Search Results

Search found 29888 results on 1196 pages for 'line breaks'.

Page 316/1196 | < Previous Page | 312 313 314 315 316 317 318 319 320 321 322 323  | Next Page >

  • Decorator not calling the decorated instance - alternative design needed

    - by Daniel Hilgarth
    Assume I have a simple interface for translating text (sample code in C#): public interface ITranslationService { string GetTranslation(string key, CultureInfo targetLanguage); // some other methods... } A first simple implementation of this interface already exists and simply goes to the database for every method call. Assuming a UI that is being translated at start up this results in one database call per control. To improve this, I want to add the following behavior: As soon as a request for one language comes in, fetch all translations from this language and cache them. All translation requests are served from the cache. I thought about implementing this new behavior as a decorator, because all other methods of that interface implemented by the decorater would simple delegate to the decorated instance. However, the implementation of GetTranslation wouldn't use GetTranslation of the decorated instance at all to get all translations of a certain language. It would fire its own query against the database. This breaks the decorator pattern, because every functionality provided by the decorated instance is simply skipped. This becomes a real problem if there are other decorators involved. My understanding is that a Decorator should be additive. In this case however, the decorator is replacing the behavior of the decorated instance. I can't really think of a nice solution for this - how would you solve it? Everything is allowed, even a complete re-design of ITranslationService itself.

    Read the article

  • How to update entity states and animations in a component-based game

    - by mivic
    I'm trying to design a component-based entity system for learning purposes (and later use on some games) and I'm having some troubles when it comes to updating entity states. I don't want to have an update() method inside the Component to prevent dependencies between Components. What I currently have in mind is that components hold data and systems update components. So, if I have a simple 2D game with some entities (e.g. player, enemy1, enemy 2) that have Transform, Movement, State, Animation and Rendering components I think I should have: A MovementSystem that moves all the Movement components and updates the State components And a RenderSystem that updates the Animation components (the animation component should have one animation (i.e. a set of frames/textures) for each state and updating it means selecting the animation corresponding to the current state (e.g. jumping, moving_left, etc), and updating the frame index). Then, the RenderSystem updates the Render components with the texture corresponding to the current frame of each entity's Animation and renders everything on screen. I've seen some implementations like Artemis framework, but I don't know how to solve this situation: Let's say that my game has the following entities. Each entity have a set of states and one animation for each state: player: "idle", "moving_right", "jumping" enemy1: "moving_up", "moving_down" enemy2: "moving_left", "moving_right" What are the most accepted approaches in order to update the current state of each entity? The only thing that I can think of is having separate systems for each group of entities and separate State and Animation components so I would have PlayerState, PlayerAnimation, Enemy1State, Enemy1Animation... PlayerMovementSystem, PlayerRenderingSystem... but I think this is a bad solution and breaks the purpose of having a component-based system. As you can see, I'm quite lost here, so I'd very much appreciate any help.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • PerlRegEx vs RegularExpressionsCore Delphi Units

    - by Jan Goyvaerts
    The RegularExpressionsCore unit that is part of Delphi XE is based on the latest class-based PerlRegEx unit that I developed. Embarcadero only made a few changes to the unit. These changes are insignificant enough that code written for earlier versions of Delphi using the class-based PerlRegEx unit will work just the same with Delphi XE. The unit was renamed from PerlRegEx to RegularExpressionsCore. When migrating your code to Delphi XE, you can choose whether you want to use the new RegularExpressionsCore unit or continue using the PerlRegEx unit in your application. All you need to change is which unit you add to the uses clause in your own units. Indentation and line breaks in the code were changed to match the style used in the Delphi RTL and VCL code. This does not change the code, but makes it harder to diff the two units. Literal strings in the unit were separated into their own unit called RegularExpressionsConsts. These strings are only used for error messages that indicate bugs in your code. If your code uses TPerlRegEx correctly then the user should not see any of these strings. My code uses assertions to check for out of bounds parameters, while Embarcadero uses exceptions. Again, if you use TPerlRegEx correctly, you should never get any assertions or exceptions. The Compile method raises an exception if the regular expression is invalid in both my original TPerlRegEx component and Embarcadero’s version. If your code allows the user to provide the regular expression, you should explicitly call Compile and catch any exceptions it raises so you can tell the user there is a problem with the regular expression. Even with user-provided regular expressions, you shouldn’t get any other assertions or exceptions if your code is correct. Note that Embarcadero owns all the rights to their RegularExpressionsCore unit. Like all the other RTL and VCL units, this unit cannot be distributed by myself or anyone other than Embarcadero. I do retain the rights to my original PerlRegEx unit which I will continue to make available for those using older versions of Delphi.

