pretty please, help me, or I might consider sacrificial killings as an option. And I think I just found a decently prized stainless steel golf-club, so I'm right on the edge of gore. Side Notes Might actually be related to IE8 window.open SSL Certificate issue. Though it doesn't explain why the dialog would auto-close (that really is beyong me...), it could help to not have the confirmation dialog and not need the dialog at all. For instance, I was thinking that just having a simple URL in that menu instead of have it entirely managed by GWT code to invoke a Window.open would solve the problem. But I don't have control on that menu, and also I'm very curious how this could be fixed otherwise and why the hell it happens in the first place...

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • deadlock when using WCF Duplex Polling with Silverlight

    - by Kobi Hari
    Hi all. I have followed Tomek Janczuk's demonstration on silverlight tv to create a chat program that uses WCF Duplex Polling web service. The client subscribes to the server, and then the server initiates notifications to all connected clients to publish events. The Idea is simple, on the client, there is a button that allows the client to connect. A text box where the client can write a message and publish it, and a bigger text box that presents all the notifications received from the server. I connected 3 clients (in different browsers - IE, Firefox and Chrome) and it all works nicely. They send messages and receive them smoothly. The problem starts when I close one of the browsers. As soon as one client is out, the other clients get stuck. They stop getting notifications. I am guessing that the loop in the server that goes through all the clients and sends them the notifications is stuck on the client that is now missing. I tried catching the exception and removing it from the clients list (see code) but it still does not help. any ideas? The server code is as follows: using System; using System.Linq; using System.Runtime.Serialization; using System.ServiceModel; using System.ServiceModel.Activation; using System.Collections.Generic; using System.Runtime.Remoting.Channels; namespace ChatDemo.Web { [ServiceContract] public interface IChatNotification { // this will be used as a callback method, therefore it must be one way [OperationContract(IsOneWay=true)] void Notify(string message); [OperationContract(IsOneWay = true)] void Subscribed(); } // define this as a callback contract - to allow push [ServiceContract(Namespace="", CallbackContract=typeof(IChatNotification))] [AspNetCompatibilityRequirements(RequirementsMode = AspNetCompatibilityRequirementsMode.Allowed)] [ServiceBehavior(InstanceContextMode=InstanceContextMode.Single)] public class ChatService { SynchronizedCollection<IChatNotification> clients = new SynchronizedCollection<IChatNotification>(); [OperationContract(IsOneWay=true)] public void Subscribe() { IChatNotification cli = OperationContext.Current.GetCallbackChannel<IChatNotification>(); this.clients.Add(cli); // inform the client it is now subscribed cli.Subscribed(); Publish("New Client Connected: " + cli.GetHashCode()); } [OperationContract(IsOneWay = true)] public void Publish(string message) { SynchronizedCollection<IChatNotification> toRemove = new SynchronizedCollection<IChatNotification>(); foreach (IChatNotification channel in this.clients) { try { channel.Notify(message); } catch { toRemove.Add(channel); } } // now remove all the dead channels foreach (IChatNotification chnl in toRemove) { this.clients.Remove(chnl); } } } } The client code is as follows: void client_NotifyReceived(object sender, ChatServiceProxy.NotifyReceivedEventArgs e) { this.Messages.Text += string.Format("{0}\n\n", e.Error != null ? e.Error.ToString() : e.message); } private void MyMessage_KeyDown(object sender, KeyEventArgs e) { if (e.Key == Key.Enter) { this.client.PublishAsync(this.MyMessage.Text); this.MyMessage.Text = ""; } } private void Button_Click(object sender, RoutedEventArgs e) { this.client = new ChatServiceProxy.ChatServiceClient(new PollingDuplexHttpBinding { DuplexMode = PollingDuplexMode.MultipleMessagesPerPoll }, new EndpointAddress("../ChatService.svc")); // listen for server events this.client.NotifyReceived += new EventHandler<ChatServiceProxy.NotifyReceivedEventArgs>(client_NotifyReceived); this.client.SubscribedReceived += new EventHandler<System.ComponentModel.AsyncCompletedEventArgs>(client_SubscribedReceived); // subscribe for the server events this.client.SubscribeAsync(); } void client_SubscribedReceived(object sender, System.ComponentModel.AsyncCompletedEventArgs e) { try { Messages.Text += "Connected!\n\n"; gsConnect.Color = Colors.Green; } catch { Messages.Text += "Failed to Connect!\n\n"; } } And the web config is as follows: <system.serviceModel> <extensions> <bindingExtensions> <add name="pollingDuplex" type="System.ServiceModel.Configuration.PollingDuplexHttpBindingCollectionElement, System.ServiceModel.PollingDuplex, Version=4.0.0.0, Culture=neutral, PublicKeyToken=31bf3856ad364e35"/> </bindingExtensions> </extensions> <behaviors> <serviceBehaviors> <behavior name=""> <serviceMetadata httpGetEnabled="true"/> <serviceDebug includeExceptionDetailInFaults="false"/> </behavior> </serviceBehaviors> </behaviors> <bindings> <pollingDuplex> <binding name="myPollingDuplex" duplexMode="MultipleMessagesPerPoll"/> </pollingDuplex> </bindings> <serviceHostingEnvironment aspNetCompatibilityEnabled="true" multipleSiteBindingsEnabled="true"/> <services> <service name="ChatDemo.Web.ChatService"> <endpoint address="" binding="pollingDuplex" bindingConfiguration="myPollingDuplex" contract="ChatDemo.Web.ChatService"/> <endpoint address="mex" binding="mexHttpBinding" contract="IMetadataExchange"/> </service> </services> </system.serviceModel>

    Read the article

  • How to make my robot move in a rectangular path along the black tape?

