Search Results

Search found 23082 results on 924 pages for 'address space'.

Page 253/924 | < Previous Page | 249 250 251 252 253 254 255 256 257 258 259 260  | Next Page >

  • How can I create objects based on dump file memory in a WinDbg extension?

    - by pj4533
    I work on a large application, and frequently use WinDbg to diagnose issues based on a DMP file from a customer. I have written a few small extensions for WinDbg that have proved very useful for pulling bits of information out of DMP files. In my extension code I find myself dereferencing c++ class objects in the same way, over and over, by hand. For example: Address = GetExpression("somemodule!somesymbol"); ReadMemory(Address, &addressOfPtr, sizeof(addressOfPtr), &cb); // get the actual address ReadMemory(addressOfObj, &addressOfObj, sizeof(addressOfObj), &cb); ULONG offset; ULONG addressOfField; GetFieldOffset("somemodule!somesymbolclass", "somefield", &offset); ReadMemory(addressOfObj+offset, &addressOfField, sizeof(addressOfField), &cb); That works well, but as I have written more extensions, with greater functionality (and accessing more complicated objects in our applications DMP files), I have longed for a better solution. I have access to the source of our own application of course, so I figure there should be a way to copy an object out of a DMP file and use that memory to create an actual object in the debugger extension that I can call functions on (by linking in dlls from our application). This would save me the trouble of pulling things out of the DMP by hand. Is this even possible? I tried obvious things like creating a new object in the extension, then overwriting it with a big ReadMemory directly from the DMP file. This seemed to put the data in the right fields, but freaked out when I tried to call a function. I figure I am missing something...maybe c++ pulls some vtable funky-ness that I don't know about? My code looks similar to this: SomeClass* thisClass = SomeClass::New(); ReadMemory(addressOfObj, &(*thisClass), sizeof(*thisClass), &cb);

    Read the article

  • XElement vs Dcitionary

    - by user135498
    Hi All, I need advice. I have application that imports 10,000 rows containing name & address from a text file into XElements that are subsequently added to a synchronized queue. When the import is complete the app spawns worker threads that process the XElements by deenqueuing them, making a database call, inserting the database output into the request document and inserting the processed document into an output queue. When all requests have been processed the output queue is written to disk as an XML doc. I used XElements for the requests because I needed the flexibility to add fields to the request during processing. i.e. Depending on the job type the app might require that it add phone number, date of birth or email address to a request based on a name/address match against a public record database. My questions is; The XElements seems to use quite a bit of memory and I know there is a lot of parsing as the document makes its way through the processing methods. I’m considering replacing the XElements with a Dictionary object but I’m skeptical the gain will be worth the effort. In essence it will accomplish the same thing. Thoughts?

    Read the article

  • Anonymous union definition/declaration in a macro GNU vs VS2008

    - by Alan_m
    I am attempting to alter an IAR specific header file for a lpc2138 so it can compile with Visual Studio 2008 (to enable compatible unit testing). My problem involves converting register definitions to be hardware independent (not at a memory address) The "IAR-safe macro" is: #define __IO_REG32_BIT(NAME, ADDRESS, ATTRIBUTE, BIT_STRUCT) \ volatile __no_init ATTRIBUTE union \ { \ unsigned long NAME; \ BIT_STRUCT NAME ## _bit; \ } @ ADDRESS //declaration //(where __gpio0_bits is a structure that names //each of the 32 bits as P0_0, P0_1, etc) __IO_REG32_BIT(IO0PIN,0xE0028000,__READ_WRITE,__gpio0_bits); //usage IO0PIN = 0x0xAA55AA55; IO0PIN_bit.P0_5 = 0; This is my comparable "hardware independent" code: #define __IO_REG32_BIT(NAME, BIT_STRUCT)\ volatile union \ { \ unsigned long NAME; \ BIT_STRUCT NAME##_bit; \ } NAME; //declaration __IO_REG32_BIT(IO0PIN,__gpio0_bits); //usage IO0PIN.IO0PIN = 0xAA55AA55; IO0PIN.IO0PIN_bit.P0_5 = 1; This compiles and works but quite obviously my "hardware independent" usage does not match the "IAR-safe" usage. How do I alter my macro so I can use IO0PIN the same way I do in IAR? I feel this is a simple anonymous union matter but multiple attempts and variants have proven unsuccessful. Maybe the IAR GNU compiler supports anonymous unions and vs2008 does not. Thank you.

