Search Results

Search found 16151 results on 647 pages for 'blackberry os v5'.

Page 250/647 | < Previous Page | 246 247 248 249 250 251 252 253 254 255 256 257  | Next Page >

  • Can I delete the OEM partition on the new Dell XPS 15?

    - by timepilot
    My new Dell XPS 15 L521X just arrived. I need to set this up to dual boot Linux. Sadly, the system comes with four primary partitions. I can't do a clean install at the moment, so one of the partitions will have to be deleted before I can install Linux. The layout is as follows: OEM: 39mb Hibernation: 8gb OS: 457gb Recovery: 12gb Obviously, I can't delete the Hibernation and OS partitions (will shrink to make space for Linux) and I'd like to keep the recovery partition if possible. So my question is what is on the small OEM partition? What functionality will I lose if I delete it?

    Read the article

  • Procedure for dual booting (2 copies of Win-7) off 2 partitions on same disk

    - by Sam Holder
    What procedure should I follow to set a dual boot (both Win-7 x64) on a machine where (ideally): Both operating systems will be installed on the same physical disk in different partitions When booting into either operating system the contents of the other OS partition disk will not be seen (this just seems safer) Other hard drives in the system will be visible by both OS's 1 copy of Win7 is already installed. Is it as simple as shrinking the existing volume and creating the partition, then sticking the CD in and booting off it and formatting the new partition and then installing another copy of windows onto the new partition? Or will that not work? Or are there gotchas?

    Read the article

  • Can't access the Internet in VMware Workstation

    - by asunnysunday
    I'm using VMware 7.1.2 in Windows 7 with Ubuntu 11.04 as a guest OS. In the host OS (Windows 7), I can access the Internet without any problems but in the virtual machine I can't access the Internet. I've tried the following but with no success: Use all methods of connecting to the Internet in "Virtual Machine Settings": Bridged, NAT, Custom; none work. Used cabled and wireless connections on the PC - neither of them work. I've used Ubuntu in VMware for several months - previously the Internet was always accessible. Could the cause of this be because I upgraded to Ubuntu 11.04?

    Read the article

  • How to install windows on a server with no CD or DVD drive

    - by user29266
    I've found a few posts on this site, however my situation is different. I have a new Dell server with no OS installed. I would like to install Windows 2008 Web Edition. I have a few USB ports and Ethernet. No CD or DVD drives. Is this article the best & only way to proceed? Installing Windows 2008 via USB thumbdrive or should I just get a external hardrive and hook it up to a usb. Once the OS is installed I'll never need a DVD drive again - so that's idea is a waste of money.

    Read the article

  • Eclipse Juno Switch Editor in Order

    - by inspectorG4dget
    In case it matters: OS: Mac OS X Lion (10.7.4) Eclipse: Juno, Build id: 20120614-1722 I have several files open in my eclipse workspace as tabs. The default shortcuts for previous and next editors are ?F6 and ?shiftF6. I know how to change these shortcuts, that's not the issue. However, what I want to do, is switch between editors in the way in which they're ordered in the tab bar. Currently, the editors change in order of last used/viewed. So, if I had three files (A, B and C in order) open and I'm currently editing A and I edited B last, when I use the shortcut for "Previous Editor", it takes me to B instead of C (and vice versa). Is there any way for me to get this functionality out of eclipse (if so, how)? Thank you

    Read the article

  • Dual boot centOS and Win7

    - by user1855965
    I posted this on stackoverflow, but it looks like superuser would be more appropriate. I have a CentOS 5 machine that runs Windows 7 as a dual boot. CentOS is the main OS and each OS is set up in a specific hard drive. This was set up before I joined the company and I don't really have need to run Windows now. My question is: can I, from CentOS, reformat the Windows HD, change GRUB settings and get the HD to be available on CentOS? Happy to provide more info if this helps. Many thanks for your help and apologies if this is a very simple issue... I don't want to blindly test things on this machine as it is used on a daily basis by several users.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Starting VM as an executable with as low overhead as possible

    - by Robert Koritnik
    Is there a solution to create a virtual machine and start it by having an executable file, that will start the machine? If possible to start as quickly as possible. Strange situation? Not at all. Read on... Real life scenario Since we can't have domain controller on a non-server OS it would be nice to have domain controller in an as thin as possible machine (possibly Samba or similar because we'd like to make it startup as quickly as possible - in a matter of a few seconds) packed in a single executable. We could then configure our non-server OS to run the executable when it starts and before user logs in. This would make it possible to login into a domain.

