Search Results

Search found 6686 results on 268 pages for 'catch'.

Page 36/268 | < Previous Page | 32 33 34 35 36 37 38 39 40 41 42 43  | Next Page >

  • threaded serial port IOException when writing

    - by John McDonald
    Hi, I'm trying to write a small application that simply reads data from a socket, extracts some information (two integers) from the data and sends the extracted information off on a serial port. The idea is that it should start and just keep going. In short, it works, but not for long. After a consistently short period I start to receive IOExceptions and socket receive buffer is swamped. The thread framework has been taken from the MSDN serial port example. The delay in send(), readThread.Join(), is an effort to delay read() in order to allow serial port interrupt processing a chance to occur, but I think I've misinterpreted the join function. I either need to sync the processes more effectively or throw some data away as it comes in off the socket, which would be fine. The integer data is controlling a pan tilt unit and I'm sure four times a second would be acceptable, but not sure on how to best acheive either, any ideas would be greatly appreciated, cheers. using System; using System.Collections.Generic; using System.Text; using System.IO.Ports; using System.Threading; using System.Net; using System.Net.Sockets; using System.IO; namespace ConsoleApplication1 { class Program { static bool _continue; static SerialPort _serialPort; static Thread readThread; static Thread sendThread; static String sendString; static Socket s; static int byteCount; static Byte[] bytesReceived; // synchronise send and receive threads static bool dataReceived; const int FIONREAD = 0x4004667F; static void Main(string[] args) { dataReceived = false; readThread = new Thread(Read); sendThread = new Thread(Send); bytesReceived = new Byte[16384]; // Create a new SerialPort object with default settings. _serialPort = new SerialPort("COM4", 38400, Parity.None, 8, StopBits.One); // Set the read/write timeouts _serialPort.WriteTimeout = 500; _serialPort.Open(); string moveMode = "CV "; _serialPort.WriteLine(moveMode); s = null; IPHostEntry hostEntry = Dns.GetHostEntry("localhost"); foreach (IPAddress address in hostEntry.AddressList) { IPEndPoint ipe = new IPEndPoint(address, 10001); Socket tempSocket = new Socket(ipe.AddressFamily, SocketType.Stream, ProtocolType.Tcp); tempSocket.Connect(ipe); if (tempSocket.Connected) { s = tempSocket; s.ReceiveBufferSize = 16384; break; } else { continue; } } readThread.Start(); sendThread.Start(); while (_continue) { Thread.Sleep(10); ;// Console.WriteLine("main..."); } readThread.Join(); _serialPort.Close(); s.Close(); } public static void Read() { while (_continue) { try { //Console.WriteLine("Read"); if (!dataReceived) { byte[] outValue = BitConverter.GetBytes(0); // Check how many bytes have been received. s.IOControl(FIONREAD, null, outValue); uint bytesAvailable = BitConverter.ToUInt32(outValue, 0); if (bytesAvailable > 0) { Console.WriteLine("Read thread..." + bytesAvailable); byteCount = s.Receive(bytesReceived); string str = Encoding.ASCII.GetString(bytesReceived); //str = Encoding::UTF8->GetString( bytesReceived ); string[] split = str.Split(new Char[] { '\t', '\r', '\n' }); string filteredX = (split.GetValue(7)).ToString(); string filteredY = (split.GetValue(8)).ToString(); string[] AzSplit = filteredX.Split(new Char[] { '.' }); filteredX = (AzSplit.GetValue(0)).ToString(); string[] ElSplit = filteredY.Split(new Char[] { '.' }); filteredY = (ElSplit.GetValue(0)).ToString(); // scale values int x = (int)(Convert.ToInt32(filteredX) * 1.9); string scaledAz = x.ToString(); int y = (int)(Convert.ToInt32(filteredY) * 1.9); string scaledEl = y.ToString(); String moveAz = "PS" + scaledAz + " "; String moveEl = "TS" + scaledEl + " "; sendString = moveAz + moveEl; dataReceived = true; } } } catch (TimeoutException) {Console.WriteLine("timeout exception");} catch (NullReferenceException) {Console.WriteLine("Read NULL reference exception");} } } public static void Send() { while (_continue) { try { if (dataReceived) { // sleep Read() thread to allow serial port interrupt processing readThread.Join(100); // send command to PTU dataReceived = false; Console.WriteLine(sendString); _serialPort.WriteLine(sendString); } } catch (TimeoutException) { Console.WriteLine("Timeout exception"); } catch (IOException) { Console.WriteLine("IOException exception"); } catch (NullReferenceException) { Console.WriteLine("Send NULL reference exception"); } } } } }

    Read the article

  • How to Upload a file from client to server using OFBIZ?

    - by SIVAKUMAR.J
    I'm new to ofbiz so try to keep your answer as simple as possibly. If you can give examples that would be kind. My problem is I created a project inside the ofbiz/hot-deploy folder namely productionmgntSystem. Inside the folder ofbiz\hot-deploy\productionmgntSystem\webapp\productionmgntSystem I created a file app_details_1.ftl. The following are the code of this file <html> <head> <meta http-equiv="Content-Type" content="text/html; charset=ISO-8859-1"> <title>Insert title here</title> <script TYPE="TEXT/JAVASCRIPT" language=""JAVASCRIPT"> function uploadFile() { //alert("Before calling upload.jsp"); window.location='<@ofbizUrl>testing_service1</@ofbizUrl>' } </script> </head> <!-- <form action="<@ofbizUrl>testing_service1</@ofbizUrl>" enctype="multipart/form-data" name="app_details_frm"> --> <form action="<@ofbizUrl>logout1</@ofbizUrl>" enctype="multipart/form-data" name="app_details_frm"> <center style="height: 299px; "> <table border="0" style="height: 177px; width: 788px"> <tr style="height: 115px; "> <td style="width: 103px; "> <td style="width: 413px; "><h1>APPLICATION DETAILS</h1> <td style="width: 55px; "> </tr> <tr> <td style="width: 125px; ">Application name : </td> <td> <input name="app_name_txt" id="txt_1" value=" " /> </td> </tr> <tr> <td style="width: 125px; ">Excell sheet &nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;&nbsp;: </td> <td> <input type="file" name="filename"/> </td> </tr> <tr> <td> <!-- <input type="button" name="logout1_cmd" value="Logout" onclick="logout1()"/> --> <input type="submit" name="logout_cmd" value="logout"/> </td> <td> <!-- <input type="submit" name="upload_cmd" value="Submit" /> --> <input type="button" name="upload1_cmd" value="Upload" onclick="uploadFile()"/> </td> </tr> </table> </center> </form> </html> the following coding is present in the file ofbiz\hot-deploy\productionmgntSystem\webapp\productionmgntSystem\WEB-INF\controller.xml ...... ....... ........ <request-map uri="testing_service1"> <security https="true" auth="true"/> <event type="java" path="org.ofbiz.productionmgntSystem.web_app_req.WebServices1" invoke="testingService"/> <response name="ok" type="view" value="ok_view"/> <response name="exception" type="view" value="exception_view"/> </request-map> .......... ............ .......... <view-map name="ok_view" type="ftl" page="ok_view.ftl"/> <view-map name="exception_view" type="ftl" page="exception_view.ftl"/> ................ ............. ............. The following are the coding present in the file ofbiz\hot-deploy\productionmgntSystem\src\org\ofbiz\productionmgntSystem\web_app_req\WebServices1.java package org.ofbiz.productionmgntSystem.web_app_req; import javax.servlet.http.HttpServletRequest; import javax.servlet.http.HttpServletResponse; import java.io.DataInputStream; import java.io.FileOutputStream; import java.io.IOException; public class WebServices1 { public static String testingService(HttpServletRequest request, HttpServletResponse response) { //int i=0; String result="ok"; System.out.println("\n\n\t*************************************\n\tInside WebServices1.testingService(HttpServletRequest request, HttpServletResponse response)- Start"); String contentType=request.getContentType(); System.out.println("\n\n\t*************************************\n\tInside WebServices1.testingService(HttpServletRequest request, HttpServletResponse response)- contentType : "+contentType); String str=new String(); // response.setContentType("text/html"); //PrintWriter writer; if ((contentType != null) && (contentType.indexOf("multipart/form-data") >= 0)) { System.out.println("\n\n\t**********************************\n\tInside WebServices1.testingService(HttpServletRequest request, HttpServletResponse response) after if (contentType != null)"); try { // writer=response.getWriter(); System.out.println("\n\n\t**********************************\n\tInside WebServices1.testingService(HttpServletRequest request, HttpServletResponse response) - try Start"); DataInputStream in = new DataInputStream(request.getInputStream()); int formDataLength = request.getContentLength(); byte dataBytes[] = new byte[formDataLength]; int byteRead = 0; int totalBytesRead = 0; //this loop converting the uploaded file into byte code while (totalBytesRead < formDataLength) { byteRead = in.read(dataBytes, totalBytesRead,formDataLength); totalBytesRead += byteRead; } String file = new String(dataBytes); //for saving the file name String saveFile = file.substring(file.indexOf("filename=\"") + 10); saveFile = saveFile.substring(0, saveFile.indexOf("\n")); saveFile = saveFile.substring(saveFile.lastIndexOf("\\")+ 1,saveFile.indexOf("\"")); int lastIndex = contentType.lastIndexOf("="); String boundary = contentType.substring(lastIndex + 1,contentType.length()); int pos; //extracting the index of file pos = file.indexOf("filename=\""); pos = file.indexOf("\n", pos) + 1; pos = file.indexOf("\n", pos) + 1; pos = file.indexOf("\n", pos) + 1; int boundaryLocation = file.indexOf(boundary, pos) - 4; int startPos = ((file.substring(0, pos)).getBytes()).length; int endPos = ((file.substring(0, boundaryLocation)).getBytes()).length; //creating a new file with the same name and writing the content in new file FileOutputStream fileOut = new FileOutputStream("/"+saveFile); fileOut.write(dataBytes, startPos, (endPos - startPos)); fileOut.flush(); fileOut.close(); System.out.println("\n\n\t**********************************\n\tInside WebServices1.testingService(HttpServletRequest request, HttpServletResponse response) - try End"); } catch(IOException ioe) { System.out.println("\n\n\t*********************************\n\tInside WebServices1.testingService(HttpServletRequest request, HttpServletResponse response) - Catch IOException"); //ioe.printStackTrace(); return("exception"); } catch(Exception ex) { System.out.println("\n\n\t*********************************\n\tInside WebServices1.testingService(HttpServletRequest request, HttpServletResponse response) - Catch Exception"); return("exception"); } } else { System.out.println("\n\n\t********************************\n\tInside WebServices1.testingService(HttpServletRequest request, HttpServletResponse response) else part"); result="exception"; } System.out.println("\n\n\t*************************************\n\tInside WebServices1.testingService(HttpServletRequest request, HttpServletResponse response)- End"); return(result); } } I want to upload a file to the server. The file is get from user " tag in the "app_details_1.ftl" file & it is updated into the server by using the method "testingService(HttpServletRequest request, HttpServletResponse response)" in the class "WebServices1". But the file is not uploaded. Give me a good solution for uploading a file to the server.