    Read the article

  • ack (perl?) regexp matching lines where if is the first word

    - by Gauthier
    Hey. I'm finally learning regexps, training with ack. I believe this uses perl regexp. I want to match all lines where the first non-blank characters are if (<word> !, with any number of spaces in between the elements. This is what I came up with: ^[ \t]*if *\(\w+ *! It only nearly worked. ^[ \t]* is wrong, since it matches one or none [space or tab]. What I want is to match anything that may contain only space or tab (or nothing). For example these should not match: // if (asdf != 0) else if (asdf != 1) How can I modify my regexp for that?

    Read the article

  • How to restart a wcf server from within a client?

    - by djerry
    Hey guys, I'm using Wcf for server - client communication. The server will need to run as a service, so there's no GUI. The admin can change settings using the client program and for those changes to be made on server, it needs to restart. This is my server setup NetTcpBinding binding = new NetTcpBinding(SecurityMode.Message); Uri address = new Uri("net.tcp://localhost:8000"); //_svc = new ServiceHost(typeof(MonitoringSystemService), address); _monSysService = new MonitoringSystemService(); _svc = new ServiceHost(_monSysService, address); publishMetaData(_svc, "http://localhost:8001"); _svc.AddServiceEndpoint(typeof(IMonitoringSystemService), binding, "Monitoring Server"); _svc.Open(); MonitoringSystemService is a class i'm using to handle client - server comm. It looks like this: [CallbackBehavior(ConcurrencyMode = ConcurrencyMode.Reentrant)] [ServiceBehavior(InstanceContextMode = InstanceContextMode.Single, MaxItemsInObjectGraph = 2147483647)] public class MonitoringSystemService : IMonitoringSystemService {} So i need to call a restart method on the client to the server, but i don't know how to restart (even stop - start) the server. I hope i'm not missing any vital information. Thanks in advance.

    Read the article

  • Variable length Blob in hibernate?

    - by Seth
    I have a byte[] member in one of my persistable classes. Normally, I'd just annotate it with @Lob and @Column(name="foo", size=). In this particular case, however, the length of the byte[] can vary a lot (from ~10KB all the way up to ~100MB). If I annotate the column with a size of 128MB, I feel like I'll be wasting a lot of space for the small and mid-sized objects. Is there a variable length blob type I can use? Will hibernate take care of all of this for me behind the scenes without wasting space? What's the best way to go about this? Thanks!

    Read the article

  • Is it possible to store pointers in shared memory without using offsets?

    - by Joseph Garvin
    When using shared memory, each process may mmap the shared region into a different area of their address space. This means that when storing pointers within the shared region, you need to store them as offsets of the start of the shared region. Unfortunately, this complicates use of atomic instructions (e.g. if you're trying to write a lock free algorithm). For example, say you have a bunch of reference counted nodes in shared memory, created by a single writer. The writer periodically atomically updates a pointer 'p' to point to a valid node with positive reference count. Readers want to atomically write to 'p' because it points to the beginning of a node (a struct) whose first element is a reference count. Since p always points to a valid node, incrementing the ref count is safe, and makes it safe to dereference 'p' and access other members. However, this all only works when everything is in the same address space. If the nodes and the 'p' pointer are stored in shared memory, then clients suffer a race condition: x = read p y = x + offset Increment refcount at y During step 2, p may change and x may no longer point to a valid node. The only workaround I can think of is somehow forcing all processes to agree on where to map the shared memory, so that real pointers rather than offsets can be stored in the mmap'd region. Is there any way to do that? I see MAP_FIXED in the mmap documentation, but I don't know how I could pick an address that would be safe.