    Read the article

  • How to treat your genius team-mate [closed]

    - by Shiplu
    I am soon going to be in a team where a very talented programmer works. Everyone int the company likes him as he knows a lot of thing and does a lot of programming. The PM and the CEO likes him a lot. I am his fan as a programmer. But as a team mate? I always try to avoid him. The reason is, in the very early days of our company our CEO used to choose both of us in a same team we worked together. Then I had many terrible experiences. Most of the time he is doing others work. When team leader breaks the work load and distributes it, He used to work more than a workday everyday and also doing my own work. The result was same duplicate code. He is not working my working finishing his own, he is doing it in the middle. how do you treat such team-mates.

    Read the article

  • Does Agile force developers to work more?

    - by Shooshpanchick
    Looking at common Agile practices it seems to me that they (intentionally or unintentionally?) force developer to spend more time actually working as opposed to reading blogs/articles, chatting, coffee breaks and just plain procrastinating. In particular: 1) Pair programming - the biggest work-forcer, just because it is inconvenient to do all that procrastination when there are two of you sitting together. 2) Short stories - when you have a HUGE chunk of work that must be done in e.g. a month, it is pretty common to slack off in the first three weeks and switch to OMG DEADLINE mode for the last one. And with the little chunks (that must be done in a day or less) it is exact opposite - you feel that time is tight, there is no space for maneuvering, and you will be held accountable for the task pretty soon, so you start working immediately. 3) Team communication and cohesion - when you underperform in a slow, distanced and silent environment it may feel ok, but when at the end of the day at Scrum meeting everyone boasts what they have accomplished and you have nothing to say you may actually feel ashamed. 4) Testing and feedback - again, it prevents you from keeping tasks "99% ready" (when it's actually around 20%) until the deadline suddenly happens. Do you feel that under Agile you work more than under "conventional" methodologies? Is this pressure compensated by the more comfortable environment and by the feeling of actually getting right things done quickly?

    Read the article

  • Ugly Boot Screen after upgrading to 12.10

    - by Sir Linuxalot
    Is there a way to change the ugly boot screen in 12.10? It seems to have rolled back to that 8-bit blocky looking thing with tiny orange dots underneath. It then breaks into process code under that, and it looks ghastly. I've read some tutorials on getting Plymouth to do some neat things, but they were for older versions of Ubuntu. I'm running a GeForce GTX 460 if that matters. Any help would be appreciated. Update: I've noticed/found a couple of things. The upgrade on my laptop didn't do this. It still uses the "normal" Ubuntu boot logo (using Plymouth, I assume). So, something is off with my desktop. And, I found and installed Super Boot Manager to see if that would help. With that, I enabled Plymouth and added a new theme, but the machine still boots with the block-ugly logo. Finally, I messed around with Grub on boot and added "nomodeset" after "quiet splash" and added it while deleting "quiet splash." None of these solutions worked. I'll keep hunting...

    Read the article

  • Simple Architecture Verification

    - by Jean Carlos Suárez Marranzini
    I just made an architecture for an application with the function of scoring, saving and loading tennis games. The architecture has 2 kinds of elements: components & layers. Components: Standalone elements that can be consumed by other components or by layers. They might also consume functionality from the model/bottom layer. Layers: Software components whose functionality rests on previous layers (except for the model layer). -Layers: -Models: Data and it's behavior. -Controllers: A layer that allows interaction between the views and the models. -Views: The presentation layer for interacting with the user. -Components: -Persistence: Makes sure the game data can be stored away for later retrieval. -Time Machine: Records changes in the game through time so it's possible to navigate the game back and forth. -Settings: Contains the settings that determine how some of the game logic will apply. -Game Engine: Contains all the game logic, which it applies to the game data to determine the path the game should take. This is an image of the architecture (I don't have enough rep to post images): http://i49.tinypic.com/35lt5a9.png The requierements which this architecture should satisfy are the following: Save & load games. Move through game history and see how the scoreboard changes as the game evolves. Tie-breaks must be properly managed. Games must be classified by hit-type. Every point can be modified. Match name and player names must be stored. Game logic must be configurable by the user. I would really appreciate any kind of advice or comments on this architecture. To see if it is well built and makes sense as a whole. I took the idea from this link. http://en.wikipedia.org/wiki/Model%E2%80%93view%E2%80%93controller

