Search Results

Search found 16174 results on 647 pages for 'disk space'.

Page 221/647 | < Previous Page | 217 218 219 220 221 222 223 224 225 226 227 228  | Next Page >

  • Map the physical file path in asp.net mvc

    - by rmassart
    Hi, I am trying to read an XSLT file from disk in my ASP.Net MVC controller. What I am doing is the following: string filepath = HttpContext.Request.PhysicalApplicationPath; filepath += "/Content/Xsl/pubmed.xslt"; string xsl = System.IO.File.ReadAllText(filepath); However, half way down this thread on forums.asp.net there is the following quote HttpContext.Current is evil and if you use it anywhere in your mvc app you are doing something wrong because you do not need it. Whilst I am not using "Current", I am wondering what is the best way to determine the absolute physical path of a file in MVC? For some reason (I don't know why!) HttpContext doesn't feel right for me. Is there a better (or recommended/best practice) way of reading files from disk in ASP.Net MVC? Thanks for your help, Robin

    Read the article

  • Way to get VS 2008 to stop forcing indentation on namespaces?

    - by Earlz
    I've never really been a big fan of the way most editors handle namespaces. They always force you to add an extra pointless level of indentation. For instance, I have a lot of code in a page that I would much rather prefer formatted as namespace mycode{ class myclass{ void function(){ foo(); } void foo(){ bar(); } void bar(){ //code.. } } } and not something like namespace mycode{ class myclass{ void function(){ foo(); } void foo(){ bar(); } void bar(){ //code.. } } } Honestly, I don't really even like the class thing being indented most of the time because I usually only have 1 class per file. And it doesn't look as bad here, but when you get a ton of code and lot of scopes, you can easily have indentation that forces you off the screen, and plus here I just used 2-space tabs and not 4-space as is used by us. Anyway, is there some way to get Visual Studio to stop trying to indent namespaces for me like that?

    Read the article

  • cannot access new drive through nfs

    - by l.thee.a
    I am running nfs-kernel-server to access my files on my linux machine(ubuntu - /share). The disk I have been using is full. So I have added a new disk and mounted it to /share/data. My other pc mounts the /share folder to /mnt/nfs; but cannot see the contents of /mnt/nfs/data. I have tried adding /share/data to /etc/exports, but it did not help. What do I do?

    Read the article

  • jquery ui modal dialog problems in IE

    - by JohnM2
    I use jquery ui dialog widget. Everything works fine in FF, Opera etc., except IE. The problem is that when dialog is opened in Internet Explorer, some space (not covered with that "modal gray layer") is added at the bottom of the document, and page is scrolled to the bottom. So I don't even see the dialog, I have to scroll up, to see it fully. Anyone had that problems? Any solutions? EDIT: now I see, that this "bottom space" is also added in FireFox, but it doesn't scroll to it like in IE.

    Read the article

  • OpenCV to use in memory buffers or file pointers

    - by The Unknown
    The two functions in openCV cvLoadImage and cvSaveImage accept file path's as arguments. For example, when saving a image it's cvSaveImage("/tmp/output.jpg", dstIpl) and it writes on the disk. Is there any way to feed this a buffer already in memory? So instead of a disk write, the output image will be in memory. I would also like to know this for both cvSaveImage and cvLoadImage (read and write to memory buffers). Thanks! My goal is to store the Encoded (jpeg) version of the file in Memory. Same goes to cvLoadImage, I want to load a jpeg that's in memory in to the IplImage format.

    Read the article

  • How to scale MongoDB

    - by terence410
    I know that MongoDB can scale vertically. What about if I running out of disk? I am currently using EC2 with EBS. As you know, I have to assign EBS for a fixed size. What if the mongodb growth bigger than the EBS size? Do I have to create a larger EBS and Copy & Paste the files? Or shall we start more MongoDB instance and each connect to different EBS disk? In such case, I could connect to a different instance for different databases.

    Read the article

  • What Regex can strip e.g. "note:" and "firstName: " from the left of a string?