    Read the article

  • increasing amazon root volume size

    - by OCD
    I have a default amazon ec2 instance with 8GB root volume size. I am running out of space. I have: Detach the current EBS volume in AWS Management Console (Web). Create snapshot of this volume. Created a new Volume with 50G space with my snapshot. Attach the new volume back to the instance to /dev/sda1 However, when I reconnect to the account with: > df -h I can see from the management console that my new Filesystem 1K-blocks Used Available Use% Mounted on /dev/xvda1 8256952 8173624 0 100% / tmpfs 308508 40 308468 1% /dev/shm It's still not using my new volume's size, how to make this work?

    Read the article

  • Way to get VS 2008 to stop forcing indentation on namespaces?

    - by Earlz
    I've never really been a big fan of the way most editors handle namespaces. They always force you to add an extra pointless level of indentation. For instance, I have a lot of code in a page that I would much rather prefer formatted as namespace mycode{ class myclass{ void function(){ foo(); } void foo(){ bar(); } void bar(){ //code.. } } } and not something like namespace mycode{ class myclass{ void function(){ foo(); } void foo(){ bar(); } void bar(){ //code.. } } } Honestly, I don't really even like the class thing being indented most of the time because I usually only have 1 class per file. And it doesn't look as bad here, but when you get a ton of code and lot of scopes, you can easily have indentation that forces you off the screen, and plus here I just used 2-space tabs and not 4-space as is used by us. Anyway, is there some way to get Visual Studio to stop trying to indent namespaces for me like that?

    Read the article

  • jquery ui modal dialog problems in IE

    - by JohnM2
    I use jquery ui dialog widget. Everything works fine in FF, Opera etc., except IE. The problem is that when dialog is opened in Internet Explorer, some space (not covered with that "modal gray layer") is added at the bottom of the document, and page is scrolled to the bottom. So I don't even see the dialog, I have to scroll up, to see it fully. Anyone had that problems? Any solutions? EDIT: now I see, that this "bottom space" is also added in FireFox, but it doesn't scroll to it like in IE.

    Read the article

  • Atomic int writes on file

    - by Waneck
    Hello! I'm writing an application that will have to be able to handle many concurrent accesses to it, either by threads as by processes. So no mutex'es or locks should be applied to this. To make the use of locks go down to a minimum, I'm designing for the file to be "append-only", so all data is first appended to disk, and then the address pointing to the info it has updated, is changed to refer to the new one. So I will need to implement a small lock system only to change this one int so it refers to the new address. How is the best way to do it? I was thinking about maybe putting a flag before the address, that when it's set, the readers will use a spin lock until it's released. But I'm afraid that it isn't at all atomic, is it? e.g. a reader reads the flag, and it is unset on the same time, a writer writes the flag and changes the value of the int the reader may read an inconsistent value! I'm looking for locking techniques but all I find is either for thread locking techniques, or to lock an entire file, not fields. Is it not possible to do this? How do append-only databases handle this? Thanks! Cauê

    Read the article

  • starting oracle 10g on ubuntu, Listener failed to start.

    - by tsegay
    I have installed oracle 10g on a ubuntu 10.x, This is my first time installation. After installing I tried to start it with the command below. tsegay@server-name:/u01/app/oracle/product/10.2.0/db_1/bin$ lsnrctl LSNRCTL for Linux: Version 10.2.0.1.0 - Production on 29-DEC-2010 22:46:51 Copyright (c) 1991, 2005, Oracle. All rights reserved. Welcome to LSNRCTL, type "help" for information. LSNRCTL> start Starting /u01/app/oracle/product/10.2.0/db_1/bin/tnslsnr: please wait... TNSLSNR for Linux: Version 10.2.0.1.0 - Production System parameter file is /u01/app/oracle/product/10.2.0/db_1/network/admin/listener.ora Log messages written to /u01/app/oracle/product/10.2.0/db_1/network/log/listener.log Error listening on: (DESCRIPTION=(ADDRESS=(PROTOCOL=IPC)(KEY=EXTPROC1))) TNS-12555: TNS:permission denied TNS-12560: TNS:protocol adapter error TNS-00525: Insufficient privilege for operation Linux Error: 1: Operation not permitted Listener failed to start. See the error message(s) above... my listener.ora file looks like this: # listener.ora Network Configuration File: /u01/app/oracle/product/10.2.0/db_1/network/admin/listener.ora # Generated by Oracle configuration tools. SID_LIST_LISTENER = (SID_LIST = (SID_DESC = (SID_NAME = PLSExtProc) (ORACLE_HOME = /u01/app/oracle/product/10.2.0/db_1) (PROGRAM = extproc) ) ) LISTENER = (DESCRIPTION_LIST = (DESCRIPTION = (ADDRESS = (PROTOCOL = IPC)(KEY = EXTPROC1)) (ADDRESS = (PROTOCOL = TCP)(HOST = acct-vmserver)(PORT = 1521)) ) ) I can guess the problem is with permission issue, But i dont know where I have to do the change on permission. Any help is appreciated ...