    Read the article

  • Defining a function that is both a generator and recursive [on hold]

    - by user96454
    I am new to python, so this code might not necessarily be clean, it's just for learning purposes. I had the idea of writing this function that would display the tree down the specified path. Then, i added the global variable number_of_py to count how many python files were in that tree. That worked as well. Finally, i decided to turn the whole thing into a generator, but the recursion breaks. My understanding of generators is that once next() is called python just executes the body of the function and "yields" a value until we hit the end of the body. Can someone explain why this doesn't work? Thanks. import os from sys import argv script, path = argv number_of_py = 0 lines_of_code = 0 def list_files(directory, key=''): global number_of_py files = os.listdir(directory) for f in files: real_path = os.path.join(directory, f) if os.path.isdir(real_path): list_files(real_path, key=key+' ') else: if real_path.split('.')[-1] == 'py': number_of_py += 1 with open(real_path) as g: yield len(g.read()) print key+real_path for i in list_files(argv[1]): lines_of_code += i print 'total number of lines of code: %d' % lines_of_code print 'total number of py files: %d' % number_of_py

    Read the article

  • TDD: Write a separate test for object initialization or relying on other tests exercising it

    - by DXM
    This seems to be the common pattern that's emerging in some of the tests I've worked on lately. We have a class, and quite often this is legacy code whose design can't be easily altered, which has a bunch of member variables. There's some kind of "Initialize" or "Load" function which would put an object into a valid state. Only after it is initialized/loaded, are the members in the proper state so that other methods can be exercised. So when we start writing tests, first test is "TestLoad" and all we put in there is exercising initialization logic. Then we might add one (or few) TestLoadFailureXXX tests and those are definitely valuable. Then we start writing tests to verify other behaviors but all of them require the object to be loaded. So they all start by running exactly the same code as "TestLoad". So my question: Is TestLoad even necessary? Do you take it and let other tests simply exercise the loading? Or leave it so things are more explicit? I know that each unit test function should have no (or as little as possible) overlap with other test functions, but it seems like in cases of loading, this is unavoidable. And whether we like it or not, if something in the loading code breaks, we will end up with a whole test suite of failures. Is there another approach that I might be missing here? Thank you for the responses. It definitely makes sense that you want to see "InitializationTest" and if that fails you know where to start looking. In case it matters, this question is mostly about C++ and we use CppUnit framework. And now, thanks to sleske, I'll be constantly wishing that CppUnit supported test dependencies. Might have to hack something in one of these days :)

    Read the article

  • Code base migration - old versioning system to modern

    - by JohnP
    Our current code base is contained in a versioning system that is old and outdated (Visual Sourcesafe 5.0, mid 1990's), and contains a mix of packages that are no longer used, ones that are being used but no longer updated, and newer code. It is also a mix of 4 languages, and includes libraries for some of our systems (Such as Dialogic, Sun Tzu {clipper}) implementations. This breaks down into the following categories: Legacy code - No longer used (Systems that have been retired or replaced, etc) Legacy code - In current use (No intentions for upgrades or minor bug fixes, only major fixes if needed) Current code - In current use, and will be used for future versions/development Support libraries - For both legacy and current code (Some of the legacy libraries are no longer available as well) We would like to migrate this to a newer versioning system as we will be adding more developers, and expanding the reach to include remote programmers. When migrating, how do you structure it? Do you just perform a dump of all the data and then import it into the new system, or do you segregate according to type before you bring it into the new system? Do you set up a separate area for libraries, or keep them with the relevant packages? Do you separate by language, system, both? A general outline and methodology is fine, it doesn't need to be broken down to individual program level.