    Read the article

  • How do I add a boot from cd option to yaboot?

    - by Sergiu
    So I'm dual-booting Ubuntu 12.04.1 on my iMac G5 powepc alongside Mac OS X and I want to add a boot cd option to yaboot because I'm trying to boot a scratched Mac OS X installation DVD that takes a while to read and the frst bootstrap moves on too fast. How do I edit the timeout for the first bootstrap anyways? So, my main question is, how do I add a cd booting option to yaboot and then, how doI boot it? The devalias from OpenFrmware tells me that 1 have 2 cd-rom instaled, on is /ht/pci@3/ata-6/disk@0 and the other on ends with a 1 instead of a zero. These are the contents of my yaboot.conf file: yaboot.conf generated by the Ubuntu installer run: "man yaboot.conf" for details. Do not make changes until you have!! see also: /usr/share/doc/yaboot/examples for example configurations. For a dual-boot menu, add one or more of: bsd=/dev/hdaX, macos=/dev/hdaY, macosx=/dev/hdaZ boot="/dev/disk/by-id/scsi-SATA_ST3160023AS_5MT1GCWA-part2" device=/ht@0,f2000000/pci@3/k2-sata-root@c/@0/@0 partition=4 root="UUID=798a048f-ee48-49e0-bba3-111aed8dee04" timeout=12000 install=/usr/lib/yaboot/yaboot magicboot=/usr/lib/yaboot/ofboot enablecdboot macosx="/dev/disk/by-id/scsi-SATA_ST3160023AS_5MT1GCWA-part3" image=/boot/vmlinux label=Linux read-only initrd=/boot/initrd.img append="quiet splash" What do I add here so that yaboot will boot from my cd in like 3 minutes after startup? Thanks!

    Read the article

  • Blacklist a single access point of a wireless network

    - by Zr40
    At my university, one of the wireless access points is failing. When something tries to associate to the network using that access point, it deassociates the client, claiming 802.1X authentication failure. Other access points do work normally using the same credentials. The issue has been reported, but after a month it still has still not been fixed. Now, I'm looking for a way to blacklist the access point's BSSID, so the OS prefers other access points on the same SSID. How can I blacklist specific BSSIDs in either Mac OS X Snow Leopard or Windows 7?

    Read the article

  • What are the major distinctions between PureDarwin and FreeBSD?

    - by ??????? ???????????
    I'm looking to install a different unix on my workstation to acquire some perspective on GNU/Linux and out of curiosity. I have narrowed my options down to these two. The reason for considering PureDarwin is because I have very little experience with Apple's products. So my question is will installing and using PureDarwin give me a closer understanding of OSX than would running FreeBSD? What I have in mind are day to day routines like adding users, installing software and configuring various aspects of the underlying OS. I know that the GUI of OSX would not be available, but that is not a concern. As a secondary, less important question, can I buy OS X in the apple store and run it in a virtual machine or does that violate their EULA?

    Read the article

  • How to use HFS formatted pen drive in Windows 7?

    - by row-sun
    I recently used disk utility in my mac book pro to format my 8 GB pen drive to install OS X. After that I formatted my pen drive from disk utility as FAT32 so that I would be able to use it in windows. But in windows the pen drive does not show up. When I right click on my computer and click manage and then disk management, the pen drive is listed there, but it doesn't show up in the explorer and I cant use it. I tried to do many things but I'm still not being able to use it in windows though I can use it in Mac OS X. Could anyone help? Thanks.