    Read the article

  • What Regex can strip e.g. "note:" and "firstName: " from the left of a string?

    - by Edward Tanguay
    I need to strip the "label" off the front of strings, e.g. note: this is a note needs to return: note and this is a note I've produced the following code example but am having trouble with the regexes. What code do I need in the two ???????? areas below so that I get the desired results shown in the comments? using System; using System.Collections.Generic; using System.Linq; using System.Text; using System.Text.RegularExpressions; namespace TestRegex8822 { class Program { static void Main(string[] args) { List<string> lines = new List<string>(); lines.Add("note: this is a note"); lines.Add("test: just a test"); lines.Add("test:\t\t\tjust a test"); lines.Add("firstName: Jim"); //"firstName" IS a label because it does NOT contain a space lines.Add("She said this to him: follow me."); //this is NOT a label since there is a space before the colon lines.Add("description: this is the first description"); lines.Add("description:this is the second description"); //no space after colon lines.Add("this is a line with no label"); foreach (var line in lines) { Console.WriteLine(StringHelpers.GetLabelFromLine(line)); Console.WriteLine(StringHelpers.StripLabelFromLine(line)); Console.WriteLine("--"); //note //this is a note //-- //test //just a test //-- //test //just a test //-- //firstName //Jim //-- // //She said this to him: follow me. //-- //description //this is the first description //-- //description //this is the first description //-- // //this is a line with no label //-- } Console.ReadLine(); } } public static class StringHelpers { public static string GetLabelFromLine(this string line) { string label = line.GetMatch(@"^?:(\s)"); //??????????????? if (!label.IsNullOrEmpty()) return label; else return ""; } public static string StripLabelFromLine(this string line) { return ...//??????????????? } public static bool IsNullOrEmpty(this string line) { return String.IsNullOrEmpty(line); } } public static class RegexHelpers { public static string GetMatch(this string text, string regex) { Match match = Regex.Match(text, regex); if (match.Success) { string theMatch = match.Groups[0].Value; return theMatch; } else { return null; } } } }

    Read the article

  • Is it possible to group records belonging to an entity in dbunit?

    - by Joshua
    Our JPA entity model auto-generates primary key identifiers for user, user_address tables. Would it be possible to group these entities given below via dbunit, so that I don't need to provide neither the primary key as well as the foreign key reference from user_address.user_id. It is getting very hard to maintain these keys (i.e. I would prefer to group the primary record 'user' and the child records 'user_address' so that dbunit can group them automatically by looking up the entity metadata). Is it achievable? <user id="1" first_name="Josh" creation_date="2009-07-11 15:45:28"/> <user_address id="1" user_id="1" address="Main St" city="Los Angeles"/> I would prefer something like this <!-- First user --> <user first_name="Josh" creation_date="2009-07-11 15:45:28"/> <user_address address="Main St" city="Los Angeles"/> <!-- Second user --> <user first_name="Mary" creation_date="2009-07-11 15:45:28"/> <user_address address="Taylors St" city="San Jose"/>

