Search Results

Search found 10424 results on 417 pages for 'persisted column'.

Page 273/417 | < Previous Page | 269 270 271 272 273 274 275 276 277 278 279 280  | Next Page >

• Why is Chrome receiving data?

  - by Aero

  Chrome seems to be continually receiving data even though I'm not downloading anything. This is making a noticeable impact on my browsing speed. The first screenshot shows Chrome receiving data even though I'm not downloading anything (nor buffering a YouTube video etc.) Even after I completely close Google Chrome, the "chrome.exe" remains in the Resource Monitor list and the "Received bytes" column continually increases in the screenshot below. However, "chrome.exe" does not show up in the Processes tab of Task Manager. This only occurs sometimes, but I don't know why. I have tried running a malware/virus scans to ensure that there is nothing malicious behind this, but those scans have shown nothing. Any ideas on what's causing this?

  Read the article

• Writing Macros to find a specific cell and paste the value from a control cell into it

  - by G-Edinburgh

  I am having some issues writing a Macro to do the following. I have a very long list of rooms with two columns one containing the room number i.e. B-CL102 and the other containing a varying integer.I am looking to create a new column that will contain another different integer for each of the rooms. Is there any way to write a Macro so that I can use two control cells at the top of the sheet, type the room number into one and the integer matching that room into another, then run the Macro and it will automatically populate the correct cell. Then I can change the two values in the control cells and run the Macro again and so on. Thanks for your help, I have a very minimal amount of experience with Macros essentially just the basics. Thanks G

  Read the article

• How to configure Notepad++ (Scintilla) to write below EOF after EOL [on hold]

  - by Piotr Piaseczny

  Is it possible to configure scintilla to "brake" EOL/EOF while writing ? Now, if I want to begin writing in a column after EOL, I use ALT+left mouse button and start typing after click. No idea how to begin writing below EOF. Pressing Enter key many times is the only method now. Other explanation: If You open a new document, doesnt matter what kind of (php/txt etc) all You have is just one line. If You want to write in line 5 - must press Enter 5 times. Every other editor I know (IDE in Builder C++/MultiEdit) "ignore" eof and you can write anywhere in document. Because of php/html I've found notepad++ as a best editor but I'd like to "brake" limitations of (probably) scintilla

  Read the article

• Real RAM latency

  - by user32569

  Hi, very quick question. When I look for RAM timing, I got 2 different explanations on what is CAS latency. First states, its the time after command to read has been issued from CPU and data are send to data bus. Second says its time betwen column in memory layout has been activated. So, where is the truth? I mean, when I want to know total RAM latenci, in case 1, ot would be just CAS times one clock time. In second case, it would be CAS+other things like RAstoCAS and so times one clock time. Thanks.

  Read the article

• why need select privileges on *.* to use view?

  - by profy

  I have a problem using view with MySQL server 5.0 (5.0.92) I cannot use view with a user granted like that : GRANT USAGE ON *.* TO 'testuser'@'' IDENTIFIED BY PASSWORD '**********'; GRANT ALL PRIVILEGES ON `testuser`.* TO 'testuser'@''; I can create view, but when I try to select in, I have this messages : ERROR 1356 (HY000): View 'testuser.v' references invalid table(s) or column(s) or function(s) or definer/invoker of view lack rights to use them I need to "GRANT SELECT ON . TO 'testuser'@''" to make select working on the view. Why ? Do you know a solution to use VIEW's without the select privileges on . ? Thanks a lots for your answers.

  Read the article

• How to stop Excel Treating US dates as UK dates?

  - by deworde

  I'm in the UK, I've got a problem where I've got a list of dates supplied in US format. Excel seems to treat the ones that are valid in both formats as UK dates, (e.g. 03/01/2012 becomes 3rd of January rather that 1st March), and treat the ones that aren't valid UK dates (e.g. 03/13/2012) as basic text. I assume this choice is something to do with my regional settings. What I want is the system to recognise that this column of text is supplied in US date format, and convert it into the underlying date representation for calculations. How do I do this?