    Read the article

  • Algorithmic problem - quickly finding all #'s where value %x is some given value

    - by Steve B.
    Problem I'm trying to solve, apologies in advance for the length: Given a large number of stored records, each with a unique (String) field S. I'd like to be able to find through an indexed query all records where Hash(S) % N == K for any arbitrary N, K (e.g. given a million strings, find all strings where HashCode(s) % 17 = 5. Is there some way of memoizing this so that we can quickly answer any question of this form without doing the % on every value? The motivation for this is a system of N distributed nodes, where each record has to be assigned to at least one node. The nodes are numbered 0 - (K-1) , and each node has to load up all of the records that match it's number: If we have 3 nodes Node 0 loads all records where Hash % 3 ==0 Node 1 loads all records where Hash % 3 ==1 Node 2 loads all records where Hash % 3 ==2 adding a 4th node, obviously all the assignments have to be recomputed - Node 0 loads all records where Hash % 4 ==0 ... etc I'd like to easily find these records through an indexed query without having to compute the mod individually. The best I've been able to come up with so far: If we take the prime factors of N (p1 * p2 * ... ) if N % M == I then p % M == I % p for all of N's prime factors e.g. 10 nodes : N % 10 == 6 then N % 2 = 0 == 6 %2 N % 5 = 1 == 6 %5 so storing an array of the "%" of N for the first "reasonable" number of primes for my data set should be helpful. For example in the above example we store the hash and the primes HASH PRIMES (array of %2, %3, %5, %7, ... ]) 16 [0 1 1 2 .. ] so looking for N%10 == 6 is equivalent to looking for all values where array[1]==1 and array[2] == 1. However, this breaks at the first prime larger than the highest number I'm storing in the factor table. Is there a better way?

    Read the article

  • Problems syncing photos and strange effects of uploaded files from other devices

    - by Daniel
    I have a Galaxy Spica (GT-i5700) Android v2.1, rooted with Leshak dev 7 #123. But never mind the root info, the problem would be the same unrooted. The photos from this phone is stored in "sdcard/images", nevertheless the phone also creates a "sdcard/DCIM" but only stores some thumbnails there. Problem nr 1: U1 only reads the DCIM-folder for automatic photo-upload. So photos stored in this phone is not uploaded. If I move photos to "DCIM" folder, U1 recognises the photos and start uploading them. Possible solution: Could there be an option in the settings, to set preferred photo folder? Problem nr 2: Out of 74 pictures, 12 did not get uploaded. Pressing "Retry failed transfers" in Settings does nothing. Pressing the files where status is "Upload failed, tap to retry" only changes the status to "Uploading..." but nothing gets uploaded. If I upload another file to U1, it is uploaded directly without any problem. It has nothing to do with file size, 1,1 MB files has been uploaded fine whilst some failed are 0,8 MB. Problem nr 3: The photos from DCIM are in my case uploaded to a folder called "Pictures - GT-I5700" in U1. If I log in to the homepage and from there upload another photo in "Pictures - GT-I5700", it shows up in U1 on my phone fine. But when I tap it, U1 downloads the photo to "sdcard/U1/Pictures - GT-I5700". If it sync photos from "sdcard/DCIM" to a specific folder, why not also download files to the same folder from which it is synced? After a while of usage, syncing and uploading files from different clients it would be a mishmash of folders and places files are stored and considering that I see no use of U1 at all. Another question: If my SD card in some way breaks down/some folders cannot be read/card temporarly changed and U1 is running, does U1 consider that as files deleted and also delete from the cloud?

    Read the article

  • Languages with a clear distinction between subroutines that are purely functional, mutating, state-changing, etc?

    - by CPX
    Lately I've become more and more frustrated that in most modern programming languages I've worked with (C/C++, C#, F#, Ruby, Python, JS and more) there is very little, if any, language support for determining what a subroutine will actually do. Consider the following simple pseudo-code: var x = DoSomethingWith(y); How do I determine what the call to DoSomethingWith(y) will actually do? Will it mutate y, or will it return a copy of y? Does it depend on global or local state, or is it only dependent on y? Will it change the global or local state? How does closure affect the outcome of the call? In all languages I've encountered, almost none of these questions can be answered by merely looking at the signature of the subroutine, and there is almost never any compile-time or run-time support either. Usually, the only way is to put your trust in the author of the API, and hope that the documentation and/or naming conventions reveal what the subroutine will actually do. My question is this: Does there exist any languages today that make symbolic distinctions between these types of scenarios, and places compile-time constraints on what code you can actually write? (There is of course some support for this in most modern languages, such as different levels of scope and closure, the separation between static and instance code, lambda functions, et cetera. But too often these seem to come into conflict with each other. For instance, a lambda function will usually either be purely functional, and simply return a value based on input parameters, or mutate the input parameters in some way. But it is usually possible to access static variables from a lambda function, which in turn can give you access to instance variables, and then it all breaks apart.)