    - by Sahat
    I am working on a robot, it's part of the summer robotics workshop in our college. We are using C-STAMP micro controllers by A-WIT. I was able to make it move, turn left, turn right, move backward. I have even managed to make it go along the black tape using a contrast sensor. I send the robot at 30-45 degrees toward the black tape on the table and it aligns itself and starts to move along the black tape. It jerks a little, probably due to my programming logic below, it's running a while loop and constantly checking if statements, so it ends up trying to turn left and right every few milliseconds, which explains the jerking part. But it's okay, it works, not as smooth as I want it to work but it works! Problem is that I can't make my robot go into a rectangular path of the black tape. As soon as it reaches the corner it just keeps going straight instead of making a left/right turn. Here's my attempt. The following code is just part of the code. My 2 sensors are located right underneath the robot, next to the front wheel, almost at the floor level. It has "index" value ranging from 0 to 8. I believe it's 8 when you have a lot of light coming into the sensor , and 0 when it's nearly pitch black. So when the robot moves into the black-tape-zone, the index value drops, and based on that I have an if-statement telling my robot to either turn left or right. To avoid confusion I didn't post the entire source code, but only the logical part responsible for the movement of my robot along the black tape. while(1) { // don't worry about these. // 10 and 9 represent Sensor's PIN location on the motherboard V = ANALOGIN(10, 1, 0, 0, 0); V2 = ANALOGIN(9, 1, 0, 0, 0); // i got this "formula" from the example in my Manual. // V stands for voltage of the sensor. // it gives me the index value of the sensor. 0 = darkest, 8 = lightest. index = ((-(V - 5) / 5) * 8 + 0.5); index2 = ((-(V2 - 5) / 5) * 8 + 0.5); // i've tweaked the position of the sensors so index > 7 is just right number. // the robot will move anywhere on the table just fine with index > 7. // as soon as it drops to or below 7 (i.e. finds black tape), the robot will // either turn left or right and then go forward. // lp & rp represent left-wheel pin and right-wheel pin, 1 means run forever. // if i change it from 1 to 100, it will go forward for 100ms. if (index > 7 && index2 > 7) goForward(lp, rp, 1); if (index <= 7) { turnLeft(lp, rp, 1); goForward(lp, rp, 1); // this is the tricky part. i've added this code last minute // trying to make my robot turn, but i didn't work. if (index > 4) { turnLeft(lp, rp, 1); goForward(lp, rp, 1); } } else if (index2 <= 7) { turnRight(lp, rp, 1); goForward(lp, rp, 1); // this is also the last minute addition. it's same code as above // but it's for the 2nd sensor. if (index2 > 4) { turnRight(lp, rp, 1); goForward(lp, rp, 1); } } I've spent the entire day trying to figure it out. I've pretty much exhausted all avenues. Asking for the solution on stackoverflow is my very last option now. Thanks in advance! If you have any questions about the code, let me know, but comments should be self-explanatory.

    Read the article

  • For Loop help In a Hash Cracker Homework.