  Read the article

• Excel - Disable AutoFormatting on Import

  - by Philip Wales

  How can I stop Microsoft Excel from auto formatting data when imported from a text file? Specifically, I want it to treat all of the values as text. I am auditing insurance data in excel before it is uploaded to the new database. The files come to me as tab delimited text files. When loaded, Excel auto-formats the data causing leading 0's on Zip Codes, Routing Numbers and other codes, to be chopped off. I don't have the patience to reformat all of the columns as text and guess how many zeros need to be replaced. Nor do I want to click through the import wizard an specify that each column is text. Ideally I just want to turn off Excel's Auto-Formatting completely, and just edit every cell as it were plain text. I don't do any formula's or charts, just grid plain text editing.

  Read the article

• check two conditions in two different columns in excel and count the matches

  - by user1727103

  I've trying to create a Error Log to help me analyse my mistakes. So for simplicity, lets assume I have two columns "Type of Question" - with values SC,RC,CR and another column that indicates whether I got this question "right/wrong".Let's assume this is my table: Question No. | Right/Wrong | Question Type | Right | SC | Right | RC | Wrong | SC | Wrong | CR | Right | RC (Pardon my formatting skills). And I want an output table like this Type of Question | Right | Wrong | Total SC | 1 | 1 | 2 RC | 2 | 0 | 2 CR | 0 | 1 | 1 So basically what I want to do is check Column3 for SC using =COUNTIF(C1:C5,"SC"), and return the total number of SC questions, and then outta the SC , I need to find out which are Right.If I know the right and the total I can get the wrong. I have never written a macro so a formula based answer would suffice.

  Read the article

• How to set the relevance of emails in Outlook?

  - by Grastveit

  Mails in outlook have a relevance-field that can be displayed as a column in the inbox. How do one set it? Edit: More precisely, how are the values of custom e-mail-fields changed through the outlook 2007 gui? Here relevance and a custom field 'Score' is shown in my inbox, but all emails have blank values. The context-menu of emails give access to "Message Options...". I was hoping the custom fields would be available there.

  Read the article

• excel autocomplete combo-box with on-selection event

  - by IttayD

  Hi, I have an excel sheet for groceries. One column is the name, another is whether to buy it or not (checkbox) and another is the amount. I'd like to have a widget in the top row so that I start typing an item's name and it shows a list of matching items that I can select from, or if I continue to type and there's only one item, completes its name. When the last item is selected, other widgets show the amount, which I can edit and clicking 'check' will check the item in the list. I know this is kind of very specific, but am hoping someone can at least get me started. Thank you, Ittay

  Read the article

• Excel Help: Fill Tool - Drag to the side (across columns) but increase the formula by Row Number.

  - by B-Ballerl

  There are answers out there to this question, but all of them have been under explianed so hence to difficult to coprehend and use them to my advantage. I want to do the seemingly simple (but not) task of Draging a Formula (Filling a series) across Column's while increasing the formula row number relativley. For Example to drag this formula: | =A1 | =A2 | =A3 Some other notes, Transposing by copy paste has proven too difficult for the amount of data. Offset and Indirect has been used by other people to do this but I don't get how they work at all so when I attempt to use them I don't know how to format it to my range. Here's a example photo Idealy we want the dragged section to continue on to fill the formula.

  Read the article

• Finding throuput of CPU and Hardrive on Solaris

  - by Jim

  How do I find the throughput of a CPU and the hard disk on an OpenSolaris machine? Using mpstat or iostat? I'm having a hard time identifying the throughput if it is given at all in the commands output. For example, in mpstat there is very little explanation as to what the columns mean. I've been using the syscl column divided by time interval to find the throughput but to be honest I have no idea what a system call truly is. I'm trying to to analyze a hardrive and CPU while writing a file to the hardisk and when at rest.