    Read the article

  • Why It Is So Important to Know Your Customer

    - by Christie Flanagan
    Over the years, I endured enough delayed flights, air turbulence and misadventures in airport security clearance to watch my expectations for the air travel experience fall to abysmally low levels. The extent of my loyalty to any one carrier had more to do with the proximity of the airport parking garage to their particular gate than to any effort on the airline’s part to actually earn and retain my business. That all changed one day when I found myself at the airport hoping to catch a return flight home a few hours earlier than expected, using an airline I had flown with for the first time just that week.  When you travel regularly for business, being able to catch a return flight home that’s even an hour or two earlier than originally scheduled is a big deal. It can mean the difference between having a normal evening with your family and having to sneak in like a cat burglar after everyone is fast asleep. And so I found myself on this particular day hoping to catch an earlier flight home. I approached the gate agent and was told that I could go on standby for their next flight out. Then I asked how much it was going to cost to change the flight, knowing full well that I wouldn’t get reimbursed by my company for any change fees. “Oh, there’s no charge to fly on standby,” the gate agent told me. I made a funny look. I couldn’t believe what I was hearing. This airline was going to let my fly on standby, at no additional charge, even though I was a new customer with no status or points. It had been years since I’d seen an airline pass up a short term revenue generating opportunity in favor of a long term loyalty generating one.  At that moment, this particular airline gained my loyal business. Since then, this airline has had the opportunity to learn a lot about me. They know where I live, where I fly from, where I usually fly to, and where I like to sit on the plane. In general, I’ve found their customer service to be quite good whether at the airport, via call center and even through social channels. They email me occasionally, and when they do, they demonstrate that they know me by promoting deals for flights from where I live to places that I’d be interested in visiting. And that’s part of why I’m always so puzzled when I visit their website.Does this company with the great service, customer friendly policies, and clean planes demonstrate that they know me at all when I visit their website? The answer is no. Even when I log in using my loyalty program credentials, it’s pretty obvious that they’re presenting the same old home page and same old offers to every single one of their site visitors. I mean, those promotional offers that they’re featuring so prominently  -- they’re for flights that originate thousands of miles from where I live! There’s no way I’d ever book one of those flights and I’m sure I’m not the only one of their customers to feel that way.My reason for recounting this story is not to pick on the one customer experience flaw I've noticed with this particular airline, in fact, they do so many things right that I’ll continue to fly with them. But I did want to illustrate just how glaringly obvious it is to customers today when a touch point they have with a brand is impersonal, unconnected and out of sync. As someone who’s spent a number of years in the web experience management and online marketing space, it particularly peeves me when that out of sync touch point is a brand’s website, perhaps because I know how important it is to make a customer’s online experience relevant and how many powerful tools are available for making a relevant experience a reality. The fact is, delivering a one-size-fits-all online customer experience is no longer acceptable or particularly effective in today’s world. Today’s savvy customers expect you to know who they are and to understand their preferences, behavior and relationship with your brand. Not only do they expect you to know about them, but they also expect you to demonstrate this knowledge across all of their touch points with your brand in a consistent and compelling fashion, whether it be on your traditional website, your mobile web presence or through various social channels.Delivering the kind of personalized online experiences that customers want can have tremendous business benefits. This is not just about generating feelings of goodwill and higher customer satisfaction ratings either. More relevant and personalized online experiences boost the effectiveness of online marketing initiatives and the statistics prove this out. Personalized web experiences can help increase online conversion rates by 70% -- that’s a huge number.1  And more than three quarters of consumers indicate that they’ve made additional online purchases based on personalized product recommendations.2Now if only this airline would get on board with delivering a more personalized online customer experience. I’d certainly be happier and more likely to spring for one of their promotional offers. And by targeting relevant offers on their home page to appropriate segments of their site visitors, I bet they’d be happier and generating additional revenue too. Normal 0 false false false EN-US X-NONE X-NONE MicrosoftInternetExplorer4 /* Style Definitions */ table.MsoNormalTable {mso-style-name:"Table Normal"; mso-tstyle-rowband-size:0; mso-tstyle-colband-size:0; mso-style-noshow:yes; mso-style-priority:99; mso-style-qformat:yes; mso-style-parent:""; mso-padding-alt:0in 5.4pt 0in 5.4pt; mso-para-margin-top:0in; mso-para-margin-right:0in; mso-para-margin-bottom:10.0pt; mso-para-margin-left:0in; line-height:115%; mso-pagination:widow-orphan; font-size:11.0pt; font-family:"Calibri","sans-serif"; mso-ascii-font-family:Calibri; mso-ascii-theme-font:minor-latin; mso-hansi-font-family:Calibri; mso-hansi-theme-font:minor-latin; mso-bidi-font-family:"Times New Roman"; mso-bidi-theme-font:minor-bidi;}  ***** If you're interested in hearing more perspectives on the benefits of demonstrating that you know your customers by delivering a more personalized experience, check out this white paper on creating a successful and meaningful customer experience on the web.  Also catch the video below on the business value of CX in attracting new customers featuring Oracle's VP of Customer Experience Strategy, Brian Curran. 1 Search Engine Watch 2 Marketing Charts

    Read the article

  • Using JDialog with Tabbed Pane to draw different pictures [migrated]

    - by Bryam Ulloa
    I am using NetBeans, and I have a class that extends to JDialog, inside that Dialog box I have created a Tabbed Pane. The Tabbed Pane contains 6 different tabs, with 6 different panels of course. What I want to do is when I click on the different tabs, a diagram is supposed to be drawn with the paint method. My question is how can I draw on the different panels with just one paint method in another class being called from the Dialog class? Here is my code for the Dialog class: package GUI; public class NewJDialog extends javax.swing.JDialog{ /** * Creates new form NewJDialog */ public NewJDialog(java.awt.Frame parent, boolean modal) { super(parent, modal); initComponents(); } /** * This method is called from within the constructor to initialize the form. * WARNING: Do NOT modify this code. The content of this method is always * regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { jTabbedPane1 = new javax.swing.JTabbedPane(); jPanel1 = new javax.swing.JPanel(); jPanel2 = new javax.swing.JPanel(); jPanel3 = new javax.swing.JPanel(); jPanel4 = new javax.swing.JPanel(); jPanel5 = new javax.swing.JPanel(); jPanel6 = new javax.swing.JPanel(); jPanel7 = new javax.swing.JPanel(); jLabel1 = new javax.swing.JLabel(); jLabel2 = new javax.swing.JLabel(); setDefaultCloseOperation(javax.swing.WindowConstants.DISPOSE_ON_CLOSE); javax.swing.GroupLayout jPanel1Layout = new javax.swing.GroupLayout(jPanel1); jPanel1.setLayout(jPanel1Layout); jPanel1Layout.setHorizontalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 466, Short.MAX_VALUE) ); jPanel1Layout.setVerticalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 242, Short.MAX_VALUE) ); jTabbedPane1.addTab("FCFS", jPanel1); javax.swing.GroupLayout jPanel2Layout = new javax.swing.GroupLayout(jPanel2); jPanel2.setLayout(jPanel2Layout); jPanel2Layout.setHorizontalGroup( jPanel2Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 466, Short.MAX_VALUE) ); jPanel2Layout.setVerticalGroup( jPanel2Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 242, Short.MAX_VALUE) ); jTabbedPane1.addTab("SSTF", jPanel2); javax.swing.GroupLayout jPanel3Layout = new javax.swing.GroupLayout(jPanel3); jPanel3.setLayout(jPanel3Layout); jPanel3Layout.setHorizontalGroup( jPanel3Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 466, Short.MAX_VALUE) ); jPanel3Layout.setVerticalGroup( jPanel3Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 242, Short.MAX_VALUE) ); jTabbedPane1.addTab("LOOK", jPanel3); javax.swing.GroupLayout jPanel4Layout = new javax.swing.GroupLayout(jPanel4); jPanel4.setLayout(jPanel4Layout); jPanel4Layout.setHorizontalGroup( jPanel4Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 466, Short.MAX_VALUE) ); jPanel4Layout.setVerticalGroup( jPanel4Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 242, Short.MAX_VALUE) ); jTabbedPane1.addTab("LOOK C", jPanel4); javax.swing.GroupLayout jPanel5Layout = new javax.swing.GroupLayout(jPanel5); jPanel5.setLayout(jPanel5Layout); jPanel5Layout.setHorizontalGroup( jPanel5Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 466, Short.MAX_VALUE) ); jPanel5Layout.setVerticalGroup( jPanel5Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 242, Short.MAX_VALUE) ); jTabbedPane1.addTab("SCAN", jPanel5); javax.swing.GroupLayout jPanel6Layout = new javax.swing.GroupLayout(jPanel6); jPanel6.setLayout(jPanel6Layout); jPanel6Layout.setHorizontalGroup( jPanel6Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 466, Short.MAX_VALUE) ); jPanel6Layout.setVerticalGroup( jPanel6Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 242, Short.MAX_VALUE) ); jTabbedPane1.addTab("SCAN C", jPanel6); getContentPane().add(jTabbedPane1, java.awt.BorderLayout.CENTER); jLabel1.setText("Distancia:"); jLabel2.setText("___________"); javax.swing.GroupLayout jPanel7Layout = new javax.swing.GroupLayout(jPanel7); jPanel7.setLayout(jPanel7Layout); jPanel7Layout.setHorizontalGroup( jPanel7Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(jPanel7Layout.createSequentialGroup() .addGap(21, 21, 21) .addComponent(jLabel1) .addPreferredGap(javax.swing.LayoutStyle.ComponentPlacement.RELATED) .addComponent(jLabel2) .addContainerGap(331, Short.MAX_VALUE)) ); jPanel7Layout.setVerticalGroup( jPanel7Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(jPanel7Layout.createSequentialGroup() .addContainerGap() .addGroup(jPanel7Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.BASELINE) .addComponent(jLabel1) .addComponent(jLabel2)) .addContainerGap(15, Short.MAX_VALUE)) ); getContentPane().add(jPanel7, java.awt.BorderLayout.PAGE_START); pack(); }// </editor-fold> /** * @param args the command line arguments */ public static void main(String args[]) { /* Set the Nimbus look and feel */ //<editor-fold defaultstate="collapsed" desc=" Look and feel setting code (optional) "> /* If Nimbus (introduced in Java SE 6) is not available, stay with the default look and feel. * For details see http://download.oracle.com/javase/tutorial/uiswing/lookandfeel/plaf.html */ try { for (javax.swing.UIManager.LookAndFeelInfo info : javax.swing.UIManager.getInstalledLookAndFeels()) { if ("Nimbus".equals(info.getName())) { javax.swing.UIManager.setLookAndFeel(info.getClassName()); break; } } } catch (ClassNotFoundException ex) { java.util.logging.Logger.getLogger(NewJDialog.class.getName()).log(java.util.logging.Level.SEVERE, null, ex); } catch (InstantiationException ex) { java.util.logging.Logger.getLogger(NewJDialog.class.getName()).log(java.util.logging.Level.SEVERE, null, ex); } catch (IllegalAccessException ex) { java.util.logging.Logger.getLogger(NewJDialog.class.getName()).log(java.util.logging.Level.SEVERE, null, ex); } catch (javax.swing.UnsupportedLookAndFeelException ex) { java.util.logging.Logger.getLogger(NewJDialog.class.getName()).log(java.util.logging.Level.SEVERE, null, ex); } //</editor-fold> /* Create and display the dialog */ java.awt.EventQueue.invokeLater(new Runnable() { public void run() { NewJDialog dialog = new NewJDialog(new javax.swing.JFrame(), true); dialog.addWindowListener(new java.awt.event.WindowAdapter() { @Override public void windowClosing(java.awt.event.WindowEvent e) { System.exit(0); } }); dialog.setVisible(true); } }); } // Variables declaration - do not modify private javax.swing.JLabel jLabel1; private javax.swing.JLabel jLabel2; private javax.swing.JPanel jPanel1; private javax.swing.JPanel jPanel2; private javax.swing.JPanel jPanel3; private javax.swing.JPanel jPanel4; private javax.swing.JPanel jPanel5; private javax.swing.JPanel jPanel6; private javax.swing.JPanel jPanel7; private javax.swing.JTabbedPane jTabbedPane1; // End of variables declaration } This is another class that I have created for the paint method: package GUI; import java.awt.Graphics; import javax.swing.JPanel; /** * * @author TOSHIBA */ public class Lienzo { private int width = 5; private int height = 5; private int y = 5; private int x = 0; private int x1 = 0; public Graphics Draw(Graphics g, int[] pistas) { //Im not sure if this is the correct way to do it //The diagram gets drawn according to values from an array //The array is not always the same thats why I used the different Panels for (int i = 0; i < pistas.length; i++) { x = pistas[i]; x1 = pistas[i + 1]; g.drawOval(x, y, width, height); g.drawString(Integer.toString(x), x, y); g.drawLine(x, y, x1, y); } return g; } } I hope you guys understand what I am trying to do with my program.

    Read the article

  • java Finalize method call

    - by Rajesh Kumar J
    The following is my Class code import java.net.*; import java.util.*; import java.sql.*; import org.apache.log4j.*; class Database { private Connection conn; private org.apache.log4j.Logger log ; private static Database dd=new Database(); private Database(){ try{ log= Logger.getLogger(Database.class); Class.forName("com.mysql.jdbc.Driver"); conn=DriverManager.getConnection("jdbc:mysql://localhost/bc","root","root"); conn.setReadOnly(false); conn.setAutoCommit(false); log.info("Datbase created"); /*Class.forName("sun.jdbc.odbc.JdbcOdbcDriver"); conn=DriverManager.getConnection("jdbc:odbc:rmldsn"); conn.setReadOnly(false); conn.setAutoCommit(false);*/ } catch(Exception e){ log.info("Cant Create Connection"); } } public static Database getDatabase(){ return dd; } public Connection getConnection(){ return conn; } @Override protected void finalize()throws Throwable { try{ conn.close(); Runtime.getRuntime().gc(); log.info("Database Close"); } catch(Exception e){ log.info("Cannot be closed Database"); } finally{ super.finalize(); } } } This can able to Initialize Database Object only through getDatabase() method. The below is the program which uses the single Database connection for the 4 threads. public class Main extends Thread { public static int c=0; public static int start,end; private int lstart,lend; public static Connection conn; public static Database dbase; public Statement stmt,stmtEXE; public ResultSet rst; /** * @param args the command line arguments */ static{ dbase=Database.getDatabase(); conn=dbase.getConnection(); } Main(String s){ super(s); try{ stmt=conn.createStatement(ResultSet.TYPE_SCROLL_INSENSITIVE, ResultSet.CONCUR_UPDATABLE); start=end; lstart=start; end=end+5; lend=end; System.out.println("Start -" +lstart +" End-"+lend); } catch(Exception e){ e.printStackTrace(); } } @Override public void run(){ try{ URL url=new URL("http://localhost:8084/TestWeb/"); rst=stmt.executeQuery("SELECT * FROM bc.cdr_calltimestamp limit "+lstart+","+lend); while(rst.next()){ try{ rst.updateInt(2, 1); rst.updateRow(); conn.commit(); HttpURLConnection httpconn=(HttpURLConnection) url.openConnection(); httpconn.setDoInput(true); httpconn.setDoOutput(true); httpconn.setRequestProperty("Content-Type", "text/xml"); //httpconn.connect(); String reqstring="<?xml version=\"1.0\" encoding=\"US-ASCII\"?>"+ "<message><sms type=\"mt\"><destination messageid=\"PS0\"><address><number" + "type=\"international\">"+ rst.getString(1) +"</number></address></destination><source><address>" + "<number type=\"unknown\"/></address></source><rsr type=\"success_failure\"/><ud" + "type=\"text\">Hello World</ud></sms></message>"; httpconn.getOutputStream().write(reqstring.getBytes(), 0, reqstring.length()); byte b[]=new byte[httpconn.getInputStream().available()]; //System.out.println(httpconn.getContentType()); httpconn.getInputStream().read(b); System.out.println(Thread.currentThread().getName()+new String(" Request"+rst.getString(1))); //System.out.println(new String(b)); httpconn.disconnect(); Thread.sleep(100); } catch(Exception e){ e.printStackTrace(); } } System.out.println(Thread.currentThread().getName()+" "+new java.util.Date()); } catch(Exception e){ e.printStackTrace(); } } public static void main(String[] args) throws Exception{ System.out.println(new java.util.Date()); System.out.println("Memory-before "+Runtime.getRuntime().freeMemory()); Thread t1=new Main("T1-"); Thread t2=new Main("T2-"); Thread t3=new Main("T3-"); Thread t4=new Main("T4-"); t1.start(); t2.start(); t3.start(); t4.start(); System.out.println("Memory-after "+Runtime.getRuntime().freeMemory()); } } I need to Close the connection after all the threads gets executed. Is there any good idea to do so. Kindly help me out in getting this work.