    Read the article

  • Win7 Professional x64 16GB (4.99GB usable)

    - by Killrawr
    I've installed Corsair Vengeance CMZ16GX3M2A1600C10, 2x8GB, DDR3-1600, PC3-12800, CL10, DIMM and my BIOS picks up that there is 16GB, Windows says there is 16GB, CPU-z says there is 16GB. But it only says I can use 4.99GB out of 16GB. Motherboard is P55-GD65 (MS-7583) Supports four unbuffered DIMM of 1.5 Volt DDR3 1066/1333/1600*/2000*/2133* (OC) DRAM, 16GB Max Windows (Above screenshot specifies that I am on a System type: 64-bit OS) CPU-z Microsoft says that the physical memory limit on a 64 bit win7 professional operating system is 192GB. Dxdiag Run Command BIOS Screenshot #1 BIOS Screenshot #2 Why is my OS limiting me to just over a quarter of the available memory? is there anyway to increase it?

    Read the article

  • Top causes of slow ssh logins

    - by Peter Lyons
    I'd love for one of you smart and helpful folks to post a list of common causes of delays during an ssh login. Specifically, there are 2 spots where I see a range from instantaneous to multi-second delays. Between issuing the ssh command and getting a login prompt and between entering the passphrase and having the shell load Now, specifically I'm looking at ssh details only here. Obviously network latency, speed of the hardware and OSes involved, complex login scripts, etc can cause delays. For context I ssh to a vast multitude of linux distributions and some Solaris hosts using mostly Ubuntu, CentOS, and MacOS X as my client systems. Almost all of the time, the ssh server configuration is unchanged from the OS's default settings. What ssh server configurations should I be interested in? Are there OS/kernel parameters that can be tuned? Login shell tricks? Etc?

    Read the article

  • Solaris 11 installed, no updates?

    - by Paul De Niro
    I was messing around with solaris and decided to give Solaris 11 a try so I downloaded it from the Oracle website. After installing the OS, I went into the package manager and did an update. It told me that there were to available updates! I find this hard to believe considering that it's running a vulnerable version of firefox and java, its own in-house software product! Many of the other software products that came with the default install are also out of date and vulnerable. Is this normal for an Oracle install, or did I do something wrong with the upgrade process? I typed "pkg update" at the prompt, and I noticed that it did call out to pkg.oracle.com looking for updates. I find it bizarre that there are no updates available for an OS that was released a couple months ago with vulnerable software...

    Read the article

  • How to delete a folder in python when [Error 32] is present

    - by harish
    I am using python 2.7. I want to delete a folder which may or may not be empty. The folder is handled by thread for file-monitoring. I am not able to kill thread but wanted to delete this folder any how. I tried with os.rmdir(Location) shutil.rmtree(Location) os.unlink(Location) But, it didn't work. It is showing error as [Error 32] The process cannot access the file because it is being used by another process: 'c:\\users\\cipher~1\\appdata\\local\\temp\\fis\\a0c433973524de528420bbd56f8ede609e6ea700' I want to delete folder a0c433973524de528420bbd56f8ede609e6ea700 or delete whole path will also suffice.

    Read the article

  • Installation on SSD with Windows preinstalled

    - by ebbot
    I bought a laptop with this fancy SSD drive, fancy new UEFI aso. I figured at first Windows out Ubuntu in but after doing 3 DoA on 3 laptops in one day I realized that maybe keeping Windows could come in handy. So dual boot it is. And this is what I've got: Disk 1 - 500 Gb HD 300 Mb Windoze only says "Healthy" don't know what it's for. 600 Mb "Healthy (EFI partition)" 186.30 Gb NTFS "OS (C:)" "Healthy (Boot, Page File, Crash Dump, Primary Partition)" 258.45 Gb NTFS "Data (D:)" "Healthy" 20.00 Gb "Healthy (Recovery Partition)" Disk 2 - 24 Gb SSD 4.00 Gb "Healthy (OEM Partition)" 18.36 Gb "Healthy (Primary Partition)" So I'm not sure what the first partition on each drive does (the 300 Gb on the HD and the OEM Partition on the SSD. Nor do I know what Data (D:). I think the 2nd partition on the SSD is for some speedup of Windoze. I'm debating if I should shrink the OS (C:) drive to around 120 GB or so. Clear the Data (D:) and also use the whole SSD for Ubuntu. That would leave me 24 Gb for e.g. / on the SSD and some 320 Gb on the HD for /home and swap. Is this a reasonable setup? Do I need to configure fstab for the SSD differently to a HD?