    - by aaron burns
    On the homework I am working on we are making a hash cracker. I am implementing it so as to have my cracker. java call worker.java. Worker.java implements Runnable. Worker is to take the start and end of a list of char, the hash it is to crack, and the max length of the password that made the hash. I know I want to do a loop in run() BUT I cannot think of how I would do it so it would go to the given max pasword length. I have posted the code I have so far. Any directions or areas I should look into.... I thought there was a way to do this with a certain way to write the loop but I don't know or can't find the correct syntax. Oh.. also. In main I divide up so x amount of threads can be chosen and I know that as of write now it only works for an even number of the 40 possible char given. package HashCracker; import java.util.*; import java.security.MessageDigest; import java.security.NoSuchAlgorithmException; public class Cracker { // Array of chars used to produce strings public static final char[] CHARS = "abcdefghijklmnopqrstuvwxyz0123456789.,-!".toCharArray(); public static final int numOfChar=40; /* Given a byte[] array, produces a hex String, such as "234a6f". with 2 chars for each byte in the array. (provided code) */ public static String hexToString(byte[] bytes) { StringBuffer buff = new StringBuffer(); for (int i=0; i<bytes.length; i++) { int val = bytes[i]; val = val & 0xff; // remove higher bits, sign if (val<16) buff.append('0'); // leading 0 buff.append(Integer.toString(val, 16)); } return buff.toString(); } /* Given a string of hex byte values such as "24a26f", creates a byte[] array of those values, one byte value -128..127 for each 2 chars. (provided code) */ public static byte[] hexToArray(String hex) { byte[] result = new byte[hex.length()/2]; for (int i=0; i<hex.length(); i+=2) { result[i/2] = (byte) Integer.parseInt(hex.substring(i, i+2), 16); } return result; } public static void main(String args[]) throws NoSuchAlgorithmException { if(args.length==1)//Hash Maker { //create a byte array , meassage digestand put password into it //and get out a hash value printed to the screen using provided methods. byte[] myByteArray=args[0].getBytes(); MessageDigest hasher=MessageDigest.getInstance("SHA-1"); hasher.update(myByteArray); byte[] digestedByte=hasher.digest(); String hashValue=Cracker.hexToString(digestedByte); System.out.println(hashValue); } else//Hash Cracker { ArrayList<Thread> myRunnables=new ArrayList<Thread>(); int numOfThreads = Integer.parseInt(args[2]); int charPerThread=Cracker.numOfChar/numOfThreads; int start=0; int end=charPerThread-1; for(int i=0; i<numOfThreads; i++) { //creates, stores and starts threads. Runnable tempWorker=new Worker(start, end, args[1], Integer.parseInt(args[1])); Thread temp=new Thread(tempWorker); myRunnables.add(temp); temp.start(); start=end+1; end=end+charPerThread; } } } import java.util.*; public class Worker implements Runnable{ private int charStart; private int charEnd; private String Hash2Crack; private int maxLength; public Worker(int start, int end, String hashValue, int maxPWlength) { charStart=start; charEnd=end; Hash2Crack=hashValue; maxLength=maxPWlength; } public void run() { byte[] myHash2Crack_=Cracker.hexToArray(Hash2Crack); for(int i=charStart; i<charEnd+1; i++) { Cracker.numOfChar[i]////// this is where I am stuck. } } }

    Read the article

  • Unable to output XML data in a manageable way

    - by Rob
    I've been given data from a previous version of a website (it was a custom CMS) and am looking to get it into a state that I can import it into my Wordpress site. This is what I'm working on - http://www.teamworksdesign.com/clients/ciw/datatest/index.php. If you scroll down to row 187 the data starts to fail (there should be a red message) with the following error message: Fatal error: Uncaught exception 'Exception' with message 'String could not be parsed as XML' in /home/teamwork/public_html/clients/ciw/datatest/index.php:132 Stack trace: #0 /home/teamwork/public_html/clients/ciw/datatest/index.php(132): SimpleXMLElement-__construct(' Can anyone see what the problem is and how to fix it? This is how I'm outputting the date: <!DOCTYPE html> <html> <head> <meta http-equiv="Content-Type" content="text/html; charset=UTF-8" /> </head> <body> <?php ini_set('memory_limit','1024M'); ini_set('max_execution_time', 500); //300 seconds = 5 minutes echo "<br />memory_limit: " . ini_get('memory_limit') . "<br /><br />"; echo "<br />max_execution_time: " . ini_get('max_execution_time') . "<br /><br />"; libxml_use_internal_errors(true); $z = new XMLReader; $z->open('dbo_Content.xml'); $doc = new DOMDocument; $doc->preserveWhiteSpace = false; // move to the first <product /> node while ($z->read() && $z->name !== 'dbo_Content'); $c = 0; // now that we're at the right depth, hop to the next <product/> until the end of the tree while ($z->name === 'dbo_Content') { if($c < 201) { // either one should work $node = simplexml_import_dom($doc->importNode($z->expand(), true)); if($node->ClassId == 'policydocument') { $c++; echo "<h1>Row: $c</h1>"; echo "<pre>"; echo htmlentities($node->XML) . "<br /><br /><br /><b>*******</b><br /><br /><br />"; echo "</pre>"; try{ $xmlObject = new SimpleXMLElement($node->XML); foreach ($xmlObject->fields[0]->field as $field) { switch((string) $field['name']) { case 'parentId': echo "<b>PARENT ID: </b> " . $field->value . "<br />"; break; case 'title': echo "<b>TITLE: </b> " . $field->value . "<br />"; break; case 'summary': echo "<b>SUMMARY: </b> " . $field->value . "<br />"; break; case 'body': echo "<b>BODY:</b> " . $field->value . "<br />"; break; case 'published': echo "<b>PUBLISHED:</b> " . $field->value . "<br />"; break; } } echo '<br /><h2 style="color:green;">Success on node: '.$node->ContentId.'</h2><hr /><br />'; } catch (Exception $e){ echo '<h2 style="color:red;">Failed on node: '.$node->ContentId.'</h2>'; } } // go to next <product /> $z->next('dbo_Content'); } } ?> </body> </html>

    Read the article

< Previous Page | 216 217 218 219 220 221 222 223 224 225  | Next Page >