    - by Edward Tanguay
    I need to strip the "label" off the front of strings, e.g. note: this is a note needs to return: note and this is a note I've produced the following code example but am having trouble with the regexes. What code do I need in the two ???????? areas below so that I get the desired results shown in the comments? using System; using System.Collections.Generic; using System.Linq; using System.Text; using System.Text.RegularExpressions; namespace TestRegex8822 { class Program { static void Main(string[] args) { List<string> lines = new List<string>(); lines.Add("note: this is a note"); lines.Add("test: just a test"); lines.Add("test:\t\t\tjust a test"); lines.Add("firstName: Jim"); //"firstName" IS a label because it does NOT contain a space lines.Add("She said this to him: follow me."); //this is NOT a label since there is a space before the colon lines.Add("description: this is the first description"); lines.Add("description:this is the second description"); //no space after colon lines.Add("this is a line with no label"); foreach (var line in lines) { Console.WriteLine(StringHelpers.GetLabelFromLine(line)); Console.WriteLine(StringHelpers.StripLabelFromLine(line)); Console.WriteLine("--"); //note //this is a note //-- //test //just a test //-- //test //just a test //-- //firstName //Jim //-- // //She said this to him: follow me. //-- //description //this is the first description //-- //description //this is the first description //-- // //this is a line with no label //-- } Console.ReadLine(); } } public static class StringHelpers { public static string GetLabelFromLine(this string line) { string label = line.GetMatch(@"^?:(\s)"); //??????????????? if (!label.IsNullOrEmpty()) return label; else return ""; } public static string StripLabelFromLine(this string line) { return ...//??????????????? } public static bool IsNullOrEmpty(this string line) { return String.IsNullOrEmpty(line); } } public static class RegexHelpers { public static string GetMatch(this string text, string regex) { Match match = Regex.Match(text, regex); if (match.Success) { string theMatch = match.Groups[0].Value; return theMatch; } else { return null; } } } }

    Read the article

  • Java object caching, which is faster, reading from a file or from a remote machine?

    - by Kumar225
    I am at a point where I need to take the decision on what to do when caching of objects reaches the configured threshold. Should I store the objects in a indexed file (like provided by JCS) and read them from the file (file IO) when required or have the object stored in a distributed cache (network, serialization, deserialization) We are using Solaris as OS. ============================ Adding some more information. I have this question so as to determine if I can switch to distributed caching. The remote server which will have cache will have more memory and better disk and this remote server will only be used for caching. One of the problems we cannot increase the locally cached objects is , it stores the cached objects in JVM heap which has limited memory(using 32bit JVM). ======================================================================== Thanks, we finally ended up choosing Coherence as our Cache product. This provides many cache configuration topologies, in process vs remote vs disk ..etc.

    Read the article

  • NTFS-compressing Virtual PC disks (on host and/or guest)

    - by nlawalker
    I'm hoping someone here can answer these definitively: Does putting a VHD file in an NTFS-compressed folder on the host improve performance of the virtual machine, diminish performance, or neither? What about using NTFS compression within the guest? Does using compresssion on either the host or the guest lead to any problems like read or write errors? If I were to put a VHD in a compressed folder on the host, would I benefit from compacting it? I've seen references to using NTFS compression on quite a few VPC "tips and tricks" blog posts, and it seems like half of them say to never do it and the other half say that not only does it save disk space but it actually can improve performance if you have a fast CPU and your primary performance bottleneck is the disk.

    Read the article

  • How do I merge a local branch into TFS

    - by Johnny
    hi, I did a stupid thing and branched my project on my local disk instead of doing it on the TFS. So now I have two projects on my disk: the old one which has TFS bindings and the new, which doesn't. I want to merge those changes back into the TFS project. How would I go about doing that? I can't do Compare because my local branch has no TFS bindings. There should be some way to compare the differences between the two projects locally and then meld the differences into the old project and check-in, but I can't find an easy way of doing that. Any other solutions?

    Read the article

  • use hg to synchronize my project between my two computer

    - by hguser
    Hi: I have two computer : the desktop in my company and the portable computer in my home. Now I want to use the hg to synchronize the project between them using a "USB removable disk". So I wonder how to implement it? THe pro in my desktop is : D:\work\mypro. I use the following command to init it: hg init Then I connect to the USB disk whose volume label is "H",and get a clone using: cd H: hg init hg clone D:\work\mypro mypro-usb ANd in my portable computer I use: cd D: hg clone H:\mypro-usb mypro-home However I do not know how to do if I modify some files(remove or add and modify) in the mypro-home,how to make the mypro-usb changed synchronizely,also I want the mypro in my desktop synchronizely. How to do it?