    Read the article

  • Debian doesn't boot after removing secondary hard drive

    - by Daveel
    In the beginning I had Debian 6 running on one hard drive (/dev/sda1). Then I decided to keep all my stuff(pics, videos, etc..) in another slave hard drive (/dev/sdb1). So sda1 has Debian OS sdb1 doesn't contain any OS files I have made it to mount automatically by adding a row in /etc/fstab (UUID and directory to mount to) Time have passed and when I tried to change that secondary hard drive with another hard drive with bigger capacity, for some reason Debian won't boot (just itself sda1) after removing secondary hard drive (sdb1) But if I plug sdb1 back, it boots just fine. I tried to comment line out from /etc/fstab, so it doesn't mount And also did update-grub after umount /dev/sdb1 What's the right way to remove hard drive secondary hard drive?

    Read the article

  • Is there a way to transfer windows license to a different machine?

    - by Alex Khvatov
    I purchased a license and used Windows 7 Home Premium 32 bit OS for a while. But recently I bought a 64 bit version to take advantage of the larger RAM the machine had and hence reinstalled the OS and activated a new license for the 64-bit version. Now, I am in a need to install the 32 bit version on another machine. How do I go about reactivating a license on another machine? (again the license currently is not used) Am I going to have issues with Microsoft not letting me reactivate that license on a different machine? Thank you.

    Read the article

  • Compiz problems in Ubuntu 12.10

    - by Antonio Raffaele Iannaccone
    I have installed ubuntu 12.10 x64 on my notebook and I wanted to make a little customization in the UI, so i downloaded Compiz Settings Manager and opened it up. Once I opened it up, I found out that in the compiz are not all those settings and animations (that I could apply like on the photos, videos etc.) so I reinstalled it few times. Once I get bored with the reinstalling I checked one field in there and Ubuntu (OS) started to get "lagged" (Dash get hid, OS started to do not respond very well). So please, can anyone help me? How can I customize my ubuntu without get lagged and with all the animations that have to be available in the compiz? Thanks to all! thank you! It seems that it helped to fix the Dash-hide problem, but I still do not have all the animations and features that have to be in the Compiz (program). Can you help me with this too please? Thanks a lot!

    Read the article

  • Is there a Google Authenticator desktop client?

    - by cwd
    I am using Google Authenticator for 2-step authentication. I like how I can use a code and verify my account using my phone: I realize that the app was designed to run on a device other than a computer to increase security for the computer (in case that it is lost or stolen), but I would like to know if there is a way I can run Google Authenticator on my Macbook. Now, per the Google Authenticator Page it will not run on a desktop: What devices does Google Authenticator work on? Android version 2.1 or later BlackBerry OS 4.5 - 6.0 iPhone iOS 3.1.3 or later However there are several emulators for developers and so I wonder if it is possible to run one of these emulators and then run Google Authenticator with that. I do realize this is not a best practice - but I'm less worried about my laptop getting stolen and more worried about someone just hacking the account. So my question is this: Is it possible to run it on the desktop, even though it is not meant to be / not recommended?

    Read the article

  • migration of physical server to a virtual solution, what i have to do?

    - by bibarse
    Hello I'm new in this forum, so i would like that you forgive me for my blissfully and my low English level. I'm a trainee in company one month ago, and my mission is to migrate 3 physicals servers to a virtualization technology. The company edit softwares for E-learning so there are lots of data like videos, flash and compressed (zip). This is some inventory of the servers: OS: Debian, 2 redhat, apache, php/mysql, sendMail/Dovecot, webmin with virtualmin template to create dynamically the web sites because there is no sysadmin ... The future provider will be responsible of to secure, update and create the virtual machines (outsourcing) and with a RedHat OS's. So i want that you help me to choose a virtualisation technologie (for the i prefer KVM of Redhat RHEV, VMWare is expensive), how evaluate the hardware needs (this for evolution of 4 or 5 years) and to elaborate a good planing to don't forget any think. Thank you for your responses.

    Read the article

  • Why am I getting [mount error(22): Invalid argument] while trying to mount SMB network drive?