    Read the article

  • Java Box Class: Unsolvable: aligning components to the left or right

    - by user323186
    I have been trying to left align buttons contained in a Box to the left, with no success. They align left alright, but for some reason dont shift all the way left as one would imagine. I attach the code below. Please try compiling it and see for yourself. Seems bizarre to me. Thanks, Eric import java.awt.Dimension; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.io.BufferedReader; import java.io.File; import java.io.FileNotFoundException; import java.io.FileReader; import java.io.IOException; import javax.swing.Box; import javax.swing.BoxLayout; import javax.swing.JButton; import javax.swing.JFileChooser; import javax.swing.JFrame; import javax.swing.JMenu; import javax.swing.JMenuBar; import javax.swing.JMenuItem; import javax.swing.JScrollPane; import javax.swing.JTextArea; public class MainGUI extends Box implements ActionListener{ //Create GUI Components Box centerGUI=new Box(BoxLayout.X_AXIS); Box bottomGUI=new Box(BoxLayout.X_AXIS); //centerGUI subcomponents JTextArea left=new JTextArea(), right=new JTextArea(); JScrollPane leftScrollPane = new JScrollPane(left), rightScrollPane = new JScrollPane(right); //bottomGUI subcomponents JButton encrypt=new JButton("Encrypt"), decrypt=new JButton("Decrypt"), close=new JButton("Close"), info=new JButton("Info"); //Create Menubar components JMenuBar menubar=new JMenuBar(); JMenu fileMenu=new JMenu("File"); JMenuItem open=new JMenuItem("Open"), save=new JMenuItem("Save"), exit=new JMenuItem("Exit"); int returnVal =0; public MainGUI(){ super(BoxLayout.Y_AXIS); initCenterGUI(); initBottomGUI(); initFileMenu(); add(centerGUI); add(bottomGUI); addActionListeners(); } private void addActionListeners() { open.addActionListener(this); save.addActionListener(this); exit.addActionListener(this); encrypt.addActionListener(this); decrypt.addActionListener(this); close.addActionListener(this); info.addActionListener(this); } private void initFileMenu() { fileMenu.add(open); fileMenu.add(save); fileMenu.add(exit); menubar.add(fileMenu); } public void initCenterGUI(){ centerGUI.add(leftScrollPane); centerGUI.add(rightScrollPane); } public void initBottomGUI(){ bottomGUI.setAlignmentX(LEFT_ALIGNMENT); //setBorder(BorderFactory.createLineBorder(Color.BLACK)); bottomGUI.add(encrypt); bottomGUI.add(decrypt); bottomGUI.add(close); bottomGUI.add(info); } @Override public void actionPerformed(ActionEvent arg0) { // find source of the action Object source=arg0.getSource(); //if action is of such a type do the corresponding action if(source==close){ kill(); } else if(source==open){ //CHOOSE FILE File file1 =chooseFile(); String input1=readToString(file1); System.out.println(input1); left.setText(input1); } else if(source==decrypt){ //decrypt everything in Right Panel and output in left panel decrypt(); } else if(source==encrypt){ //encrypt everything in left panel and output in right panel encrypt(); } else if(source==info){ //show contents of info file in right panel doInfo(); } else { System.out.println("Error"); //throw new UnimplementedActionException(); } } private void doInfo() { // TODO Auto-generated method stub } private void encrypt() { // TODO Auto-generated method stub } private void decrypt() { // TODO Auto-generated method stub } private String readToString(File file) { FileReader fr = null; try { fr = new FileReader(file); } catch (FileNotFoundException e1) { e1.printStackTrace(); } BufferedReader br=new BufferedReader(fr); String line = null; try { line = br.readLine(); } catch (IOException e) { e.printStackTrace(); } String input=""; while(line!=null){ input=input+"\n"+line; try { line=br.readLine(); } catch (IOException e) { e.printStackTrace(); } } return input; } private File chooseFile() { //Create a file chooser final JFileChooser fc = new JFileChooser(); returnVal = fc.showOpenDialog(fc); return fc.getSelectedFile(); } private void kill() { System.exit(0); } public static void main(String[] args) { // TODO Auto-generated method stub MainGUI test=new MainGUI(); JFrame f=new JFrame("Tester"); f.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); f.setJMenuBar(test.menubar); f.setPreferredSize(new Dimension(600,400)); //f.setUndecorated(true); f.add(test); f.pack(); f.setVisible(true); } }