    Read the article

  • Autocomplete server-side implementation

    - by toluju
    What is a fast and efficient way to implement the server-side component for an autocomplete feature in an html input box? I am writing a service to autocomplete user queries in our web interface's main search box, and the completions are displayed in an ajax-powered dropdown. The data we are running queries against is simply a large table of concepts our system knows about, which matches roughly with the set of wikipedia page titles. For this service obviously speed is of utmost importance, as responsiveness of the web page is important to the user experience. The current implementation simply loads all concepts into memory in a sorted set, and performs a simple log(n) lookup on a user keystroke. The tailset is then used to provide additional matches beyond the closest match. The problem with this solution is that it does not scale. It currently is running up against the VM heap space limit (I've set -Xmx2g, which is about the most we can push on our 32 bit machines), and this prevents us from expanding our concept table or adding more functionality. Switching to 64-bit VMs on machines with more memory isn't an immediate option. I've been hesitant to start working on a disk-based solution as I am concerned that disk seek time will kill performance. Are there possible solutions that will let me scale better, either entirely in memory or with some fast disk-backed implementations? Edits: @Gandalf: For our use case it is important the the autocompletion is comprehensive and isn't just extra help for the user. As for what we are completing, it is a list of concept-type pairs. For example, possible entries are [("Microsoft", "Software Company"), ("Jeff Atwood", "Programmer"), ("StackOverflow.com", "Website")]. We are using Lucene for the full search once a user selects an item from the autocomplete list, but I am not yet sure Lucene would work well for the autocomplete itself. @Glen: No databases are being used here. When I'm talking about a table I just mean the structured representation of my data. @Jason Day: My original implementation to this problem was to use a Trie, but the memory bloat with that was actually worse than the sorted set due to needing a large number of object references. I'll read on the ternary search trees to see if it could be of use.

    Read the article

  • SQL: ATER COLUMN to shorter CHAR(n) type

    - by Rising Star
    I'm working with MS SQL SERVER 2003. I want to change a column in one of my tables to have fewer characters in the entries. This is identical to this question: http://stackoverflow.com/questions/2281336/altering-a-table-column-to-accept-more-characters except for the fact that I want fewer characters instead of more. I have a column in one of my tables that holds nine-digit entries. A developer previously working on the table mistakenly set the column to hold ten-digit entries. I need to change the type from CHAR(10) to CHAR(9). Following the instructions from the discussion linked above, I wrote the statement ALTER TABLE [MY_TABLE] ALTER COLUMN [MY_COLUMN] CHAR(9); This returns the error message "String or binary data would be truncated". I see that my nine-digit strings have a space appended to make them ten digits. How do I tell SQL Server to discard the extra space and convert my column to a CHAR(9) type?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Red Hat cluster: Failure of one of two services sharing the same virtual IP tears down IP

    - by js.
    I'm creating a 2+1 failover cluster under Red Hat 5.5 with 4 services of which 2 have to run on the same node, sharing the same virtual IP address. One of the services on each node needs a (SAN) disk, the other doesn't. I'm using HA-LVM. When I shut down (via ifdown) the two interfaces connected to the SAN to simulate SAN failure, the service needing the disk is disabled, the other keeps running, as expected. Surprisingly (and unfortunately), the virtual IP address shared by the two services on the same machine is also removed, rendering the still-running service useless. How can I configure the cluster to keep the IP address up?

    Read the article

  • HTML list wrapping problem

    - by Daniel
    I have a HTML list with this style: font-weight: bold; padding: 0px; margin: 0px; list-style-type: none; display: block; width:700px; font-size: 14px; white-space: pre-wrap; and the cells have this style: display: inline; and I have spacer cells between each cell with this style: padding-right: 20px; display: inline; My problem is that when the list is too long for its 700 pixels, it wraps. I want this, but I dont want the objects to be on two separate lines. I have tried the CSS white-space property, but nothing seems to work. Any ideas?