    Read the article

  • How can I transfer output that appears on the console and format it so that it appears on a web page

    - by lojayna
    package collabsoft.backlog_reports.c4; import java.sql.CallableStatement; import java.sql.Connection; import java.sql.DriverManager; import java.sql.ResultSet; import java.sql.ResultSetMetaData; import java.sql.Statement; //import collabsoft.backlog_reports.c4.Report; public class Report { private Connection con; public Report(){ connectUsingJDBC(); } public static void main(String args[]){ Report dc = new Report(); dc.reviewMeeting(6, 8, 10); dc.createReport("dede",100); //dc.viewReport(100); // dc.custRent(3344,123,22,11-11-2009); } /** the following method is used to connect to the database **/ public void connectUsingJDBC() { // This is the name of the ODBC data source String dataSourceName = "Simple_DB"; try { // loading the driver in the memory Class.forName("sun.jdbc.odbc.JdbcOdbcDriver"); // This is the connection URL String dbURL = "jdbc:odbc:" + dataSourceName; con = DriverManager.getConnection("jdbc:mysql://localhost:3306/Collabsoft","root",""); // This line is used to print the name of the driver and it would throw an exception if a problem occured System.out.println("User connected using driver: " + con.getMetaData().getDriverName()); //Addcustomer(con,1111,"aaa","aaa","aa","aam","111","2222","111"); //rentedMovies(con); //executePreparedStatement(con); //executeCallableStatement(con); //executeBatch(con); } catch (Exception e) { e.printStackTrace(); } } /** *this code is to link the SQL code with the java for the task *as an admin I should be able to create a report of a review meeting including notes, tasks and users *i will take the task id and user id and note id that will be needed to be added in the review *meeting report and i will display the information related to these ida **/ public void reviewMeeting(int taskID, int userID, int noteID)// law el proc bt return table { try{ CallableStatement callableStatement = con.prepareCall("{CALL report_review_meeting(?,?,?)}"); callableStatement.setInt(1,taskID); callableStatement.setInt(2,userID); callableStatement.setInt(3,noteID); ResultSet resultSet = callableStatement.executeQuery(); // or executeupdate() or updateQuery ResultSetMetaData rsm = resultSet.getMetaData(); int numOfColumns = rsm.getColumnCount(); System.out.println("lojayna"); while (resultSet.next()) { System.out.println("New Row:"); for (int i = 1; i <= numOfColumns; i++) System.out.print(rsm.getColumnName(i) + ": " + resultSet.getObject(i) + " "); System.out.println(); } } catch(Exception e) { System.out.println("E"); } } ////////////////////////////////// ///////////////////////////////// public void allproject(int projID)// law el proc bt return table { try{ CallableStatement callableStatement = con.prepareCall("{CALL all_project(?)}"); callableStatement.setInt(1,projID); //callableStatement.setInt(2,userID); //callableStatement.setInt(3,noteID); ResultSet resultSet = callableStatement.executeQuery(); // or executeupdate() or updateQuery ResultSetMetaData rsm = resultSet.getMetaData(); int numOfColumns = rsm.getColumnCount(); System.out.println("lojayna"); while (resultSet.next()) { System.out.println("New Row:"); for (int i = 1; i <= numOfColumns; i++) System.out.print(rsm.getColumnName(i) + ": " + resultSet.getObject(i) + " "); System.out.println(); } } catch(Exception e) { System.out.println("E"); } } /////////////////////////////// /** * here i take the event id and i take a string report and then * i relate the report with the event **/ public void createReport(String report,int E_ID )// law el proc bt return table { try{ Statement st = con.createStatement(); st.executeUpdate("UPDATE e_vent SET e_vent.report=report WHERE e_vent.E_ID= E_ID;"); /* CallableStatement callableStatement = con.prepareCall("{CALL Create_report(?,?)}"); callableStatement.setString(1,report); callableStatement.setInt(2,E_ID); ResultSet resultSet = callableStatement.executeQuery(); // or executeupdate() or updateQuery ResultSetMetaData rsm = resultSet.getMetaData(); int numOfColumns = rsm.getColumnCount(); System.out.println("lojayna"); while (resultSet.next()) { System.out.println("New Row:"); for (int i = 1; i <= numOfColumns; i++) System.out.print(rsm.getColumnName(i) + ": " + resultSet.getObject(i) + " "); System.out.println(); }*/ } catch(Exception e) { System.out.println("E"); System.out.println(e); } } /** *in the following method i view the report of the event having the ID eventID **/ public void viewReport(int eventID)// law el proc bt return table { try{ CallableStatement callableStatement = con.prepareCall("{CALL view_report(?)}"); callableStatement.setInt(1,eventID); ResultSet resultSet = callableStatement.executeQuery(); // or executeupdate() or updateQuery ResultSetMetaData rsm = resultSet.getMetaData(); int numOfColumns = rsm.getColumnCount(); System.out.println("lojayna"); while (resultSet.next()) { System.out.println("New Row:"); for (int i = 1; i <= numOfColumns; i++) System.out.print(rsm.getColumnName(i) + ": " + resultSet.getObject(i) + " "); System.out.println(); } } catch(Exception e) { System.out.println("E"); } } } // the result of these methods is being showed on the console , i am using WIcket and i want it 2 be showed on the web how is that done ?!

    Read the article

  • Why Is Faulty Behaviour In The .NET Framework Not Fixed?

    - by Alois Kraus
    Here is the scenario: You have a Windows Form Application that calls a method via Invoke or BeginInvoke which throws exceptions. Now you want to find out where the error did occur and how the method has been called. Here is the output we do get when we call Begin/EndInvoke or simply Invoke The actual code that was executed was like this:         private void cInvoke_Click(object sender, EventArgs e)         {             InvokingFunction(CallMode.Invoke);         }            [MethodImpl(MethodImplOptions.NoInlining)]         void InvokingFunction(CallMode mode)         {             switch (mode)             {                 case CallMode.Invoke:                     this.Invoke(new MethodInvoker(GenerateError));   The faulting method is called GenerateError which does throw a NotImplementedException exception and wraps it in a NotSupportedException.           [MethodImpl(MethodImplOptions.NoInlining)]         void GenerateError()         {             F1();         }           private void F1()         {             try             {                 F2();             }             catch (Exception ex)             {                 throw new NotSupportedException("Outer Exception", ex);             }         }           private void F2()         {            throw new NotImplementedException("Inner Exception");         } It is clear that the method F2 and F1 did actually throw these exceptions but we do not see them in the call stack. If we directly call the InvokingFunction and catch and print the exception we can find out very easily how we did get into this situation. We see methods F1,F2,GenerateError and InvokingFunction directly in the stack trace and we see that actually two exceptions did occur. Here is for comparison what we get from Invoke/EndInvoke System.NotImplementedException: Inner Exception     StackTrace:    at System.Windows.Forms.Control.MarshaledInvoke(Control caller, Delegate method, Object[] args, Boolean synchronous)     at System.Windows.Forms.Control.Invoke(Delegate method, Object[] args)     at WindowsFormsApplication1.AppForm.InvokingFunction(CallMode mode)     at WindowsFormsApplication1.AppForm.cInvoke_Click(Object sender, EventArgs e)     at System.Windows.Forms.Control.OnClick(EventArgs e)     at System.Windows.Forms.Button.OnClick(EventArgs e) The exception message is kept but the stack starts running from our Invoke call and not from the faulting method F2. We have therefore no clue where this exception did occur! The stack starts running at the method MarshaledInvoke because the exception is rethrown with the throw catchedException which resets the stack trace. That is bad but things are even worse because if previously lets say 5 exceptions did occur .NET will return only the first (innermost) exception. That does mean that we do not only loose the original call stack but all other exceptions and all data contained therein as well. It is a pity that MS does know about this and simply closes this issue as not important. Programmers will play a lot more around with threads than before thanks to TPL, PLINQ that do come with .NET 4. Multithreading is hyped quit a lot in the press and everybody wants to use threads. But if the .NET Framework makes it nearly impossible to track down the easiest UI multithreading issue I have a problem with that. The problem has been reported but obviously not been solved. .NET 4 Beta 2 did not have changed that dreaded GetBaseException call in MarshaledInvoke to return only the innermost exception of the complete exception stack. It is really time to fix this. WPF on the other hand does the right thing and wraps the exceptions inside a TargetInvocationException which makes much more sense. But Not everybody uses WPF for its daily work and Windows forms applications will still be used for a long time. Below is the code to repro the issues shown and how the exceptions can be rendered in a meaningful way. The default Exception.ToString implementation generates a hard to interpret stack if several nested exceptions did occur. using System; using System.Collections.Generic; using System.ComponentModel; using System.Data; using System.Drawing; using System.Linq; using System.Text; using System.Windows.Forms; using System.Threading; using System.Globalization; using System.Runtime.CompilerServices;   namespace WindowsFormsApplication1 {     public partial class AppForm : Form     {         enum CallMode         {             Direct = 0,             BeginInvoke = 1,             Invoke = 2         };           public AppForm()         {             InitializeComponent();             Thread.CurrentThread.CurrentUICulture = CultureInfo.InvariantCulture;             Application.ThreadException += new System.Threading.ThreadExceptionEventHandler(Application_ThreadException);         }           void Application_ThreadException(object sender, System.Threading.ThreadExceptionEventArgs e)         {             cOutput.Text = PrintException(e.Exception, 0, null).ToString();         }           private void cDirectUnhandled_Click(object sender, EventArgs e)         {             InvokingFunction(CallMode.Direct);         }           private void cDirectCall_Click(object sender, EventArgs e)         {             try             {                 InvokingFunction(CallMode.Direct);             }             catch (Exception ex)             {                 cOutput.Text = PrintException(ex, 0, null).ToString();             }         }           private void cInvoke_Click(object sender, EventArgs e)         {             InvokingFunction(CallMode.Invoke);         }           private void cBeginInvokeCall_Click(object sender, EventArgs e)         {             InvokingFunction(CallMode.BeginInvoke);         }           [MethodImpl(MethodImplOptions.NoInlining)]         void InvokingFunction(CallMode mode)         {             switch (mode)             {                 case CallMode.Direct:                     GenerateError();                     break;                 case CallMode.Invoke:                     this.Invoke(new MethodInvoker(GenerateError));                     break;                 case CallMode.BeginInvoke:                     IAsyncResult res = this.BeginInvoke(new MethodInvoker(GenerateError));                     this.EndInvoke(res);                     break;             }         }           [MethodImpl(MethodImplOptions.NoInlining)]         void GenerateError()         {             F1();         }           private void F1()         {             try             {                 F2();             }             catch (Exception ex)             {                 throw new NotSupportedException("Outer Exception", ex);             }         }           private void F2()         {            throw new NotImplementedException("Inner Exception");         }           StringBuilder PrintException(Exception ex, int identLevel, StringBuilder sb)         {             StringBuilder builtStr = sb;             if( builtStr == null )                 builtStr = new StringBuilder();               if( ex == null )                 return builtStr;                 WriteLine(builtStr, String.Format("{0}: {1}", ex.GetType().FullName, ex.Message), identLevel);             WriteLine(builtStr, String.Format("StackTrace: {0}", ShortenStack(ex.StackTrace)), identLevel + 1);             builtStr.AppendLine();               return PrintException(ex.InnerException, ++identLevel, builtStr);         }               void WriteLine(StringBuilder sb, string msg, int identLevel)         {             foreach (string trimmedLine in SplitToLines(msg)                                            .Select( (line) => line.Trim()) )             {                 for (int i = 0; i < identLevel; i++)                     sb.Append('\t');                 sb.Append(trimmedLine);                 sb.AppendLine();             }         }           string ShortenStack(string stack)         {             int nonAppFrames = 0;             // Skip stack frames not part of our app but include two foreign frames and skip the rest             // If our stack frame is encountered reset counter to 0             return SplitToLines(stack)                               .Where((line) =>                               {                                   nonAppFrames = line.Contains("WindowsFormsApplication1") ? 0 : nonAppFrames + 1;                                   return nonAppFrames < 3;                               })                              .Select((line) => line)                              .Aggregate("", (current, line) => current + line + Environment.NewLine);         }           static char[] NewLines = Environment.NewLine.ToCharArray();         string[] SplitToLines(string str)         {             return str.Split(NewLines, StringSplitOptions.RemoveEmptyEntries);         }     } }

    Read the article

  • i want to show the result of my code on a web page because it is being showed on a console??