  Read the article

• mysql -e option with variable data - Pass the variable value to insert sql statement in shell script

  - by Ahn

  The following shell script is not inserting the data to the table. How to pass the variable value to insert sql statement in a shell script. id=0 while true do id=`expr $id + 1`; mysql -u root -ptest --socket=/data/mysql1/mysql.sock -e 'insert into mytest1.mytable2(id,name) values (' $id ',"testing");' echo $id >> id.txt done I have modified the script as below and tried, and still having the issue id=0 while true do id=`expr $id + 1`; # mysql -u root -ptest --socket=/data/mysql1/mysql.sock1 -e 'insert into mytest1.mytable1(name) values ("amma");' mysql -u root -ptest --socket=/data/mysql1/mysql.sock -e 'insert into mytest1.mytable2(id,name) values ( $id ,"testing");' echo $id >> id.txt done error : ]$ ./insert ERROR 1054 (42S22) at line 1: Unknown column '$id' in 'field list'

  Read the article

• PostgreSQL, update existing rows with pg_restore

  - by woky

  Hello. I need to sync two PostgreSQL databases (some tables from development db to production db) sometimes. So I came up with this script: [...] pg_dump -a -F tar -t table1 -t table2 -U user1 dbname1 | \ pg_restore -a -U user2 -d dbname2 [...] The problem is that this works just for newly added rows. When I edit non-PK column I get constraint error and row isn't updated. For each dumped row I need to check if it exists in destination database (by PK) and if so delete it before INSERT/COPY. Thanks for your advice. (Previously posted on stackoverflow.com, but IMHO this is better place for this question).

  Read the article

• How does the "Full Control" permission differ from manually giving all other permissions?

  - by Lord Torgamus

  On Windows Server 2003, and some other versions of Windows, the Properties > Security tab of a folder's or file's context menu provides "Allow" and "Deny" options for "Full Control," "Modify," "Read" and other permissions (graphic provided). After clicking "Full Control," all boxes in the column — except for "Special Permissions" — get automatically checked. What's the difference between checking "Full Control" and just checking all the other boxes individually? Are there hidden/advanced permissions toggled by "Full Control" that aren't listed in the main permissions window? Is "Full Control" just a convenience shortcut?

  Read the article

• Dangers of the pyton eval() statement

  - by LukeP

  I am creating a game. Specifically it is a pokemon battle simulator. I have an sqlite database of moves in which a row looks something like: name | type | Power | Accuracy | PP | Description However, there are some special moves. For said special moves, their damage (and other attributes not shown above, like status effects) may be dependant on certian factors. Rather than create a huge if/else in one of my classes covering the formulas for every one of these moves. I'd rather include another column in the DB that contains a formula in string form, like 'self.health/2'(simplified example). I could then just plug that into eval. I always see people saying to stay away from eval, but from what I can tell, this would be considered an acceptable use, as the dangers of eval only come into play when accepting user input. Am I correct in this assumption, or is there somthing i'm not seeing.

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• Set an Excel cell's color based on multiple other cells' colors

  - by Lord Torgamus

  I have an Excel 2007 spreadsheet for a list of products and a bunch of factors to rate each one on, and I'm using Conditional Formatting to set the color of the cells in the individual attribute columns. It looks something like this: I want to fill in the rating column for each item with a color, based on the color ratings of its individual attributes. Examples of ways to determine this: the color of the category in which the item scored worst the statistical mode of the category colors the average of the category ratings, where each color is assigned a numerical value How can I implement any or all of the above rules? (I'm really just asking for a quick overview of the relevant Excel feature; I don't need step-by-step instructions for each rule.)

  Read the article

• Is it possible to use images in an Excel IF statement?

  - by dunc

  Quite a simple one here, but I guess the answer will be a resounding no! I have a few symbols, basic clip-art, which I'd like to display depending on certain information. At the moment, I'm using this statement to display Y or N: =IF(B2>0,VLOOKUP(B2,'Student Data'!$A$2:$L$36,8),"") It's a simple lookup which checks another worksheet to see if someone has entered "Y" or "N" into the relevant column. What I'm wondering is this: would it be possible to display these clip-art images (I have them in .PNG format) instead of simple text? I.e. IF VALUE_OF_CELL=7, DISPLAY IMAGE1. Thanks in advance,

  Read the article

• Vim Misbehaving

  - by zchtodd

  I'm not sure what changed, but lately Vim has been driving me nuts. Whenever I try to do a column mode insert, vim takes my current character and adds to the last character I inserted. For example, the first time I do a block comment by inserting # on multiple lines, it works fine. The next time, however, I end up with ## inserted on every line, and the problem just compounds from there. To do this, I'm hitting Ctrl-V, down or up arrow, Shift-I, #, and then Esc. This worked for months, but now it seems to be pasting extra stuff in. I've tried disabling all .vimrc files, but the behavior remains the same. Any ideas?