    Read the article

  • How to serve a View as CSV in ASP.NET Web Forms

    - by ChessWhiz
    Hi, I have a MS SQL view that I want to make available as a CSV download in my ASPNET Web Forms app. I am using Entity Framework for other views and tables in the project. What's the best way to enable this download? I could add a HyperLink whose click handler iterates over the view, writes its CSV form to the disk, and then serves that file. However, I'd prefer not to write to the disk if it can be avoided, and that involves iteration code that may be avoided with some other solution. Any ideas?

    Read the article

  • how Can we get the output format to CSV instead of HTML in Alfresco using webscripts?

    - by pavan123
    how Can we change the output format to CSV instead of HTML in Alfresco using webscripts? below are the my corresponding FTL and Webscript files recursive.get.html.ftl <#macro recurse_macro node depth> <#if node.isContainer> <tr> <td> ${node.properties.name} </td> <td></td> </tr> <#list node.children as child> <#if child.isContainer> <@recurse_macro node=child depth=depth+1/> <#list child.children as child2> <#if child2.isDocument> <tr><td></td><td>${child2.properties.name}</td></tr> </#if> </#list> </#if> </#list> </#if> </#macro> Recursive Listing of Spaces & Documents: Space Document recursive.get.desc.xml <webscript> <shortname>recurcive</shortname> <description>Recursive</description> <url>/sample/recursive/{recursive}</url> <format default="html">extension</format> <authentication>guest</authentication> </webscript> and html output is Recursive Listing of Spaces & Documents: Space Document Company Home Data Dictionary Space Templates Software Engineering Project Documentation Drafts Pending Approval Published Samples system-overview.html Discussions UI Design Presentations Quality Assurance Presentation Templates doc_info.ftl localizable.ftl my_docs.ftl my_spaces.ftl my_summary.ftl translatable.ftl recent_docs.ftl general_example.ftl my_docs_inline.ftl show_audit.ftl readme.ftl Email Templates notify_user_email.ftl invite_user_email.ftl RSS Templates RSS_2.0_recent_docs.ftl Saved Searches admin Scripts backup.js example test script.js backup and log.js append copyright.js alfresco docs.js test return value.js Web Scripts org alfresco sample blogsearch.get.js blogsearch.get.atom.ftl blogsearch.get.desc.xml blogsearch.get.html.ftl blogsearch.get.html.400.ftl blogsearch.get.atom.400.ftl categorysearch.get.js categorysearch.get.atom.ftl categorysearch.get.desc.xml categorysearch.get.html.ftl categorysearch.get.html.404.ftl categorysearch.get.atom.404.ftl folder.get.js folder.get.atom.ftl folder.get.desc.xml folder.get.html.ftl avmstores.get.desc.xml avmstores.get.html.ftl avmbrowse.get.js avmbrowse.get.desc.xml avmbrowse.get.html.ftl recursive.get.desc.xml recursive.get.html.ftl sgs.get.desc.xml sgs.get.csv.ftl sample1.get.desc.xml sample1.get.csv.ftl first.get.desc.xml first.get.text.ftl rag.get.html.ftl rag.get.desc.xml new1.get.desc.xml new1.get.html.ftl excel.get.html.ftl excel.get.desc.xml sgs1.get.desc.xml one.get.html.ftl one.get.desc.xml one.get.js readme.html Web Scripts Extensions readme.html Guest Home Alfresco-Tutorial.pdf User Homes isabel Users Home

    Read the article

  • Error in Print Function in Bubble Sort MIPS?