    - by Steve_
    Disclaimer: I am very new to Linux :) Anyway, onward: I have a fresh instance of Ubuntu Server (12.04.1 LTS) running on my network and I want to mount a network drive to the server so I can access the contents. The network drive is a SAMBA compatible drive running Darwin OS. If I run the following command: smbclient -L //192.168.0.2 -U myuser It prompts me for the password and then displays output similar to: Domain=[SERVER01] OS=[Darwin] Server=[@(#)PROGRAM:smbd PROJECT:smbx-105.4.0] Sharename Type Comment --------- ---- ------- Comp Staff's Public Folder Disk CompRaid03 Disk Dropbox Disk Groups Disk IPC$ IPC Public Disk Users Disk compstaff Disk However, when I try and mount the CompRaid03 share, using this command: sudo mount -t cifs //192.168.0.2/CompRaid03 /mnt/myshare -o username=myuser I get the same password prompt, but after putting the correct password in, I received this error: mount error(22): Invalid argument dmesg | tail returns: [23576.037373] CIFS VFS: cifs_mount failed w/return code = -22 I don't understand what is wrong with this command. I've managed to mount a share on my current (Windows 8) machine using basically the same command but with a different IP address and share name (obviously). I've spent a good few hours trying to solve this and got no where. Any help or pointers would be greatly appreciated. Thanks Steve EDIT As suggested I've also trued using "user=" instead of "username=": sudo mount -t cifs //192.168.0.2/CompRaid03 /mnt/svnrepo -o user=myuser This results in the same "Invalid argument" error.

    Read the article

  • How to install RAID drivers on already installed Windows 7?

    - by happysencha
    64-bit Windows 7 Ultimate 6GB RAM Intel i7 920 Intel X25-M SSD 80GB 2,5" Club 3D Radeon HD5750 GA-EX58-UD4P Motherboard I've been running fine with Windows 7 installed on the SSD. I wanted to create an mirrored Raid-1 setup for backups using two hard disks, so I ordered two Samsung HD203WI. This motherboard supports two different RAID controllers, the Intel's ICH10R and Gigabyte's SATA2 SATA controller. There are 6 SATA ports behind the ICH10R and 2 SATA ports for the Gigabyte controller. I googled around and seemed that the ICH10R is a better choice and since then I've been trying to make it work. When I activate the [RAID] mode from BIOS, the Windows 7 gives BSOD exactly as described by this guy: "Windows 7 will start to boot, it gets to the screen where there are 4 colors coming together and it blue screens and restarts no matter what I do." First thing I did: turned off the RAID and booted to Windows and tried to install the SATA RAID drivers from Gigabyte. I launch the driver installation program and it gives "This computer does not meet the minimum requirements for installing the software" error. I then tried Intel's Rapid Storage Technology drivers (which apparently is the same as the one offered at Gigabyte's site), but it resulted in exactly the same error. I then detached the new Samsung hard disks from the SATA ports, but left the [RAID] enabled in BIOS. To my surprise, it still BSOD'd, so at this point I knew it is an OS/driver issue. Also, I tried with the Gigabyte's RAID enabled (while the ICH10R RAID disabled) and it booted just fine. So then I thought, that maybe I can't install the RAID drivers from within the OS. So I caused the BSOD on purpose once again, and then with ICH10R RAID activated and Samsung hard disks attached, I choose the Windows 7 Recovery mode in the boot menu. It sees some problem(s), tries to repair, does not succeed and does not ask for drivers (which I put on a USB stick) to install. I also tried to use the command-line in the recovery: "rundll32 syssetup, SetupInfObjectInstallAction DefaultInstall 128 iaStor.inf" but it gave "Installation failed." So I'm clueless how should I proceed. Do I really need to re-install Windows 7 and load RAID drivers in the Win7 setup? I don't want to install any OS on the RAID, the Windows 7 is and will be on the SSD. I just want to have a RAID-1 backup using those two hard disks. I mean why would I need to re-install operating system to add RAID setup?

    Read the article

< Previous Page | 246 247 248 249 250 251 252 253 254 255 256 257  | Next Page >