  Read the article

• How do I combine data from multiple rows in excel to one cell?

  - by Steve

  I have a list of product skus in one column in excel. I have thousands of these skus that need to be combined in one cell separated by commas with no spaces. There are too many rows of data to use the concatenate function. Not sure how to get this done. Here's an example of what I'm working with but with 6,000+ more rows. I'm using Excel 2003. A 140-12 1074-156 903-78 876-65 349-09 986-43 237-12 342-11 450-187 677-133

  Read the article

• Emacs org-mode: how to avoid duplicate lines in agenda, when items is scheduled AND has deadline

  - by Martin

  Many of my TODO items in Emacs org-mode have a DEADLINE defined in the future (e. g. Friday) and are at the same time SCHEDULED today so that I already know I have to start working on this task. Then, this task will appear twice in my agenda. That's not nice but not necessarily a problem yet, but if then the task has assigned a time estimate for its duration and I go to column view with C-C C-X C-C to see how much time my tasks today will need, the time estimate for this task is counted twice, so e. g. if the time effort estimate is 2 hours, I'll have 4 hours in my daily agenda, as the item appears as well as scheduled today (or in the past) as also with its deadline in 3 days. How can I avoid counting an item twice?

  Read the article

• Backup all plesk MySQL Databases to individual files

  - by Michael

  Hy, Because I'm new to shell scripting I need a hand. I currently backup all mydatabases to a single file, thing that makes the restore preaty hard. The second problem that my MySQL password dosen't work because of a Plesk bug and i get the password from "/etc/psa/.psa.shadow". Here is the code that I use to backup all my databases to a single file. mysqldump -uadmin -p`cat /etc/psa/.psa.shadow` --all-databases | bzip2 -c > /root/21.10.2013.sql.bz2 I found some scripts on the web that backup each database to individual files but I don't know how to make them work for my situation. Here is a example script: for db in $(mysql -e 'show databases' -s --skip-column-names); do mysqldump $db | gzip > "/backups/mysqldump-$(hostname)-$db-$(date +%Y-%m-%d-%H.%M.%S).gz"; done Can someone help me make the script above work for my situation? Requirements: Backup each database to individual file using plesk password location.

  Read the article

• Sharepoint managed Properties

  - by paulie

  Originally posted on StackOverflow, and edited for clarity I have a custom Content Type inside a list that has over 30 items (Which were uploaded via DockIt), and I have added several "managed properties" to the "crawled properties", in the SSP. All of them work except 1. The column "Synopsis" is a multiline field with no limit on it's length. It appears as a crawled property "Synopsis", and is mapped to a managed property 'asynop'. On the 'Advanced Search Page', it is added as a property and searchable, however it only returns a some matching records (if any). I manually created an entry, ran the crawl and was able to search for it. I edited an existing entry, ran the crawl (full and incremental), and it still only returned the manually entered entry. If I entered the search term in the Search box directly "asynop:fatigue", then all the correct results appear. Why is this happening? And could it please stop?

  Read the article

• In Excel, how to group data by date, and then do operations on the data?

  - by Bicou

  Hi, I have Excel 2003. My data is like this: 01/10/2010 0.99 02/10/2010 1.49 02/10/2010 0.99 02/10/2010 0.99 02/10/2010 0.99 03/10/2010 1.49 03/10/2010 1.49 03/10/2010 0.99 etc. In fact it is a list of sales every day. I want to have something like this: 01/10/2010 0.99 02/10/2010 4.46 03/10/2010 3.97 I want to group by date, and sum the column B. I'd like to see the evolution of the sales over time, and display a nice graph about that. I have managed to create pivot tables that almost do the job: they list the number of 0.99 and 1.49 each day, but I can't find a way to simply sum everything and group by date. Thanks for reading.

  Read the article

< Previous Page | 269 270 271 272 273 274 275 276 277 278 279 280  | Next Page >