    - by m00nbeam360
    Sorry that this is such a long block of code, but do you see any obvious syntax errors in this? I feel like the problem is that the code isn't printing correctly since the sort and swap methods were from my textbook. Please help if you can! .data save: .word 1,2,4,2,5,6 size: .word 6 .text swap: sll $t1, $a1, 2 #shift bits by 2 add $t1, $a1, $t1 #set $t1 address to v[k] lw $t0, 0($t1) #load v[k] into t1 lw $t2, 4($t1) #load v[k+1] into t1 sw $t2, 0($t1) #swap addresses sw $t0, 4($t1) #swap addresses jr $ra #return sort: addi $sp, $sp, -20 #make enough room on the stack for five registers sw $ra, 16($sp) #save the return address on the stack sw $s3, 12($sp) #save $s3 on the stack sw $s2, 8($sp) #save Ss2 on the stack sw $s1, 4($sp) #save $s1 on the stack sw $s0, 0($sp) #save $s0 on the stack move $s2, $a0 #copy the parameter $a0 into $s2 (save $a0) move $s3, $a1 #copy the parameter $a1 into $s3 (save $a1) move $s0, $zero #start of for loop, i = 0 for1tst: slt $t0, $s0, $s3 #$t0 = 0 if $s0 S $s3 (i S n) beq $t0, $zero, exit1 #go to exit1 if $s0 S $s3 (i S n) addi $s1, $s0, -1 #j - i - 1 for2tst: slti $t0, $s1, 0 #$t0 = 1 if $s1 < 0 (j < 0) bne $t0, $zero, exit2 #$t0 = 1 if $s1 < 0 (j < 0) sll $t1, $s1, 2 #$t1 = j * 4 (shift by 2 bits) add $t2, $s2, $t1 #$t2 = v + (j*4) lw $t3, 0($t2) #$t3 = v[j] lw $t4, 4($t2) #$t4 = v[j+1] slt $t0, $t4, $t3 #$t0 = 0 if $t4 S $t3 beq $t0, $zero, exit2 #go to exit2 if $t4 S $t3 move $a0, $s2 #1st parameter of swap is v(old $a0) move $a1, $s1 #2nd parameter of swap is j jal swap #swap addi $s1, $s1, -1 j for2tst #jump to test of inner loop j print exit2: addi $s0, $s0, 1 #i = i + 1 j for1tst #jump to test of outer loop exit1: lw $s0, 0($sp) #restore $s0 from stack lw $s1, 4($sp) #resture $s1 from stack lw $s2, 8($sp) #restore $s2 from stack lw $s3, 12($sp) #restore $s3 from stack lw $ra, 16($sp) #restore $ra from stack addi $sp, $sp, 20 #restore stack pointer jr $ra #return to calling routine .data space:.asciiz " " # space to insert between numbers head: .asciiz "The sorted numbers are:\n" .text print:add $t0, $zero, $a0 # starting address of array add $t1, $zero, $a1 # initialize loop counter to array size la $a0, head # load address of print heading li $v0, 4 # specify Print String service syscall # print heading out: lw $a0, 0($t0) # load fibonacci number for syscall li $v0, 1 # specify Print Integer service syscall # print fibonacci number la $a0, space # load address of spacer for syscall li $v0, 4 # specify Print String service syscall # output string addi $t0, $t0, 4 # increment address addi $t1, $t1, -1 # decrement loop counter bgtz $t1, out # repeat if not finished jr $ra # return

    Read the article

  • Internet Explorer changes brightness

    - by Sale
    I have a very annoying problem with IE8 on Vista: My screen brightness changes when I view a page with IE. It slowly dimms brightness some 20% - enough to be noticeable. This seems to be dependent on the OVERALL brightness of the page viewed or of the amount of bright space on the page... sometimes it dimms down if the page is bright, sometimes the complete different, it dimms when lot of dark space is on the page. I know this sounds weird, I cannot describe it better. It takes about one,two seconds from on brightness level to the other. This ONLY occurs in IE - not in Word or any other application. Please help! This dimming is very stressfull for my eyes.