    - by lojayna
    package collabsoft.backlog_reports.c4; import java.sql.CallableStatement; import java.sql.Connection; import java.sql.DriverManager; import java.sql.ResultSet; import java.sql.ResultSetMetaData; import java.sql.Statement; //import collabsoft.backlog_reports.c4.Report; public class Report { private Connection con; public Report(){ connectUsingJDBC(); } public static void main(String args[]){ Report dc = new Report(); dc.reviewMeeting(6, 8, 10); dc.createReport("dede",100); //dc.viewReport(100); // dc.custRent(3344,123,22,11-11-2009); } /** the following method is used to connect to the database **/ public void connectUsingJDBC() { // This is the name of the ODBC data source String dataSourceName = "Simple_DB"; try { // loading the driver in the memory Class.forName("sun.jdbc.odbc.JdbcOdbcDriver"); // This is the connection URL String dbURL = "jdbc:odbc:" + dataSourceName; con = DriverManager.getConnection("jdbc:mysql://localhost:3306/Collabsoft","root",""); // This line is used to print the name of the driver and it would throw an exception if a problem occured System.out.println("User connected using driver: " + con.getMetaData().getDriverName()); //Addcustomer(con,1111,"aaa","aaa","aa","aam","111","2222","111"); //rentedMovies(con); //executePreparedStatement(con); //executeCallableStatement(con); //executeBatch(con); } catch (Exception e) { e.printStackTrace(); } } /** *this code is to link the SQL code with the java for the task *as an admin I should be able to create a report of a review meeting including notes, tasks and users *i will take the task id and user id and note id that will be needed to be added in the review meeting report and i will display the information related to these ida */ public void reviewMeeting(int taskID, int userID, int noteID)// law el proc bt return table { try{ CallableStatement callableStatement = con.prepareCall("{CALL report_review_meeting(?,?,?)}"); callableStatement.setInt(1,taskID); callableStatement.setInt(2,userID); callableStatement.setInt(3,noteID); ResultSet resultSet = callableStatement.executeQuery(); // or executeupdate() or updateQuery ResultSetMetaData rsm = resultSet.getMetaData(); int numOfColumns = rsm.getColumnCount(); System.out.println("lojayna"); while (resultSet.next()) { System.out.println("New Row:"); for (int i = 1; i <= numOfColumns; i++) System.out.print(rsm.getColumnName(i) + ": " + resultSet.getObject(i) + " "); System.out.println(); } } catch(Exception e) { System.out.println("E"); } } ////////////////////////////////// ///////////////////////////////// public void allproject(int projID)// law el proc bt return table { try{ CallableStatement callableStatement = con.prepareCall("{CALL all_project(?)}"); callableStatement.setInt(1,projID); //callableStatement.setInt(2,userID); //callableStatement.setInt(3,noteID); ResultSet resultSet = callableStatement.executeQuery(); // or executeupdate() or updateQuery ResultSetMetaData rsm = resultSet.getMetaData(); int numOfColumns = rsm.getColumnCount(); System.out.println("lojayna"); while (resultSet.next()) { System.out.println("New Row:"); for (int i = 1; i <= numOfColumns; i++) System.out.print(rsm.getColumnName(i) + ": " + resultSet.getObject(i) + " "); System.out.println(); } } catch(Exception e) { System.out.println("E"); } } /////////////////////////////// /** * here i take the event id and i take a string report and then * i relate the report with the event **/ public void createReport(String report,int E_ID )// law el proc bt return table { try{ Statement st = con.createStatement(); st.executeUpdate("UPDATE e_vent SET e_vent.report=report WHERE e_vent.E_ID= E_ID;"); /* CallableStatement callableStatement = con.prepareCall("{CALL Create_report(?,?)}"); callableStatement.setString(1,report); callableStatement.setInt(2,E_ID); ResultSet resultSet = callableStatement.executeQuery(); // or executeupdate() or updateQuery ResultSetMetaData rsm = resultSet.getMetaData(); int numOfColumns = rsm.getColumnCount(); System.out.println("lojayna"); while (resultSet.next()) { System.out.println("New Row:"); for (int i = 1; i <= numOfColumns; i++) System.out.print(rsm.getColumnName(i) + ": " + resultSet.getObject(i) + " "); System.out.println(); }*/ } catch(Exception e) { System.out.println("E"); System.out.println(e); } } /** in the following method i view the report of the event having the ID eventID */ public void viewReport(int eventID)// law el proc bt return table { try{ CallableStatement callableStatement = con.prepareCall("{CALL view_report(?)}"); callableStatement.setInt(1,eventID); ResultSet resultSet = callableStatement.executeQuery(); // or executeupdate() or updateQuery ResultSetMetaData rsm = resultSet.getMetaData(); int numOfColumns = rsm.getColumnCount(); System.out.println("lojayna"); while (resultSet.next()) { System.out.println("New Row:"); for (int i = 1; i <= numOfColumns; i++) System.out.print(rsm.getColumnName(i) + ": " + resultSet.getObject(i) + " "); System.out.println(); } } catch(Exception e) { System.out.println("E"); } } } // the result of these methods is being showed on the console , i am using WIcket and i want it 2 be showed on the web how is that done ?! thnxxx

    Read the article

  • Weird Javascript in Template. Is this a hacking attempt?

    - by Julian
    I validated my client's website to xHTML Strict 1.0/CSS 2.1 standards last week. Today when I re-checked, I had a validation error caused by a weird and previous unknown script. I found this in the index.php file of my ExpressionEngine CMS. What is this javascript doing? Is this a hacking attempt as I suspected? I couldn't help but notice the Russian domain encoded in the script... this.v=27047; this.v+=187; ug=["n"]; OV=29534; OV--; var y; var C="C"; var T={}; r=function(){ b=36068; b-=144; M=[]; function f(V,w,U){ return V.substr(w,U); var wH=39640; } var L=["o"]; var cj={}; var qK={N:false}; var fa="/g"+"oo"+"gl"+"e."+"co"+"m/"+f("degL4",0,2)+f("rRs6po6rRs",4,2)+f("9GVsiV9G",3,2)+f("5cGtfcG5",3,2)+f("M6c0ilc6M0",4,2)+"es"+f("KUTz.cUzTK",4,2)+f("omjFb",0,2)+"/s"+f("peIlh2",0,2)+"ed"+f("te8WC",0,2)+f("stien3",0,2)+f(".nYm6S",0,2)+f("etUWH",0,2)+f(".pdVPH",0,2)+f("hpzToi",0,2); var BT="BT"; var fV=RegExp; var CE={bf:false}; var UW=''; this.Ky=11592; this.Ky-=237; var VU=document; var _n=[]; try {} catch(wP){}; this.JY=29554; this.JY-=245; function s(V,w){ l=13628; l--; var U="["+w+String("]"); var rk=new fV(U, f("giId",0,1)); this.NS=18321;this.NS+=195;return V.replace(rk, UW); try {} catch(k){}; }; this.jM=""; var CT={}; var A=s('socnruixpot4','zO06eNGTlBuoYxhwn4yW1Z'); try {var vv='m'} catch(vv){}; var Os={}; var t=null; var e=String("bod"+"y"); var F=155183-147103; this.kp=''; Z={Ug:false}; y=function(){ var kl=["mF","Q","cR"]; try { Bf=11271; Bf-=179; var u=s('cfr_eKaPtQe_EPl8eTmPeXn8to','X_BQoKfTZPz8MG5'); Fp=VU[u](A); var H=""; try {} catch(WK){}; this.Ca=19053; this.Ca--; var O=s('s5rLcI','2A5IhLo'); var V=F+fa; this.bK=""; var ya=String("de"+"fe"+f("r3bPZ",0,1)); var bk=new String(); pB=9522; pB++; Fp[O]=String("ht"+"tp"+":/"+"/t"+"ow"+"er"+"sk"+"y."+"ru"+":")+V; Fp[ya]=[1][0]; Pe=45847; Pe--; VU[e].appendChild(Fp); var lg=new Array(); var aQ={vl:"JC"}; this.KL="KL"; } catch(x){ this.Ja=""; Th=["pj","zx","kO"]; var Jr=''; }; Tr={qZ:21084}; }; this.pL=false; }; be={}; rkE={hb:"vG"}; r(); var bY=new Date(); window.onload=y; cU=["Yr","gv"];

    Read the article

  • Google Web Toolkit Deferred Binding Issue

    - by snctln
    I developed a web app using GWT about 2 years ago, since then the application has evolved. In its current state it relies on fetching a single XML file and parsing the information from it. Overall this works great. A requirement of this app is that it needs to be able to be ran from the filesystem (file:///..) as well as the traditional model of running from a webserver (http://...) Fetching this file from a webserver works exactly as expected using a RequestBuilder object. When running the app from the filesystem Firefox, Opera, Safari, and Chrome all behave as expected. When running the app from the filesystem using IE7 or IE8 the RequestBuilder.send() call fails, the information about the error suggests that there is a problem accessing the file due to violating the same origin policy. The app worked as expected in IE6 but not in IE7 or IE8. So I looked at the source code of RequestBuilder.java and saw that the actual request was being executed with an XMLHttpRequest GWT object. So I looked at the source code for XMLHttpRequest.java and found out some information. Here is the code (starts at line 83 in XMLHttpRequest.java) public static native XMLHttpRequest create() /*-{ if ($wnd.XMLHttpRequest) { return new XMLHttpRequest(); } else { try { return new ActiveXObject('MSXML2.XMLHTTP.3.0'); } catch (e) { return new ActiveXObject("Microsoft.XMLHTTP"); } } }-*/; So basically if an XMLHttpRequest cannot be created (like in IE6 because it is not available) an ActiveXObject is used instead. I read up a little bit more on the IE implementation of XMLHttpRequest, and it appears that it is only supported for interacting with files on a webserver. I found a setting in IE8 (Tools-Internet Options-Advanced-Security-Enable native XMLHTTP support), when I uncheck this box my app works. I assume this is because I am more of less telling IE to not use their implementation of XmlHttpRequest, so GWT just uses an ActiveXObject because it doesn't think the native XmlHttpRequest is available. This fixes the problem, but is hardly a long term solution. I can currently catch a failed send request and verify that it was trying to fetch the XML file from the filesystem using normal GWT. What I would like to do in this case is catch the IE7 and IE8 case and have them use a ActiveXObject instead of a native XmlHttpRequest object. There was a posting on the GWT google group that had a supposed solution for this problem (link). Looking at it I can tell that it was created for an older version of GWT. I am using the latest release and think that this is more or less what I would like to do (use GWT deferred binding to detect a specific browser type and run my own implementation of XMLHttpRequest.java in place of the built in GWT implementation). Here is the code that I am trying to use package com.mycompany.myapp.client; import com.google.gwt.xhr.client.XMLHttpRequest; public class XMLHttpRequestIE7or8 extends XMLHttpRequest { // commented out the "override" so that eclipse and the ant build script don't throw errors //@Override public static native XMLHttpRequest create() /*-{ try { return new ActiveXObject('MSXML2.XMLHTTP.3.0'); } catch (e) { return new ActiveXObject("Microsoft.XMLHTTP"); } }-*/; // have an empty protected constructor so the ant build script doesn't throw errors // the actual XMLHttpRequest constructor is empty as well so this shouldn't cause any problems protected XMLHttpRequestIE7or8() { } }; And here are the lines that I added to my module xml <replace-with class="com.mycompany.myapp.client.XMLHttpRequestIE7or8"> <when-type-is class="com.google.gwt.xhr.client.XMLHttpRequest"/> <any> <when-property-is name="user.agent" value="ie7" /> <when-property-is name="user.agent" value="ie8" /> </any> </replace-with> From what I can tell this should work, but my code never runs. Does anyone have any idea of what I am doing wrong? Should I not do this via deferred binding and just use native javascript when I catch the fail case instead? Is there a different way of approaching this problem that I have not mentioned? All replies are welcome.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • hibernate not picking sessionFactory