    Read the article

  • SQL: ATER COLUMN to shorter CHAR(n) type

    - by Rising Star
    I'm working with MS SQL SERVER 2003. I want to change a column in one of my tables to have fewer characters in the entries. This is identical to this question: http://stackoverflow.com/questions/2281336/altering-a-table-column-to-accept-more-characters except for the fact that I want fewer characters instead of more. I have a column in one of my tables that holds nine-digit entries. A developer previously working on the table mistakenly set the column to hold ten-digit entries. I need to change the type from CHAR(10) to CHAR(9). Following the instructions from the discussion linked above, I wrote the statement ALTER TABLE [MY_TABLE] ALTER COLUMN [MY_COLUMN] CHAR(9); This returns the error message "String or binary data would be truncated". I see that my nine-digit strings have a space appended to make them ten digits. How do I tell SQL Server to discard the extra space and convert my column to a CHAR(9) type?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How do you organise your MVC controller tests?

    - by Andrew Bullock
    I'm looking for tidy suggestions on how people organise their controller tests. For example, take the "add" functionality of my "Address" controller, [AcceptVerbs(HttpVerbs.Get)] public ActionResult Add() { var editAddress = new DTOEditAddress(); editAddress.Address = new Address(); editAddress.Countries = countryService.GetCountries(); return View("Add", editAddress); } [RequireRole(Role = Role.Write)] [AcceptVerbs(HttpVerbs.Post)] public ActionResult Add(FormCollection form) { // save code here } I might have a fixture called "when_adding_an_address", however there are two actions i need to test under this title... I don't want to call both actions in my Act() method in my fixture, so I divide the fixture in half, but then how do I name it? "When_adding_an_address_GET" and "When_adding_an_address_POST"? things just seems to be getting messy, quickly. Also, how do you deal with stateless/setupless assertions for controllers, and how do you arrange these wrt the above? for example: [Test] public void the_requesting_user_must_have_write_permissions_to_POST() { Assert.IsTrue(this.SubjectUnderTest.ActionIsProtectedByRole(c => c.Add(null), Role.Write)); } This is custom code i know, but you should get the idea, it simply checks that a filter attribute is present on the method. The point is it doesnt require any Arrange() or Act(). Any tips welcome! Thanks

    Read the article

  • Portable way of finding total disk size in Java (pre java 6)

    - by Wouter Lievens
    I need to find the total size of a drive in Java 5 (or 1.5, whatever). I know that Java 6 has a new method in java.io.File, but I need it to work in Java 5. Apache Commons IO has org.apache.commons.io.FileSystemUtils to provide the free disk space, but not the total disk space. I realize this is OS dependant and will need to depend on messy command line invocation. I'm fine with it working on "most" systems, i.e. windows/linux/macosx. Preferably I'd like to use an existing library rather than write my own variants. Any thoughts? Thanks.

    Read the article

  • HTML list wrapping problem

    - by Daniel
    I have a HTML list with this style: font-weight: bold; padding: 0px; margin: 0px; list-style-type: none; display: block; width:700px; font-size: 14px; white-space: pre-wrap; and the cells have this style: display: inline; and I have spacer cells between each cell with this style: padding-right: 20px; display: inline; My problem is that when the list is too long for its 700 pixels, it wraps. I want this, but I dont want the objects to be on two separate lines. I have tried the CSS white-space property, but nothing seems to work. Any ideas?

    Read the article

  • how Can we get the output format to CSV instead of HTML in Alfresco using webscripts?