    Read the article

  • XNA on the TechNet Wiki

    - by Michael B. McLaughlin
    Many months ago I came across an interesting Microsoft website, the TechNet Wiki, when I was looking for information about something that I can’t even remember anymore. I noticed at the time that its section on gaming technologies was sparse and even exchanged a few emails with one of the friendly Microsoft employees who contributes there regularly about some ideas I had for the site. I seem to recall mentioning my intentions to add some articles on XNA when I found the time but between one thing and another it seemed like I was busy from the end of last Summer straight through ‘til now. Yesterday I came across the TechNet Wiki link in my miscellaneous links collection and remembered my intentions many months ago. I decided that adding XNA pages to it would make a nice project to work on while taking breaks from my other projects. So I wrote my first two articles for it: XNA Framework Overview and Content Pipeline Overview. I hope to add more in the coming days and weeks. I’d be delighted if some of my fellow XNA enthusiasts out there joined in, time permitting. Anyone else who’d like to add a page or two on a topic area you’re familiar with, this seems like a great opportunity to contribute to the community and help build a nice knowledge base to benefit all of us who are always interested in learning something new!

    Read the article

  • Versioning APIs

    - by Sharon
    Suppose that you have a large project supported by an API base. The project also ships a public API that end(ish) users can use. Sometimes you need to make changes to the API base that supports your project. For example, you need to add a feature that needs an API change, a new method, or requires altering of one of the objects, or the format of one of those objects, passed to or from the API. Assuming that you are also using these objects in your public API, the public objects will also change any time you do this, which is undesirable as your clients may rely on the API objects remaining identical for their parsing code to work. (cough C++ WSDL clients...) So one potential solution is to version the API. But when we say "version" the API, it sounds like this also must mean to version the API objects as well as well as providing duplicate method calls for each changed method signature. So I would then have a plain old clr object for each version of my api, which again seems undesirable. And even if I do this, I surely won't be building each object from scratch as that would end up with vast amounts of duplicated code. Rather, the API is likely to extend the private objects we are using for our base API, but then we run into the same problem because added properties would also be available in the public API when they are not supposed to be. So what is some sanity that is usually applied to this situation? I know many public services such as Git for Windows maintains a versioned API, but I'm having trouble imagining an architecture that supports this without vast amounts of duplicate code covering the various versioned methods and input/output objects. I'm aware that processes such as semantic versioning attempt to put some sanity on when public API breaks should occur. The problem is more that it seems like many or most changes require breaking the public API if the objects aren't more separated, but I don't see a good way to do that without duplicating code.

    Read the article

  • What did Rich Hickey mean when he said, "All that specificity [of interfaces/classes/types] kills your reuse!"

    - by GlenPeterson
    In Rich Hickey's thought-provoking goto conference keynote "The Value of Values" at 29 minutes he's talking about the overhead of a language like Java and makes a statement like, "All those interfaces kill your reuse." What does he mean? Is that true? In my search for answers, I have run across: The Principle of Least Knowledge AKA The Law of Demeter which encourages airtight API interfaces. Wikipedia also lists some disadvantages. Kevlin Henney's Imperial Clothing Crisis which argues that use, not reuse is the appropriate goal. Jack Diederich's "Stop Writing Classes" talk which argues against over-engineering in general. Clearly, anything written badly enough will be useless. But how would the interface of a well-written API prevent that code from being used? There are examples throughout history of something made for one purpose being used more for something else. But in the software world, if you use something for a purpose it wasn't intended for, it usually breaks. I'm looking for one good example of a good interface preventing a legitimate but unintended use of some code. Does that exist? I can't picture it.

    Read the article

  • CodeStock 2012 Review: Eric Landes( @ericlandes ) - Automated Tests in to automated Builds! How to put the right type of automated tests in to the right automated builds.