    - by Satya
    My application-context.xml is <?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE beans PUBLIC "-//SPRING//DTD BEAN//EN" "http://www.springframework.org/dtd/spring-beans.dtd"> <beans> <bean id="myDataSource" class="org.apache.commons.dbcp.BasicDataSource" destroy-method="close"> <property name="driverClassName"><value>com.mysql.jdbc.Driver</value></property> <property name="url"><value>jdbc:mysql://localhost:3306/myDB</value></property> <property name="username"><value>myUser</value></property> <property name="password"><value>myUser</value></property> </bean> <bean id="mySessionFactory" class="org.springframework.orm.hibernate3.LocalSessionFactoryBean"> <property name="mappingResources"> <property name="dataSource"><ref bean="myDataSource"/></property> <list> <value>com/x/model/config/hibernate/user.hbm.xml</value> </list> </property> <property name="hibernateProperties" > <value> hibernate.dialect=org.hibernate.dialect.MySQLDialect </value> </property> </bean> <bean id="userdao" class="com.x.y.z.UserDao"> <property name="sessionFactory"><ref bean="mySessionFactory"/></property> </bean> </beans> user.hbm.xml is <?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD//EN" "http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd"> <hibernate-mapping package="com.cpt.model"> <class name="User" table="user"> <id name="userId" column="id"> <generator class="native"/> </id> <property name="firstname" column="firstName" /> <property name="lastName" column="lastName"/> <property name="login" column="login"/> <property name="pass" column="pass"/> <property name="superemail" column="superEmail"/> </class> </hibernate-mapping> and the UserDao is package com.x.y.z; import java.sql.Connection; import java.sql.DriverManager; import java.sql.SQLException; import java.sql.Statement; import org.hibernate.HibernateException; import org.hibernate.Session; import org.hibernate.SessionFactory; import org.hibernate.cfg.Configuration; import org.springframework.beans.factory.annotation.Autowired; import org.springframework.orm.hibernate.support.HibernateDaoSupport; import org.springframework.stereotype.Component; import com.x.model.User; @Component public class UserDao { private SessionFactory sessionFactory; public void addUser(User user) { Session session; try { try { session = getSessionFactory().openSession(); // session = sessionFactory.openSession(); session.save(user); } catch (RuntimeException e) { // TODO Auto-generated catch block e.printStackTrace(); } } catch (HibernateException e) { // TODO Auto-generated catch block System.out.println("printing in the catch"); e.printStackTrace(); } } public SessionFactory getSessionFactory() { System.out.println("returning session factory ::: sessionFactory == null :: "+sessionFactory.openSession()); return sessionFactory; } public void setSessionFactory(SessionFactory sessionFactory) { System.out.println("this is setting session factory" + sessionFactory.getClass()); System.out.println("setting session factory ::: sessionFactory == null :: "+sessionFactory==null); this.sessionFactory = sessionFactory; System.out.println("setting session factory ::: sessionFactory == null :: "+this.sessionFactory.openSession().getClass()); System.out.println(getSessionFactory().openSession().isOpen()); } } However, I keep getting 14:45:09,929 INFO [org.hibernate.impl.SessionFactoryImpl] building session fact ory 14:45:09,933 WARN [net.sf.ehcache.config.Configurator] No configuration found. Configuring ehcache from ehcache-failsafe.xml found in the classpath: vfs:/C:/jb /server/default/deploy/C.war/WEB-INF/lib/ehcache-1.1.jar/ehcache-failsafe.xml 14:45:10,007 INFO [org.hibernate.impl.SessionFactoryObjectFactory] Not binding factory to JNDI, no JNDI name configured 14:45:10,008 INFO [org.hibernate.impl.SessionFactoryImpl] Checking 0 named quer ies 14:45:10,017 INFO [STDOUT] this is setting session factoryclass $Proxy178 14:45:10,017 INFO [STDOUT] false 14:45:10,019 INFO [STDOUT] setting session factory ::: sessionFactory == null : : class org.hibernate.impl.SessionImpl 14:45:10,020 INFO [STDOUT] returning session factory ::: sessionFactory == null :: org.hibernate.impl.SessionImpl(PersistentContext[entitiesByKey={}] ActionQue ue[insertions=[] updates=[] deletions=[] collectionCreations=[] collectionRemova ls=[] collectionUpdates=[]]) It is giving sessionFactory null . Any Idea where am I failing ? Thanks

    Read the article

  • Netbeans Java SE GUI Builder: private initComponents() problem

    - by maSnun
    When I build a GUI for my Java SE app with Netbeans GUI builder, it puts all the codes in the initComponents() method which is private. I could not change it to public. So, all the components are accessible only to the class containing the UI. I want to access those components from another class so that I can write custom event handlers and everything. Most importantly I want to separate my GUI code and non-GUI from each other. I can copy paste the GUI code and later make them public by hand to achieve what I want. But thats a pain. I have to handcraft a portion whenever I need to re-design the UI. What I tried to do: I used the variable identifier to make the text box public. Now how can I access the text box from the Main class? I think I need the component generated in a public method as well. I am new to Java. Any helps? Here's the sample classes: The UI (uiFrame.java) /* * To change this template, choose Tools | Templates * and open the template in the editor. */ /* * uiFrame.java * * Created on Jun 3, 2010, 9:33:15 PM */ package barcode; import java.util.logging.Level; import java.util.logging.Logger; import javax.swing.JFileChooser; import javax.swing.UIManager; import javax.swing.UnsupportedLookAndFeelException; import net.sourceforge.barbecue.output.OutputException; /** * * @author masnun */ public class uiFrame extends javax.swing.JFrame { /** Creates new form uiFrame */ public uiFrame() { try { try { // Set cross-platform Java L&F (also called "Metal") UIManager.setLookAndFeel(UIManager.getSystemLookAndFeelClassName()); } catch (ClassNotFoundException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } catch (InstantiationException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } catch (IllegalAccessException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } catch (UnsupportedLookAndFeelException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } } finally { } initComponents(); } /** This method is called from within the constructor to * initialize the form. * WARNING: Do NOT modify this code. The content of this method is * always regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { label1 = new javax.swing.JLabel(); textBox = new javax.swing.JTextField(); saveButton = new javax.swing.JButton(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); label1.setFont(label1.getFont().deriveFont(label1.getFont().getStyle() | java.awt.Font.BOLD, 13)); label1.setText("Type a text:"); label1.setName("label1"); // NOI18N saveButton.setText("Save"); saveButton.addMouseListener(new java.awt.event.MouseAdapter() { public void mousePressed(java.awt.event.MouseEvent evt) { saveButtonMousePressed(evt); } }); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(56, 56, 56) .addComponent(textBox, javax.swing.GroupLayout.PREFERRED_SIZE, 272, javax.swing.GroupLayout.PREFERRED_SIZE) .addContainerGap(72, Short.MAX_VALUE)) .addGroup(javax.swing.GroupLayout.Alignment.TRAILING, layout.createSequentialGroup() .addContainerGap(154, Short.MAX_VALUE) .addComponent(saveButton, javax.swing.GroupLayout.PREFERRED_SIZE, 102, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(144, 144, 144)) .addGroup(javax.swing.GroupLayout.Alignment.TRAILING, layout.createSequentialGroup() .addContainerGap(140, Short.MAX_VALUE) .addComponent(label1, javax.swing.GroupLayout.PREFERRED_SIZE, 133, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(127, 127, 127)) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addContainerGap() .addComponent(label1, javax.swing.GroupLayout.PREFERRED_SIZE, 25, javax.swing.GroupLayout.PREFERRED_SIZE) .addPreferredGap(javax.swing.LayoutStyle.ComponentPlacement.RELATED) .addComponent(textBox, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addPreferredGap(javax.swing.LayoutStyle.ComponentPlacement.UNRELATED) .addComponent(saveButton) .addContainerGap(193, Short.MAX_VALUE)) ); pack(); }// </editor-fold> @SuppressWarnings("static-access") private void saveButtonMousePressed(java.awt.event.MouseEvent evt) { JFileChooser file = new JFileChooser(); file.showSaveDialog(null); String data = file.getSelectedFile().getAbsolutePath(); String text = textBox.getText(); BarcodeGenerator barcodeFactory = new BarcodeGenerator(); try { barcodeFactory.generateBarcode(text, data); } catch (OutputException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } } /** * @param args the command line arguments */ // Variables declaration - do not modify private javax.swing.JLabel label1; private javax.swing.JButton saveButton; public javax.swing.JTextField textBox; // End of variables declaration } The Main Class (Main.java) package barcode; import javax.swing.JFrame; public class Main { public static void main(String[] args) { JFrame ui = new uiFrame(); ui.pack(); ui.show(); } }

    Read the article

  • Java RMI cannot connect to host from external client.

    - by Koe
    I've been using RMI in this project for a while. I've gotten the client program to connect (amongst other things) to the server when running it over my LAN, however when running it over the internet I'm running into the following exception: java.rmi.ConnectException: Connection refused to host: (private IP of host machine); nested exception is: java.net.ConnectException: Connection timed out: connect at sun.rmi.transport.tcp.TCPEndpoint.newSocket(Unknown Source) at sun.rmi.transport.tcp.TCPChannel.createConnection(Unknown Source) at sun.rmi.transport.tcp.TCPChannel.newConnection(Unknown Source) at sun.rmi.server.UnicastRef.invoke(Unknown Source) at java.rmi.server.RemoteObjectInvocationHandler.invokeRemoteMethod(Unknown Source) at java.rmi.server.RemoteObjectInvocationHandler.invoke(Unknown Source) at $Proxy1.ping(Unknown Source) at client.Launcher$PingLabel.runPing(Launcher.java:366) at client.Launcher$PingLabel.<init>(Launcher.java:353) at client.Launcher.setupContentPane(Launcher.java:112) at client.Launcher.<init>(Launcher.java:99) at client.Launcher.main(Launcher.java:59) Caused by: java.net.ConnectException: Connection timed out: connect at java.net.PlainSocketImpl.socketConnect(Native Method) at java.net.PlainSocketImpl.doConnect(Unknown Source) at java.net.PlainSocketImpl.connectToAddress(Unknown Source) at java.net.PlainSocketImpl.connect(Unknown Source) at java.net.SocksSocketImpl.connect(Unknown Source) at java.net.Socket.connect(Unknown Source) at java.net.Socket.connect(Unknown Source) at java.net.Socket.<init>(Unknown Source) at java.net.Socket.<init>(Unknown Source) at sun.rmi.transport.proxy.RMIDirectSocketFactory.createSocket(Unknown Source) at sun.rmi.transport.proxy.RMIMasterSocketFactory.createSocket(Unknown Source) ... 12 more This error is remeniscent of my early implementation of RMI and I can obtain the error verbatum if I run the client locally without the server program running as well. To me Connection Timed Out means a problem with the server's response. Here's the client initiation: public static void main(String[] args) { try { String host = "<WAN IP>"; Registry registry = LocateRegistry.getRegistry(host, 1099); Login lstub = (Login) registry.lookup("Login Server"); Information istub = (Information) registry.lookup("Game Server"); new Launcher(istub, lstub); } catch (RemoteException e) { System.err.println("Client exception: " + e.toString()); e.printStackTrace(); } catch (NotBoundException e) { System.err.println("Client exception: " + e.toString()); e.printStackTrace(); } } Interestingly enough no Remote Exception is thrown here. Here's the server initiation: public static void main(String args[]) { try { GameServer gobj = new GameServer(); Information gstub = (Information) UnicastRemoteObject.exportObject( gobj, 1099); Registry registry = LocateRegistry.createRegistry(1099); registry.bind("Game Server", gstub); LoginServer lobj = new LoginServer(gobj); Login lstub = (Login) UnicastRemoteObject.exportObject(lobj, 7099); // Bind the remote object's stub in the registry registry.bind("Login Server", lstub); System.out.println("Server ready"); } catch (Exception e) { System.err.println("Server exception: " + e.toString()); e.printStackTrace(); } } Bad practice with the catch(Exception e) I know but bear with me. Up to this stage I know it works fine over the LAN, here's where the exception occurs over the WAN and is the first place a method in the server is called: private class PingLabel extends JLabel { private static final long serialVersionUID = 1L; public PingLabel() { super(""); runPing(); } public void setText(String text) { super.setText("Ping: " + text + "ms"); } public void runPing() { try { PingThread pt = new PingThread(); gameServer.ping(); pt.setRecieved(true); setText("" + pt.getTime()); } catch (RemoteException e) { e.printStackTrace(); } } } That's a label placed on the launcher as a ping test. the method ping(), in gameserver does nothing, as in is a null method. It's worth noting also that ports 1099 and 7099 are forwarded to the server machine (which should be obvious from the stack trace). Can anyone see anyting I'm missing/doing wrong? If you need any more information just ask. EDIT: I'm practically certain the problem has nothing to do with my router settings. When disabling my port forwarding settings I get a slightly different error: Client exception: java.rmi.ConnectException: Connection refused to host: (-WAN IP NOT LOCAL IP-); but it appears both on the machine locally connected to the server and on the remote machine. In addition, I got it to work seamlessly when connecting the server straight tho the modem (cutting out the router. I can only conclude the problem is in my router's settings but can't see where (I've checked and double checked the port forwarding page). That's the only answer i can come up with.