    - by pavan123
    how Can we change the output format to CSV instead of HTML in Alfresco using webscripts? below are the my corresponding FTL and Webscript files recursive.get.html.ftl <#macro recurse_macro node depth> <#if node.isContainer> <tr> <td> ${node.properties.name} </td> <td></td> </tr> <#list node.children as child> <#if child.isContainer> <@recurse_macro node=child depth=depth+1/> <#list child.children as child2> <#if child2.isDocument> <tr><td></td><td>${child2.properties.name}</td></tr> </#if> </#list> </#if> </#list> </#if> </#macro> Recursive Listing of Spaces & Documents: Space Document recursive.get.desc.xml <webscript> <shortname>recurcive</shortname> <description>Recursive</description> <url>/sample/recursive/{recursive}</url> <format default="html">extension</format> <authentication>guest</authentication> </webscript> and html output is Recursive Listing of Spaces & Documents: Space Document Company Home Data Dictionary Space Templates Software Engineering Project Documentation Drafts Pending Approval Published Samples system-overview.html Discussions UI Design Presentations Quality Assurance Presentation Templates doc_info.ftl localizable.ftl my_docs.ftl my_spaces.ftl my_summary.ftl translatable.ftl recent_docs.ftl general_example.ftl my_docs_inline.ftl show_audit.ftl readme.ftl Email Templates notify_user_email.ftl invite_user_email.ftl RSS Templates RSS_2.0_recent_docs.ftl Saved Searches admin Scripts backup.js example test script.js backup and log.js append copyright.js alfresco docs.js test return value.js Web Scripts org alfresco sample blogsearch.get.js blogsearch.get.atom.ftl blogsearch.get.desc.xml blogsearch.get.html.ftl blogsearch.get.html.400.ftl blogsearch.get.atom.400.ftl categorysearch.get.js categorysearch.get.atom.ftl categorysearch.get.desc.xml categorysearch.get.html.ftl categorysearch.get.html.404.ftl categorysearch.get.atom.404.ftl folder.get.js folder.get.atom.ftl folder.get.desc.xml folder.get.html.ftl avmstores.get.desc.xml avmstores.get.html.ftl avmbrowse.get.js avmbrowse.get.desc.xml avmbrowse.get.html.ftl recursive.get.desc.xml recursive.get.html.ftl sgs.get.desc.xml sgs.get.csv.ftl sample1.get.desc.xml sample1.get.csv.ftl first.get.desc.xml first.get.text.ftl rag.get.html.ftl rag.get.desc.xml new1.get.desc.xml new1.get.html.ftl excel.get.html.ftl excel.get.desc.xml sgs1.get.desc.xml one.get.html.ftl one.get.desc.xml one.get.js readme.html Web Scripts Extensions readme.html Guest Home Alfresco-Tutorial.pdf User Homes isabel Users Home

    Read the article

  • DB design for master file in enterprise software

    - by Thang Nguyen
    Dear all. I want to write an enterprise software and now I'm in the DB design phase. The software will have some master data such as Suppliers, Customers, Inventories, Bankers... I considering 2 options: Put each of these on one separate table. The advantage: the table will have all necessary information for that kind of master file (Customer: name, address,.../Inventory: Type, Manufacturer, Condition...). Disadvantage: Not flexible. When I want to have a new type of master data, such as Insurer, I have to design another table. Put all in one table and this table have foreign key to another table which have type of each kind of master data (table 1: id, data_type, code, name, address....; table 2: data_type, data_type_name). Advantage: flexible - if I want more master data such as Insurer, I just put in table 2: code: 002, name: Insurer, and then put detail each insurer into table 1). Disadvantage: table 1 must have sufficient field to store all kind of information including: customer name, address, account, inventory's manufacturer, inventory's quality...). So which method do you usually do (or you think work better). Thank you very much

    Read the article

  • Shrink database after removing extra data

    - by Sergey Osypchuk
    We have a need to fit database in 4G in order to use ms sql express edition. I started from 7G database, and found a lot of not needed records, and deleted them. After Shrink database size is 4.6G, and 748MB is free (according to database properties). However, when i execute exec sp_spaceused i am having interesting results: DatabaseName Database_size unallocation space xxxxxx 4726.50 MB 765.42 MB Reserved Data index_size unused 3899472 KB 1608776 KB 1448400 KB 842296 KB Any ideas, how can i bite at least some of this unused space? Also I know table, which occupied it. update: is it worth to try to rebuild table indexes? ALTER INDEX ALL ON Production.Product REBUILD