    Automated Tests in to automated Builds! How to put the right type of automated tests in to the right automated builds.Speaker: Eric LandesTwitter: @ericlandesBlog: http://ericlandes.com/ This was one of the first sessions I attended during CodeStock 2012. Eric’s talk focused mostly on unit testing, and that the lack of proper unit testing can be compared to stealing from an employer. His point was that if you’re not doing proper unit testing then all of the time wasted on fixing issues that could have been detected with unit tests is like stealing money from employer. He makes the assumption that that time spent on fixing these issues could have been better spent developing new features that drive the business. To a point I can agree with Eric’s argument regarding unit testing and stealing from a company’s perspective. I can see how he relates resources being shifted from new development to bug fixes as stealing based on the fact that the resources used to fix bugs are directly taken from other projects. He also states that Boring/Redundant and Build/Test tasks should be automated because it reduces the changes of errors and frees up developer to do what they do best, DEVELOP! When he refers to testing, he breaks testing down in to four distinct types. Unit Test Acceptance Test (This also includes Integration Tests) Performance Test UI Test With this he also recommends that developers should not go buck wild striving for 100% code coverage because some test my not provide a great return on investment. In his experience he recommends that 70% test coverage was a very acceptable rate.

    Read the article

  • C++: calling non-member functions with the same syntax of member ones

    - by peoro
    One thing I'd like to do in C++ is to call non-member functions with the same syntax you call member functions: class A { }; void f( A & this ) { /* ... */ } // ... A a; a.f(); // this is the same as f(a); Of course this could only work as long as f is not virtual (since it cannot appear in A's virtual table. f doesn't need to access A's non-public members. f doesn't conflict with a function declared in A (A::f). I'd like such a syntax because in my opinion it would be quite comfortable and would push good habits: calling str.strip() on a std::string (where strip is a function defined by the user) would sound a lot better than calling strip( str );. most of the times (always?) classes provide some member functions which don't require to be member (ie: are not virtual and don't use non-public members). This breaks encapsulation, but is the most practical thing to do (due to point 1). My question here is: what do you think of such feature? Do you think it would be something nice, or something that would introduce more issues than the ones it aims to solve? Could it make sense to propose such a feature to the next standard (the one after C++0x)? Of course this is just a brief description of this idea; it is not complete; we'd probably need to explicitly mark a function with a special keyword to let it work like this and many other stuff.

    Read the article

  • Partner Webcast - Oracle Business Process Management: What’s new in Oracle BPM 11.1.1.7.0 - 04 July 2013

    - by Thanos
    Business processes are at the heart of what makes or breaks a business—and what differentiates it from the competition. Business processes that deliver operational efficiency, business visibility, excellent customer experience, and agility give the enterprise an edge over the competition. Business managers need process management tools that enable them to make impactful changes. Oracle has been always a leader in this area and the new version of Oracle BPM 11g takes that even further by providing complete web based process modeling, simulation and implementation including designing the user interface and business logic. That provides business users with ability to take complete control over the business processes without sacrificing the vast service integration capabilities delivered traditionally by IT using SOA approach. Oracle Business Process Management is the industry's most complete and business user-friendly BPM solution. Register today for this webcast and find out more on the latest and most exciting new features which are now available in Oracle BPM Suite. Agenda Introduction do Oracle BPM 11g Exciting new features in this release Revamped Process Composer Simulations Web Forms Process Player Adaptive Case Management Instance Revisioning Other features Demonstration Q&A Delivery Format This FREE online LIVE eSeminar will be delivered over the Web. Registrations received less than 24hours prior to start time may not receive confirmation to attend. Duration: 1 hour Register Now! For any questions please contact us at [email protected] Visit our ISV Migration Center blog & Facebook Page or Follow us @oracleimc  to learn more on Oracle Technologies, upcoming partner webcasts and events. Existing content available YouTube - SlideShare - Oracle Mix

    Read the article

  • How can I get SLI working with 295.40?

    - by Steve
    I've been doing a lot of googling these last few hours and I'm not having much luck. Perhaps I don't know exactly what I am looking for. I just recently installed Ubuntu 12.04LTS x86_64. Looks beautiful! I have two GTX470's in SLI, and I am finally migrating my desktop over given the hopeful gaming support as of late. My laptop has been enjoying multiple distros of Ubuntu for a couple years now. However, new problems come with unexplored territory, here. At first, I only had one working monitor of my two. Over on nvidia-xconfig I fixed that, but the only solution that actually worked was twinview. Just recently I read here that twinview is not compatible with SLI. Sweet. When I try to tell it, oh hey, use a separate XScreen, configure it the way I want it, click save to configuration file, enter my password, then a sudo restart lightdm, it's broken. One screen blacks or whites out (Couldn't tell you the specific conditions for each, I'm dubious at this point,) and I get this huge error dialogue box upon login. Something about incompatible resolutions if I remember right. Though I am sure I set the resolutions for each screen correctly. Anyway, when I try to enable SLI (sudo nvidia-xconfig --sli=On) despite the fact it hates twinview, unity breaks. The sidebar is there, but only one screen works, the mouse is trapped running along the left edge of it, and the background of the sidebar is a solid blue. Anyway, this ended up being entirely too verbose, I'm sorry, but could anyone part some wisdom please? It would be appreciated!