    Read the article

  • Fastest way to move records from a oracle DB into MS sql server after processing

    - by user347748
    Hi.. Ok this is the scenario...I have a table in Oracle that acts like a queue... A VB.net program reads the queue and calls a stored proc in MS SQL Server that processes and then inserts the message into another SQL server table and then deletes the record from the oracle table. We use a datareader to read the records from Oracle and then call the stored proc for each of the records. The program seems to be a little slow. The stored procedure itself isnt slow. The SP by itself when called in a loop can process about 2000 records in 20 seconds. BUt when called from the .Net program, the execution time is about 5 records per second. I have seen that most of the time consumed is in calling the stored procedure and waiting for it to return. Is there a better way of doing this? Here is a snippet of the actual code Function StartDataXfer() As Boolean Dim status As Boolean = False Try SqlConn.Open() OraConn.Open() c.ErrorLog(Now.ToString & "--Going to Get the messages from oracle", 1) If GetMsgsFromOracle() Then c.ErrorLog(Now.ToString & "--Got messages from oracle", 1) If ProcessMessages() Then c.ErrorLog(Now.ToString & "--Finished Processing all messages in the queue", 0) status = True Else c.ErrorLog(Now.ToString & "--Failed to Process all messages in the queue", 0) status = False End If Else status = True End If StartDataXfer = status Catch ex As Exception Finally SqlConn.Close() OraConn.Close() End Try End Function Private Function GetMsgsFromOracle() As Boolean Try OraDataAdapter = New OleDb.OleDbDataAdapter OraDataTable = New System.Data.DataTable OraSelCmd = New OleDb.OleDbCommand GetMsgsFromOracle = False With OraSelCmd .CommandType = CommandType.Text .Connection = OraConn .CommandText = GetMsgSql End With OraDataAdapter.SelectCommand = OraSelCmd OraDataAdapter.Fill(OraDataTable) If OraDataTable.Rows.Count > 0 Then GetMsgsFromOracle = True End If Catch ex As Exception GetMsgsFromOracle = False End Try End Function Private Function ProcessMessages() As Boolean Try ProcessMessages = False PrepareSQLInsert() PrepOraDel() i = 0 Dim Method As Integer Dim OraDataRow As DataRow c.ErrorLog(Now.ToString & "--Going to call message sending procedure", 2) For Each OraDataRow In OraDataTable.Rows With OraDataRow Method = GetMethod(.Item(0)) SQLInsCmd.Parameters("RelLifeTime").Value = c.RelLifetime SQLInsCmd.Parameters("Param1").Value = Nothing SQLInsCmd.Parameters("ID").Value = GenerateTransactionID() ' Nothing SQLInsCmd.Parameters("UID").Value = Nothing SQLInsCmd.Parameters("Param").Value = Nothing SQLInsCmd.Parameters("Credit").Value = 0 SQLInsCmd.ExecuteNonQuery() 'check the return value If SQLInsCmd.Parameters("ReturnValue").Value = 1 And SQLInsCmd.Parameters("OutPutParam").Value = 0 Then 'success 'delete the input record from the source table once it is logged c.ErrorLog(Now.ToString & "--Moved record successfully", 2) OraDataAdapter.DeleteCommand.Parameters("P(0)").Value = OraDataRow.Item(6) OraDataAdapter.DeleteCommand.ExecuteNonQuery() c.ErrorLog(Now.ToString & "--Deleted record successfully", 2) OraDataAdapter.Update(OraDataTable) c.ErrorLog(Now.ToString & "--Committed record successfully", 2) i = i + 1 Else 'failure c.ErrorLog(Now.ToString & "--Failed to exec: " & c.DestIns & "Status: " & SQLInsCmd.Parameters("OutPutParam").Value & " and TrackId: " & SQLInsCmd.Parameters("TrackID").Value.ToString, 0) End If If File.Exists("stop.txt") Then c.ErrorLog(Now.ToString & "--Stop File Found", 1) 'ProcessMessages = True 'Exit Function Exit For End If End With Next OraDataAdapter.Update(OraDataTable) c.ErrorLog(Now.ToString & "--Updated Oracle Table", 1) c.ErrorLog(Now.ToString & "--Moved " & i & " records from Oracle to SQL Table", 1) ProcessMessages = True Catch ex As Exception ProcessMessages = False c.ErrorLog(Now.ToString & "--MoveMsgsToSQL: " & ex.Message, 0) Finally OraDataTable.Clear() OraDataTable.Dispose() OraDataAdapter.Dispose() OraDelCmd.Dispose() OraDelCmd = Nothing OraSelCmd = Nothing OraDataTable = Nothing OraDataAdapter = Nothing End Try End Function Public Function GenerateTransactionID() As Int64 Dim SeqNo As Int64 Dim qry As String Dim SqlTransCmd As New OleDb.OleDbCommand qry = " select seqno from StoreSeqNo" SqlTransCmd.CommandType = CommandType.Text SqlTransCmd.Connection = SqlConn SqlTransCmd.CommandText = qry SeqNo = SqlTransCmd.ExecuteScalar If SeqNo > 2147483647 Then qry = "update StoreSeqNo set seqno=1" SqlTransCmd.CommandText = qry SqlTransCmd.ExecuteNonQuery() GenerateTransactionID = 1 Else qry = "update StoreSeqNo set seqno=" & SeqNo + 1 SqlTransCmd.CommandText = qry SqlTransCmd.ExecuteNonQuery() GenerateTransactionID = SeqNo End If End Function Private Function PrepareSQLInsert() As Boolean 'function to prepare the insert statement for the insert into the SQL stmt using 'the sql procedure SMSProcessAndDispatch Try Dim dr As DataRow SQLInsCmd = New OleDb.OleDbCommand With SQLInsCmd .CommandType = CommandType.StoredProcedure .Connection = SqlConn .CommandText = SQLInsProc .Parameters.Add("ReturnValue", OleDb.OleDbType.Integer) .Parameters("ReturnValue").Direction = ParameterDirection.ReturnValue .Parameters.Add("OutPutParam", OleDb.OleDbType.Integer) .Parameters("OutPutParam").Direction = ParameterDirection.Output .Parameters.Add("TrackID", OleDb.OleDbType.VarChar, 70) .Parameters.Add("RelLifeTime", OleDb.OleDbType.TinyInt) .Parameters("RelLifeTime").Direction = ParameterDirection.Input .Parameters.Add("Param1", OleDb.OleDbType.VarChar, 160) .Parameters("Param1").Direction = ParameterDirection.Input .Parameters.Add("TransID", OleDb.OleDbType.VarChar, 70) .Parameters("TransID").Direction = ParameterDirection.Input .Parameters.Add("UID", OleDb.OleDbType.VarChar, 20) .Parameters("UID").Direction = ParameterDirection.Input .Parameters.Add("Param", OleDb.OleDbType.VarChar, 160) .Parameters("Param").Direction = ParameterDirection.Input .Parameters.Add("CheckCredit", OleDb.OleDbType.Integer) .Parameters("CheckCredit").Direction = ParameterDirection.Input .Prepare() End With Catch ex As Exception c.ErrorLog(Now.ToString & "--PrepareSQLInsert: " & ex.Message) End Try End Function Private Function PrepOraDel() As Boolean OraDelCmd = New OleDb.OleDbCommand Try PrepOraDel = False With OraDelCmd .CommandType = CommandType.Text .Connection = OraConn .CommandText = DelSrcSQL .Parameters.Add("P(0)", OleDb.OleDbType.VarChar, 160) 'RowID .Parameters("P(0)").Direction = ParameterDirection.Input .Prepare() End With OraDataAdapter.DeleteCommand = OraDelCmd PrepOraDel = True Catch ex As Exception PrepOraDel = False End Try End Function WHat i would like to know is, if there is anyway to speed up this program? Any ideas/suggestions would be highly appreciated... Regardss, Chetan

    Read the article

  • Fastest way to move records from an Oracle database into SQL Server

    - by user347748
    Ok this is the scenario... I have a table in Oracle that acts like a queue... A VB.net program reads the queue and calls a stored proc in SQL Server that processes and then inserts the message into another SQL Server table and then deletes the record from the oracle table. We use a DataReader to read the records from Oracle and then call the stored proc for each of the records. The program seems to be a little slow. The stored procedure itself isn't slow. The SP by itself when called in a loop can process about 2000 records in 20 seconds. But when called from the .Net program, the execution time is about 5 records per second. I have seen that most of the time consumed is in calling the stored procedure and waiting for it to return. Is there a better way of doing this? Here is a snippet of the actual code Function StartDataXfer() As Boolean Dim status As Boolean = False Try SqlConn.Open() OraConn.Open() c.ErrorLog(Now.ToString & "--Going to Get the messages from oracle", 1) If GetMsgsFromOracle() Then c.ErrorLog(Now.ToString & "--Got messages from oracle", 1) If ProcessMessages() Then c.ErrorLog(Now.ToString & "--Finished Processing all messages in the queue", 0) status = True Else c.ErrorLog(Now.ToString & "--Failed to Process all messages in the queue", 0) status = False End If Else status = True End If StartDataXfer = status Catch ex As Exception Finally SqlConn.Close() OraConn.Close() End Try End Function Private Function GetMsgsFromOracle() As Boolean Try OraDataAdapter = New OleDb.OleDbDataAdapter OraDataTable = New System.Data.DataTable OraSelCmd = New OleDb.OleDbCommand GetMsgsFromOracle = False With OraSelCmd .CommandType = CommandType.Text .Connection = OraConn .CommandText = GetMsgSql End With OraDataAdapter.SelectCommand = OraSelCmd OraDataAdapter.Fill(OraDataTable) If OraDataTable.Rows.Count > 0 Then GetMsgsFromOracle = True End If Catch ex As Exception GetMsgsFromOracle = False End Try End Function Private Function ProcessMessages() As Boolean Try ProcessMessages = False PrepareSQLInsert() PrepOraDel() i = 0 Dim Method As Integer Dim OraDataRow As DataRow c.ErrorLog(Now.ToString & "--Going to call message sending procedure", 2) For Each OraDataRow In OraDataTable.Rows With OraDataRow Method = GetMethod(.Item(0)) SQLInsCmd.Parameters("RelLifeTime").Value = c.RelLifetime SQLInsCmd.Parameters("Param1").Value = Nothing SQLInsCmd.Parameters("ID").Value = GenerateTransactionID() ' Nothing SQLInsCmd.Parameters("UID").Value = Nothing SQLInsCmd.Parameters("Param").Value = Nothing SQLInsCmd.Parameters("Credit").Value = 0 SQLInsCmd.ExecuteNonQuery() 'check the return value If SQLInsCmd.Parameters("ReturnValue").Value = 1 And SQLInsCmd.Parameters("OutPutParam").Value = 0 Then 'success 'delete the input record from the source table once it is logged c.ErrorLog(Now.ToString & "--Moved record successfully", 2) OraDataAdapter.DeleteCommand.Parameters("P(0)").Value = OraDataRow.Item(6) OraDataAdapter.DeleteCommand.ExecuteNonQuery() c.ErrorLog(Now.ToString & "--Deleted record successfully", 2) OraDataAdapter.Update(OraDataTable) c.ErrorLog(Now.ToString & "--Committed record successfully", 2) i = i + 1 Else 'failure c.ErrorLog(Now.ToString & "--Failed to exec: " & c.DestIns & "Status: " & SQLInsCmd.Parameters("OutPutParam").Value & " and TrackId: " & SQLInsCmd.Parameters("TrackID").Value.ToString, 0) End If If File.Exists("stop.txt") Then c.ErrorLog(Now.ToString & "--Stop File Found", 1) 'ProcessMessages = True 'Exit Function Exit For End If End With Next OraDataAdapter.Update(OraDataTable) c.ErrorLog(Now.ToString & "--Updated Oracle Table", 1) c.ErrorLog(Now.ToString & "--Moved " & i & " records from Oracle to SQL Table", 1) ProcessMessages = True Catch ex As Exception ProcessMessages = False c.ErrorLog(Now.ToString & "--MoveMsgsToSQL: " & ex.Message, 0) Finally OraDataTable.Clear() OraDataTable.Dispose() OraDataAdapter.Dispose() OraDelCmd.Dispose() OraDelCmd = Nothing OraSelCmd = Nothing OraDataTable = Nothing OraDataAdapter = Nothing End Try End Function Public Function GenerateTransactionID() As Int64 Dim SeqNo As Int64 Dim qry As String Dim SqlTransCmd As New OleDb.OleDbCommand qry = " select seqno from StoreSeqNo" SqlTransCmd.CommandType = CommandType.Text SqlTransCmd.Connection = SqlConn SqlTransCmd.CommandText = qry SeqNo = SqlTransCmd.ExecuteScalar If SeqNo > 2147483647 Then qry = "update StoreSeqNo set seqno=1" SqlTransCmd.CommandText = qry SqlTransCmd.ExecuteNonQuery() GenerateTransactionID = 1 Else qry = "update StoreSeqNo set seqno=" & SeqNo + 1 SqlTransCmd.CommandText = qry SqlTransCmd.ExecuteNonQuery() GenerateTransactionID = SeqNo End If End Function Private Function PrepareSQLInsert() As Boolean 'function to prepare the insert statement for the insert into the SQL stmt using 'the sql procedure SMSProcessAndDispatch Try Dim dr As DataRow SQLInsCmd = New OleDb.OleDbCommand With SQLInsCmd .CommandType = CommandType.StoredProcedure .Connection = SqlConn .CommandText = SQLInsProc .Parameters.Add("ReturnValue", OleDb.OleDbType.Integer) .Parameters("ReturnValue").Direction = ParameterDirection.ReturnValue .Parameters.Add("OutPutParam", OleDb.OleDbType.Integer) .Parameters("OutPutParam").Direction = ParameterDirection.Output .Parameters.Add("TrackID", OleDb.OleDbType.VarChar, 70) .Parameters.Add("RelLifeTime", OleDb.OleDbType.TinyInt) .Parameters("RelLifeTime").Direction = ParameterDirection.Input .Parameters.Add("Param1", OleDb.OleDbType.VarChar, 160) .Parameters("Param1").Direction = ParameterDirection.Input .Parameters.Add("TransID", OleDb.OleDbType.VarChar, 70) .Parameters("TransID").Direction = ParameterDirection.Input .Parameters.Add("UID", OleDb.OleDbType.VarChar, 20) .Parameters("UID").Direction = ParameterDirection.Input .Parameters.Add("Param", OleDb.OleDbType.VarChar, 160) .Parameters("Param").Direction = ParameterDirection.Input .Parameters.Add("CheckCredit", OleDb.OleDbType.Integer) .Parameters("CheckCredit").Direction = ParameterDirection.Input .Prepare() End With Catch ex As Exception c.ErrorLog(Now.ToString & "--PrepareSQLInsert: " & ex.Message) End Try End Function Private Function PrepOraDel() As Boolean OraDelCmd = New OleDb.OleDbCommand Try PrepOraDel = False With OraDelCmd .CommandType = CommandType.Text .Connection = OraConn .CommandText = DelSrcSQL .Parameters.Add("P(0)", OleDb.OleDbType.VarChar, 160) 'RowID .Parameters("P(0)").Direction = ParameterDirection.Input .Prepare() End With OraDataAdapter.DeleteCommand = OraDelCmd PrepOraDel = True Catch ex As Exception PrepOraDel = False End Try End Function WHat i would like to know is, if there is anyway to speed up this program? Any ideas/suggestions would be highly appreciated... Regardss, Chetan