    Read the article

  • DroDownlist in DataGrid produces Error

    - by S Nash
    I have a DataGrid and everytime I change value of it's embeded dropdwonlist I get: "System.Web.HttpException: The IListSource does not contain any data sources." I have a data grid which loads fine: Name column is editable. I have a dropdownlist these : DataDataGrid gets its value from a table. (Select Name, Address From Persons) Dropdown list also gets list of names from the same table. So DataGrid and dropdownlist are bound to 2 different datasets. Here is my code for dataGrid" <Columns> <ASP:ButtonColumn Text="Delete" CommandName="Delete"></ASP:ButtonColumn> <asp:EditCommandColumn ButtonType="LinkButton" UpdateText="Update" CancelText="Cancel" EditText="Edit"></asp:EditCommandColumn> <ASP:TemplateColumn HeaderText="Name" SortExpression="FY" HeaderStyle-HorizontalAlign="center" HeaderStyle-Wrap="True"> <ItemStyle Wrap="false" HorizontalAlign="left" /> <ItemTemplate> <ASP:Label ID="Name" Text='<%# DataBinder.Eval(Container.DataItem, "Name") %>' runat="server"/> </ItemTemplate> <EditItemTemplate> <ASP:DropDownList id="ddlName" cssClass="DropDownList" runat="server" datasource="<%#allNames%>" DataTextField= "Name" DataValueField="ID" Defaultvalue='<%# DataBinder.Eval(Container.DataItem, "ID") %>' OnPreRender="SetDefaultListItem" accessKey="I" AutoPostBack="true" /> </EditItemTemplate> </ASP:TemplateColumn> <asp:BoundColumn DataField="Address" ReadOnly="True" HeaderText="Address"></asp:BoundColumn> </Columns> Error happens here : dg.DataSource = ds dg.DataBind() Any ideas how to solve this issues? All I want is a DataGrid with a editable column ,which can be edited by choosing one of the value of in a dropdownlist.

    Read the article

  • Internet Explorer changes brightness

    - by Sale
    I have a very annoying problem with IE8 on Vista: My screen brightness changes when I view a page with IE. It slowly dimms brightness some 20% - enough to be noticeable. This seems to be dependent on the OVERALL brightness of the page viewed or of the amount of bright space on the page... sometimes it dimms down if the page is bright, sometimes the complete different, it dimms when lot of dark space is on the page. I know this sounds weird, I cannot describe it better. It takes about one,two seconds from on brightness level to the other. This ONLY occurs in IE - not in Word or any other application. Please help! This dimming is very stressfull for my eyes.

    Read the article

  • Compile time float packing/punning

    - by detly
    I'm writing C for the PIC32MX, compiled with Microchip's PIC32 C compiler (based on GCC 3.4). My problem is this: I have some reprogrammable numeric data that is stored either on EEPROM or in the program flash of the chip. This means that when I want to store a float, I have to do some type punning: typedef union { int intval; float floatval; } IntFloat; unsigned int float_as_int(float fval) { IntFloat intf; intf.floatval = fval; return intf.intval; } // Stores an int of data in whatever storage we're using void StoreInt(unsigned int data, unsigned int address); void StoreFPVal(float data, unsigned int address) { StoreInt(float_as_int(data), address); } I also include default values as an array of compile time constants. For (unsigned) integer values this is trivial, I just use the integer literal. For floats, though, I have to use this Python snippet to convert them to their word representation to include them in the array: import struct hex(struct.unpack("I", struct.pack("f", float_value))[0]) ...and so my array of defaults has these indecipherable values like: const unsigned int DEFAULTS[] = { 0x00000001, // Some default integer value, 1 0x3C83126F, // Some default float value, 0.005 } (These actually take the form of X macro constructs, but that doesn't make a difference here.) Commenting is nice, but is there a better way? It's be great to be able to do something like: const unsigned int DEFAULTS[] = { 0x00000001, // Some default integer value, 1 COMPILE_TIME_CONVERT(0.005), // Some default float value, 0.005 } ...but I'm completely at a loss, and I don't even know if such a thing is possible. Notes Obviously "no, it isn't possible" is an acceptable answer if true. I'm not overly concerned about portability, so implementation defined behaviour is fine, undefined behaviour is not (I have the IDB appendix sitting in front of me). As fas as I'm aware, this needs to be a compile time conversion, since DEFAULTS is in the global scope. Please correct me if I'm wrong about this.

    Read the article

< Previous Page | 249 250 251 252 253 254 255 256 257 258 259 260  | Next Page >