    Read the article

  • Shrink database after removing extra data

    - by Sergey Osypchuk
    We have a need to fit database in 4G in order to use ms sql express edition. I started from 7G database, and found a lot of not needed records, and deleted them. After Shrink database size is 4.6G, and 748MB is free (according to database properties). However, when i execute exec sp_spaceused i am having interesting results: DatabaseName Database_size unallocation space xxxxxx 4726.50 MB 765.42 MB Reserved Data index_size unused 3899472 KB 1608776 KB 1448400 KB 842296 KB Any ideas, how can i bite at least some of this unused space? Also I know table, which occupied it. update: is it worth to try to rebuild table indexes? ALTER INDEX ALL ON Production.Product REBUILD

    Read the article

  • File sizing issue in DOS/FAT

    - by Heather
    I've been tasked with writing a data collection program for a Unitech HT630, which runs a proprietary DOS operating system that can run executables compiled for 16-bit MS DOS with some restrictions. I'm using the Digital Mars C/C++ compiler, which is working well thus far. One of the application requirements is that the data file must be human-readable plain text, meaning the file can be imported into Excel or opened by Notepad. I'm using a variable length record format much like CSV that I've successfully implemented using the C standard library file I/O functions. When saving a record, I have to calculate whether the updated record is larger or smaller than the version of the record currently in the data file. If larger, I first shift all records immediately after the current record forward by the size difference calculated before saving the updated record. EOF is extended automatically by the OS to accommodate the extra data. If smaller, I shift all records backwards by my calculated offset. This is working well, however I have found no way to modify the EOF marker or file size to ignore the data after the end of the last record. Most of the time records will grow in size because the data collection program will be filling some of the empty fields with data when saving a record. Records will only shrink in size when a correction is made on an existing entry, or on a normal record save if the descriptive data in the record is longer than what the program reads in memory. In the situation of a shrinking record, after the last record in the file I'm left with whatever data was sitting there before the shift. I have been writing an EOF delimiter into the file after a "shrinking record save" to signal where the end of my records are and space-filling the remaining data, but then I no longer have a clean file until a "growing record save" extends the size of the file over the space-filled area. The truncate() function in unistd.h does not work (I'm now thinking this is for *nix flavors only?). One proposed solution I've seen involves creating a second file and writing all the data you wish to save into that file, and then deleting the original. Since I only have 4MB worth of disk space to use, this works if the file size is less than 2MB minus the size of my program executable and configuration files, but would fail otherwise. It is very likely that when this goes into production, users would end up with a file exceeding 2MB in size. I've looked at Ralph Brown's Interrupt List and the interrupt reference in IBM PC Assembly Language and Programming and I can't seem to find anything to update the file size or similar. Is reducing a file's size without creating a second file even possible in DOS?

    Read the article

  • Invoices for Printing in MS-Access

    - by Nitrodist
    The application that I'm currently working on has a funky set up for the invoices that they print. The form is the invoice that is printed out. I took a look at the Northwind DB and what it does is and it actually generates a report based on the record's information. What are the limitations of using Forms vs. Reports for printing out reports? One of the limitations that I've run into so far is that the printed page is jam packed with information (all required) to fit on a single page, yet there is lots of wasted space for some stuff since elements on the page don't shrink or grow due to what's inputted into the textboxes. How are invoices designed for your applications? How do you handle space restraints for creating invoices?

    Read the article

  • how does fgets internally works?

    - by Registered User
    Well it is a basic question but I seem confused enough. #include<stdio.h> int main() { char a[100]; printf("Enter a string\n"); scanf("%s",a); } Basically the above is what I want to achieve. If I enter a string James Bond then I want that to be stored in array a. But the problem is because of presence of a blank space in between only James word is stored. So how can I solve this one. UPDATE After the replies given below I understand fgets() would be a better choice. I want to know internal working of fgets as why is it able to store the string with space where as scanf is not able to do the same.

    Read the article

  • Placing an background image with padding in h2 tag

    - by Cedar Jensen
    I want to create a headline (h2) with an image at the right-most area of the bounding box. I have the layout almost right except I can't push the image a little bit to the right of the element's bounding box -- how would I tweak my css so it is displayed correctly? I'm trying to do something like this: [{someHeadLineText}{dynamic space }{image}{5px space}] where the [] indicate the total available width of my content. Html: <div class="primaryHeader"> <h2>News</h2> </div> Css: .primaryHeader h2 { background-color: green; /* the header looks like a box */ color: black; background: transparent url(../images/edit.png) no-repeat right center; border: 1px solid red; } I am placing the image to the right of my h2 element and centered vertically -- but how do I adjust the placement of the background image?

    Read the article

< Previous Page | 217 218 219 220 221 222 223 224 225 226 227 228  | Next Page >