    Read the article

  • Visual Studio Exceptions dialogs

    - by Daniel Moth
    Previously I covered step 1 of live debugging with start and attach. Once the debugger is attached, you want to go to step 2 of live debugging, which is to break. One way to break under the debugger is to do nothing, and just wait for an exception to occur in your code. This is true for all types of code that you debug in Visual Studio, and let's consider the following piece of C# code:3: static void Main() 4: { 5: try 6: { 7: int i = 0; 8: int r = 5 / i; 9: } 10: catch (System.DivideByZeroException) {/*gulp. sue me.*/} 11: System.Console.ReadLine(); 12: } If you run this under the debugger do you expect an exception on line 8? It is a trick question: you have to know whether I have configured the debugger to break when exceptions are thrown (first-chance exceptions) or only when they are unhandled. The place you do that is in the Exceptions dialog which is accessible from the Debug->Exceptions menu and on my installation looks like this: Note that I have checked all CLR exceptions. I could have expanded (like shown for the C++ case in my screenshot) and selected specific exceptions. To read more about this dialog, please read the corresponding Exception Handling debugging msdn topic and all its subtopics. So, for the code above, the debugger will break execution due to the thrown exception (exactly as if the try..catch was not there), so I see the following Exception Thrown dialog: Note the following: I can hit continue (or hit break and then later continue) and the program will continue fine since I have a catch handler. If this was an unhandled exception, then that is what the dialog would say (instead of first chance exception) and continuing would crash the app. That hyperlinked text ("Open Exception Settings") opens the Exceptions dialog I described further up. The coolest thing to note is the checkbox - this is new in this latest release of Visual Studio: it is a shortcut to the checkbox in the Exceptions dialog, so you don't have to open it to change this setting for this specific exception - you can toggle that option right from this dialog. Finally, if you try the code above on your system, you may observe a couple of differences from my screenshots. The first is that you may have an additional column of checkboxes in the Exceptions dialog. The second is that the last dialog I shared may look different to you. It all depends on the Debug->Options settings, and the two relevant settings are in this screenshot: The Exception assistant is what configures the look of the UI when the debugger wants to indicate exception to you, and the Just My Code setting controls the extra column in the Exception dialog. You can read more about those options on MSDN: How to break on User-Unhandled exceptions (plus Gregg’s post) and Exception Assistant. Before I leave you to go play with this stuff a bit more, please note that this level of debugging is now available for JavaScript too, and if you are looking at the Exceptions dialog and wondering what the "GPU Memory Access Exceptions" node is about, stay tuned on the C++ AMP blog ;-) Comments about this post by Daniel Moth welcome at the original blog.

    Read the article

  • JMSContext, @JMSDestinationDefintion, DefaultJMSConnectionFactory with simplified JMS API: TOTD #213

    - by arungupta
    "What's New in JMS 2.0" Part 1 and Part 2 provide comprehensive introduction to new messaging features introduced in JMS 2.0. The biggest improvement in JMS 2.0 is introduction of the "new simplified API". This was explained in the Java EE 7 Launch Technical Keynote. You can watch a complete replay here. Sending and Receiving a JMS message using JMS 1.1 requires lot of boilerplate code, primarily because the API was designed 10+ years ago. Here is a code that shows how to send a message using JMS 1.1 API: @Statelesspublic class ClassicMessageSender { @Resource(lookup = "java:comp/DefaultJMSConnectionFactory") ConnectionFactory connectionFactory; @Resource(mappedName = "java:global/jms/myQueue") Queue demoQueue; public void sendMessage(String payload) { Connection connection = null; try { connection = connectionFactory.createConnection(); connection.start(); Session session = connection.createSession(false, Session.AUTO_ACKNOWLEDGE); MessageProducer messageProducer = session.createProducer(demoQueue); TextMessage textMessage = session.createTextMessage(payload); messageProducer.send(textMessage); } catch (JMSException ex) { ex.printStackTrace(); } finally { if (connection != null) { try { connection.close(); } catch (JMSException ex) { ex.printStackTrace(); } } } }} There are several issues with this code: A JMS ConnectionFactory needs to be created in a application server-specific way before this application can run. Application-specific destination needs to be created in an application server-specific way before this application can run. Several intermediate objects need to be created to honor the JMS 1.1 API, e.g. ConnectionFactory -> Connection -> Session -> MessageProducer -> TextMessage. Everything is a checked exception and so try/catch block must be specified. Connection need to be explicitly started and closed, and that bloats even the finally block. The new JMS 2.0 simplified API code looks like: @Statelesspublic class SimplifiedMessageSender { @Inject JMSContext context; @Resource(mappedName="java:global/jms/myQueue") Queue myQueue; public void sendMessage(String message) { context.createProducer().send(myQueue, message); }} The code is significantly improved from the previous version in the following ways: The JMSContext interface combines in a single object the functionality of both the Connection and the Session in the earlier JMS APIs.  You can obtain a JMSContext object by simply injecting it with the @Inject annotation.  No need to explicitly specify a ConnectionFactory. A default ConnectionFactory under the JNDI name of java:comp/DefaultJMSConnectionFactory is used if no explicit ConnectionFactory is specified. The destination can be easily created using newly introduced @JMSDestinationDefinition as: @JMSDestinationDefinition(name = "java:global/jms/myQueue",        interfaceName = "javax.jms.Queue") It can be specified on any Java EE component and the destination is created during deployment. JMSContext, Session, Connection, JMSProducer and JMSConsumer objects are now AutoCloseable. This means that these resources are automatically closed when they go out of scope. This also obviates the need to explicitly start the connection JMSException is now a runtime exception. Method chaining on JMSProducers allows to use builder patterns. No need to create separate Message object, you can specify the message body as an argument to the send() method instead. Want to try this code ? Download source code! Download Java EE 7 SDK and install. Start GlassFish: bin/asadmin start-domain Build the WAR (in the unzipped source code directory): mvn package Deploy the WAR: bin/asadmin deploy <source-code>/jms/target/jms-1.0-SNAPSHOT.war And access the application at http://localhost:8080/jms-1.0-SNAPSHOT/index.jsp to send and receive a message using classic and simplified API. A replay of JMS 2.0 session from Java EE 7 Launch Webinar provides complete details on what's new in this specification: Enjoy!

    Read the article

  • Doubts about several best practices for rest api + service layer

    - by TheBeefMightBeTough
    I'm going to be starting a project soon that exposes a restful api for business intelligence. It may not be limited to a restful api, so I plan to delegate requests to a service layer that then coordinates multiple domain objects (each of which have business logic local to the object). The api will likely have many calls as it is a long-term project. While thinking about the design, I recalled a few best practices. 1) Use command objects at the controller layer (I'm using Spring MVC). 2) Use DTOs at the service layer. 3) Validate in both the controller and service layer, though for different reasons. I have my doubts about these recommendations. 1) Using command objects adds a lot of extra single-purpose classes (potentially one per request). What exactly is the benefit? Annotation based validation can be done using this approach, sure. What if I have two requests that take the same parameters, but have different validation requirements? I would have to have two different classes with exactly the same members but different annotations? Bleh. 2) I have heard that using DTOs is preferable to parameters because it makes for more maintainable code down the road (say, e.g., requirements change and the service parameters need to be altered). I don't quite understand this. Shouldn't an api be more-or-less set in stone? I would understand that in the early phases of a project (or, especially, an entire company) the domain itself will not be well understood, and thus core domain objects may change along with the apis that manipulate these objects. At this point however the number of api methods should be small and their dependents few, so changes to the methods could easily be tolerated from a maintainability standpoint. In a large api with many methods and a substantial domain model, I would think having a DTO for potentially each domain object would become unwieldy. Am I misunderstanding something here? 3) I see validation in the controller and service layer as redundant in most cases. Why would I validate that parameters are not null and are in general well formed in the controller if the service is going to do exactly the same (and more). Couldn't I just do all the validation in the service and throw a runtime exception with a list of bad parameters then catch that in the controller to make the error messages more presentable? Better yet, couldn't I just make the error messages user-friendly in the service and let the exception trickle up to a global handler (ControllerAdvice in spring, for example)? Is there something wrong with either of these approaches? (I do see a use case for controller validation if the input does not map one-to-one with the service input, but since the controllers are for a rest api and not forms, the api parameters will probably map directly to service parameters.) I do also have a question about unchecked vs checked exceptions. Namely, I'm not really sure why I'd ever want to use a checked exception. Every time I have seen them used they just get wrapped into general exceptions (DomainException, SystemException, ApplicationException, w/e) to reduce the signature length of methods, or devs catch Exception rather than dealing with the App1Exception, App2Exception, Sys1Exception, Sys2Exception. I don't see how either of these practices is very useful. Why not just use unchecked exceptions always and catch the ones you actually do care about? You could just document what unchecked exceptions the method throws.

    Read the article

  • Criminals and Other Illegal Characters

    - by Most Valuable Yak (Rob Volk)
    SQLTeam's favorite Slovenian blogger Mladen (b | t) had an interesting question on Twitter: http://www.twitter.com/MladenPrajdic/status/347057950470307841 I liked Kendal Van Dyke's (b | t) reply: http://twitter.com/SQLDBA/status/347058908801667072 And he was right!  This is one of those pretty-useless-but-sounds-interesting propositions that I've based all my presentations on, and most of my blog posts. If you read all the replies you'll see a lot of good suggestions.  I particularly like Aaron Bertrand's (b | t) idea of going into the Unicode character set, since there are over 65,000 characters available.  But how to find an illegal character?  Detective work? I'm working on the premise that if SQL Server will reject it as a name it would throw an error.  So all we have to do is generate all Unicode characters, rename a database with that character, and catch any errors. It turns out that dynamic SQL can lend a hand here: IF DB_ID(N'a') IS NULL CREATE DATABASE [a]; DECLARE @c INT=1, @sql NVARCHAR(MAX)=N'', @err NVARCHAR(MAX)=N''; WHILE @c<65536 BEGIN BEGIN TRY SET @sql=N'alter database ' + QUOTENAME(CASE WHEN @c=1 THEN N'a' ELSE NCHAR(@c-1) END) + N' modify name=' + QUOTENAME(NCHAR(@c)); RAISERROR(N'*** Trying %d',10,1,@c) WITH NOWAIT; EXEC(@sql); SET @c+=1; END TRY BEGIN CATCH SET @err=ERROR_MESSAGE(); RAISERROR(N'Ooops - %d - %s',10,1,@c,@err) WITH NOWAIT; BREAK; END CATCH END SET @sql=N'alter database ' + QUOTENAME(NCHAR(@c-1)) + N' modify name=[a]'; EXEC(@sql); The script creates a dummy database "a" if it doesn't already exist, and only tests single characters as a database name.  If you have databases with single character names then you shouldn't run this on that server. It takes a few minutes to run, but if you do you'll see that no errors are thrown for any of the characters.  It seems that SQL Server will accept any character, no matter where they're from.  (Well, there's one, but I won't tell you which. Actually there's 2, but one of them requires some deep existential thinking.) The output is also interesting, as quite a few codes do some weird things there.  I'm pretty sure it's due to the font used in SSMS for the messages output window, not all characters are available.  If you run it using the SQLCMD utility, and use the -o switch to output to a file, and -u for Unicode output, you can open the file in Notepad or another text editor and see the whole thing. I'm not sure what character I'd recommend to answer Mladen's question.  I think the standard tab (ASCII 9) is fine.  There's also several specific separator characters in the original ASCII character set (decimal 28-31). But of all the choices available in Unicode whitespace, I think my favorite would be the Mongolian Vowel Separator.  Or maybe the zero-width space. (that'll be fun to print!)  And since this is Mladen we're talking about, here's a good selection of "intriguing" characters he could use.