    Read the article

  • Need efficient way to keep enemy from getting hit multiple times by same source

    - by TenFour04
    My game's a simple 2D one, but this probably applies to many types of scenarios. Suppose my player has a sword, or a gun that shoots a projectile that can pass through and hit multiple enemies. While the sword is swinging, there is a duration where I am checking for the sword making contact with any enemy on every frame. But once an enemy is hit by that sword, I don't want him to continue getting hit over and over as the sword follows through. (I do want the sword to continue checking whether it is hitting other enemies.) I've thought of a couple different approaches (below), but they don't seem like good ones to me. I'm looking for a way that doesn't force cross-referencing (I don't want the enemy to have to send a message back to the sword/projectile). And I'd like to avoid generating/resetting multiple array lists with every attack. Each time the sword swings it generates a unique id (maybe by just incrementing a global static long). Every enemy keeps a list of id's of swipes or projectiles that have already hit them, so the enemy knows not to get hurt by something multiple times. Downside is that every enemy may have a big list to compare to. So projectiles and sword swipes would have to broadcast their end-of-life to all enemies and cause a search and remove on every enemy's array list. Seems kind of slow. Each sword swipe or projectile keeps its own list of enemies that it has already hit so it knows not to apply damage. Downsides: Have to generate a new list (probably pull from a pool and clear one) every time a sword is swung or a projectile shot. Also, this breaks down modularity, because now the sword has to send a message to the enemy, and the enemy has to send a message back to the sword. Seems to me that two-way streets like this are a great way to create very difficult-to-find bugs.

    Read the article

  • Error while installing an application

    - by Bong.Da.City
    So i have installed synaptic package manager.. via it, i have checked once libopencv-highgui-dev and applied complete removal.. after that i installed it... now everytime i try to install an application e.g Format Junkie sudo add-apt-repository ppa:format-junkie-team/release && sudo apt-get update && sudo apt-get install formatjunkie in the command install format junkie it gives me that error everytime: sudo apt-get install formatjunkie Reading package lists... Done Building dependency tree Reading state information... Done Some packages could not be installed. This may mean that you have requested an impossible situation or if you are using the unstable distribution that some required packages have not yet been created or been moved out of Incoming. The following information may help to resolve the situation: The following packages have unmet dependencies: libopencv-features2d-dev : Depends: libopencv-highgui-dev (= 2.3.1-11ubuntu2) but it is not going to be installed E: Error, pkgProblemResolver::Resolve generated breaks, this may be caused by held packages. What should i do? And 2nd what did i did wrong so it won't happen another time? output of lsb_release -a No LSB modules are available. Distributor ID: Ubuntu Description: Ubuntu 12.10 Release: 12.10 Codename: quantal

    Read the article

  • Successful Fusion CRM Bootcamp in Paris - July 24-24th

    - by Richard Lefebvre
    The first Fusion CRM Bootcamp for EMEA partners successfully took place in the Paris Pullmann Bercy hotel on July 24-26th. The agenda covered 14 Fusion CRM topics in depth, including detailed presentations and hands-on exercises, delivered by a team of Fusion CRM experts from Oracle Product Development. 89 participants represented 55 companies from 14 different countries, attended this event which was also a great opportunity to network with Oracle Product Development and Alliances & Channels executives during the breaks and the "Fusion Lounge" session each day after the training. As expressed by the participants in the event survey, the overall satisfaction reached to an impressive percentage of 85+ with the response of “met or exceeded the expectations” and with individual comments such as: On top of the presentation of Fusion CRM as a product, this event allowed to better understand Oracle's product and rollout strategy. The ability to meet the development team was really a bonus. Extremely valuable information given that enables integrators to go on the road of Fusion CRM Excellent organization, good product information coverage and demonstration Additional Fusion CRM bootcamps are planed across EMEA in the next quarters, although they will probably be under a different format which is still to be defined.

    Read the article

< Previous Page | 312 313 314 315 316 317 318 319 320 321 322 323  | Next Page >