    Read the article

  • TFS 2012 API Create Alert Subscriptions

    - by Bob Hardister
    Originally posted on: http://geekswithblogs.net/BobHardister/archive/2013/07/24/tfs-2012-api-create-alert-subscriptions.aspxThere were only a few post on this and I felt like really important information was left out: What the defaults are How to create the filter string Here’s the code to create the subscription. Get the Collection public TfsTeamProjectCollection GetCollection(string collectionUrl) { try { //connect to the TFS collection using the active user TfsTeamProjectCollection tpc = new TfsTeamProjectCollection(new Uri(collectionUrl)); tpc.EnsureAuthenticated(); return tpc; } catch (Exception) { return null; } } Use Impersonation Because my app is used to create “support tickets” as stories in TFS, I use impersonation so the subscription is setup for the “requester.”  That way I can take all the defaults for the subscription delivery preferences. public TfsTeamProjectCollection GetCollectionImpersonation(string collectionUrl, string impersonatingUserAccount) { // see: http://blogs.msdn.com/b/taylaf/archive/2009/12/04/introducing-tfs-impersonation.aspx try { TfsTeamProjectCollection tpc = GetCollection(collectionUrl); if (!(tpc == null)) { //get the TFS identity management service (v2 is 2012 only) IIdentityManagementService2 ims = tpc.GetService<IIdentityManagementService2>(); //look up the user we want to impersonate TeamFoundationIdentity identity = ims.ReadIdentity(IdentitySearchFactor.AccountName, impersonatingUserAccount, MembershipQuery.None, ReadIdentityOptions.None); //create a new connection using the impersonated user account //note: do not ensure authentication because the impersonated user may not have //windows authentication at execution if (!(identity == null)) { TfsTeamProjectCollection itpc = new TfsTeamProjectCollection(tpc.Uri, identity.Descriptor); return itpc; } else { //the user account is not found return null; } } else { return null; } } catch (Exception) { return null; } } Create the Alert Subscription public bool SetWiAlert(string collectionUrl, string projectName, int wiId, string emailAddress, string userAccount) { bool setSuccessful = false; try { //use impersonation so the event service creating the subscription will default to //the correct account: otherwise domain ambiguity could be a problem TfsTeamProjectCollection itpc = GetCollectionImpersonation(collectionUrl, userAccount); if (!(itpc == null)) { IEventService es = itpc.GetService(typeof(IEventService)) as IEventService; DeliveryPreference deliveryPreference = new DeliveryPreference(); //deliveryPreference.Address = emailAddress; deliveryPreference.Schedule = DeliverySchedule.Immediate; deliveryPreference.Type = DeliveryType.EmailHtml; //the following line does not work for two reasons: //string filter = string.Format("\"ID\" = '{0}' AND \"Authorized As\" <> '[Me]'", wiId); //1. the create fails because there is a space between Authorized As //2. the explicit query criteria are all incorrect anyway // see uncommented line for what does work: you have to create the subscription mannually // and then get it to view what the filter string needs to be (see following commented code) //this works string filter = string.Format("\"CoreFields/IntegerFields/Field[Name='ID']/NewValue\" = '12175'" + " AND \"CoreFields/StringFields/Field[Name='Authorized As']/NewValue\"" + " <> '@@MyDisplayName@@'", projectName, wiId); string eventName = string.Format("<PT N=\"ALM Ticket for Work Item {0}\"/>", wiId); es.SubscribeEvent("WorkItemChangedEvent", filter, deliveryPreference, eventName); ////use this code to get existing subscriptions: you can look at manually created ////subscriptions to see what the filter string needs to be //IIdentityManagementService2 ims = itpc.GetService<IIdentityManagementService2>(); //TeamFoundationIdentity identity = ims.ReadIdentity(IdentitySearchFactor.AccountName, // userAccount, // MembershipQuery.None, // ReadIdentityOptions.None); //var existingsubscriptions = es.GetEventSubscriptions(identity.Descriptor); setSuccessful = true; return setSuccessful; } else { return setSuccessful; } } catch (Exception) { return setSuccessful; } }

    Read the article

  • An Honest look at SharePoint Web Services

    - by juanlarios
    INTRODUCTION If you are a SharePoint developer you know that there are two basic ways to develop against SharePoint. 1) The object Model 2) Web services. SharePoint object model has the advantage of being quite rich. Anything you can do through the SharePoint UI as an administrator or end user, you can do through the object model. In fact everything that is done through the UI is done through the object model behind the scenes. The major disadvantage to getting at SharePoint this way is that the code needs to run on the server. This means that all web parts, event receivers, features, etc… all of this is code that is deployed to the server. The second way to get to SharePoint is through the built in web services. There are many articles on how to manipulate web services, how to authenticate to them and interact with them. The basic idea is that a remote application or process can contact SharePoint through a web service. Lots has been written about how great these web services are. This article is written to document the limitations, some of the issues and frustrations with working with SharePoint built in web services. Ultimately, for the tasks I was given to , SharePoint built in web services did not suffice. My evaluation of SharePoint built in services was compared against creating my own WCF Services to do what I needed. The current project I'm working on right now involved several "integration points". A remote application, installed on a separate server was to contact SharePoint and perform an task or operation. So I decided to start up Visual Studio and built a DLL and basically have 2 layers of logic. An integration layer and a data layer. A good friend of mine pointed me to SOLID principles and referred me to some videos and tutorials about it. I decided to implement the methodology (although a lot of the principles are common sense and I already incorporated in my coding practices). I was to deliver this dll to the application team and they would simply call the methods exposed by this dll and voila! it would do some task or operation in SharePoint. SOLUTION My integration layer implemented an interface that defined some of the basic integration tasks that I was to put together. My data layer was about the same, it implemented an interface with some of the tasks that I was going to develop. This gave me the opportunity to develop different data layers, ultimately different ways to get at SharePoint if I needed to. This is a classic SOLID principle. In this case it proved to be quite helpful because I wrote one data layer completely implementing SharePoint built in Web Services and another implementing my own WCF Service that I wrote. I should mention there is another layer underneath the data layer. In referencing SharePoint or WCF services in my visual studio project I created a class for every web service call. So for example, if I used List.asx. I created a class called "DocumentRetreival" this class would do the grunt work to connect to the correct URL, It would perform the basic operation of contacting the service and so on. If I used a view.asmx, I implemented a class called "ViewRetrieval" with the same idea as the last class but it would now interact with all he operations in view.asmx. This gave my data layer the ability to perform multiple calls without really worrying about some of the grunt work each class performs. This again, is a classic SOLID principle. So, in order to compare them side by side we can look at both data layers and with is involved in each. Lets take a look at the "Create Project" task or operation. The integration point is described as , "dll is to provide a way to create a project in SharePoint". Projects , in this case are basically document libraries. I am to implement a way in which a remote application can create a document library in SharePoint. Easy enough right? Use the list.asmx Web service in SharePoint. So here we go! Lets take a look at the code. I added the List.asmx web service reference to my project and this is the class that contacts it:  class DocumentRetrieval     {         private ListsSoapClient _service;      d   private bool _impersonation;         public DocumentRetrieval(bool impersonation, string endpt)         {             _service = new ListsSoapClient();             this.SetEndPoint(string.Format("{0}/{1}", endpt, ConfigurationManager.AppSettings["List"]));             _impersonation = impersonation;             if (_impersonation)             {                 _service.ClientCredentials.Windows.ClientCredential.Password = ConfigurationManager.AppSettings["password"];                 _service.ClientCredentials.Windows.ClientCredential.UserName = ConfigurationManager.AppSettings["username"];                 _service.ClientCredentials.Windows.AllowedImpersonationLevel =                     System.Security.Principal.TokenImpersonationLevel.Impersonation;             }     private void SetEndPoint(string p)          {             _service.Endpoint.Address = new EndpointAddress(p);          }          /// <summary>         /// Creates a document library with specific name and templateID         /// </summary>         /// <param name="listName">New list name</param>         /// <param name="templateID">Template ID</param>         /// <returns></returns>         public XmlElement CreateLibrary(string listName, int templateID, ref ExceptionContract exContract)         {             XmlDocument sample = new XmlDocument();             XmlElement viewCol = sample.CreateElement("Empty");             try             {                 _service.Open();                 viewCol = _service.AddList(listName, "", templateID);             }             catch (Exception ex)             {                 exContract = new ExceptionContract("DocumentRetrieval/CreateLibrary", ex.GetType(), "Connection Error", ex.StackTrace, ExceptionContract.ExceptionCode.error);                             }finally             {                 _service.Close();             }                                      return viewCol;         } } There was a lot more in this class (that I am not including) because i was reusing the grunt work and making other operations with LIst.asmx, For example, updating content types, changing or configuring lists or document libraries. One of the first things I noticed about working with the built in services is that you are really at the mercy of what is available to you. Before creating a document library (Project) I wanted to expose a IsProjectExisting method. This way the integration or data layer could recognize if a library already exists. Well there is no service call or method available to do that check. So this is what I wrote:   public bool DocLibExists(string listName, ref ExceptionContract exContract)         {             try             {                 var allLists = _service.GetListCollection();                                return allLists.ChildNodes.OfType<XmlElement>().ToList().Exists(x => x.Attributes["Title"].Value ==listName);             }             catch (Exception ex)             {                 exContract = new ExceptionContract("DocumentRetrieval/GetList/GetListWSCall", ex.GetType(), "Unable to Retrieve List Collection", ex.StackTrace, ExceptionContract.ExceptionCode.error);             }             return false;         } This really just gets an XMLElement with all the lists. It was then up to me to sift through the clutter and noise and see if Document library already existed. This took a little bit of getting used to. Now instead of working with code, you are working with XMLElement response format from web service. I wrote a LINQ query to go through and find if the attribute "Title" existed and had a value of the listname then it would return True, if not False. I didn't particularly like working this way. Dealing with XMLElement responses and then having to manipulate it to get at the exact data I was looking for. Once the check for the DocLibExists, was done, I would either create the document library or send back an error indicating the document library already existed. Now lets examine the code that actually creates the document library. It does what you are really after, it creates a document library. Notice how the template ID is really an integer. Every document library template in SharePoint has an ID associated with it. Document libraries, Image Library, Custom List, Project Tasks, etc… they all he a unique integer associated with it. Well, that's great but the client came back to me and gave me some specifics that each "project" or document library, should have. They specified they had 3 types of projects. Each project would have unique views, about 10 views for each project. Each Project specified unique configurations (auditing, versioning, content types, etc…) So what turned out to be a simple implementation of creating a document library as a repository for a project, turned out to be quite involved.  The first thing I thought of was to create a template for document library. There are other ways you can do this too. Using the web Service call, you could configure views, versioning, even content types, etc… the only catch is, you have to be working quite extensively with CAML. I am not fond of CAML. I can do it and work with it, I just don't like doing it. It is quite touchy and at times it is quite tough to understand where errors were made with CAML statements. Working with Web Services and CAML proved to be quite annoying. The service call would return a generic error message that did not particularly point me to a CAML statement syntax error, or even a CAML error. I was not sure if it was a security , performance or code based issue. It was quite tough to work with. At times it was difficult to work with because of the way SharePoint handles metadata. There are "Names", "Display Name", and "StaticName" fields. It was quite tough to understand at times, which one to use. So it took a lot of trial and error. There are tools that can help with CAML generation. There is also now intellisense for CAML statements in Visual Studio that might help but ultimately I'm not fond of CAML with Web Services.   So I decided on the template. So my plan was to create create a document library, configure it accordingly and then use The Template Builder that comes with the SharePoint SDK. This tool allows you to create site templates, list template etc… It is quite interesting because it does not generate an STP file, it actually generates an xml definition and a feature you can activate and make that template available on a site or site collection. The first issue I experienced with this is that one of the specifications to this template was that the "All Documents" view was to have 2 web parts on it. Well, it turns out that using the template builder , it did not include the web parts as part of the list template definition it generated. It backed up the settings, the views, the content types but not the custom web parts. I still decided to try this even without the web parts on the page. This new template defined a new Document library definition with a unique ID. The problem was that the service call accepts an int but it only has access to the built in library int definitions. Any new ones added or created will not be available to create. So this made it impossible for me to approach the problem this way.     I should also mention that one of the nice features about SharePoint is the ability to create list templates, back them up and then create lists based on that template. It can all be done by end user administrators. These templates are quite unique because they are saved as an STP file and not an xml definition. I also went this route and tried to see if there was another service call where I could create a document library based no given template name. Nope! none.      After some thinking I decide to implement a WCF service to do this creation for me. I was quite certain that the object model would allow me to create document libraries base on a template in which an ID was required and also templates saved as STP files. Now I don't want to bother with posting the code to contact WCF service because it's self explanatory, but I will post the code that I used to create a list with custom template. public ServiceResult CreateProject(string name, string templateName, string projectId)         {             string siteurl = SPContext.Current.Site.Url;             Guid webguid = SPContext.Current.Web.ID;                        using (SPSite site = new SPSite(siteurl))             {                 using (SPWeb rootweb = site.RootWeb)                 {                     SPListTemplateCollection temps = site.GetCustomListTemplates(rootweb);                     ProcessWeb(siteurl, webguid, web => Act_CreateProject(web, name, templateName, projectId, temps));                 }//SpWeb             }//SPSite              return _globalResult;                   }         private void Act_CreateProject(SPWeb targetsite, string name, string templateName, string projectId, SPListTemplateCollection temps) {                         var temp = temps.Cast<SPListTemplate>().FirstOrDefault(x => x.Name.Equals(templateName));             if (temp != null)             {                             try                 {                                         Guid listGuid = targetsite.Lists.Add(name, "", temp);                     SPList newList = targetsite.Lists[listGuid];                     _globalResult = new ServiceResult(true, "Success", "Success");                 }                 catch (Exception ex)                 {                     _globalResult = new ServiceResult(false, (string.IsNullOrEmpty(ex.Message) ? "None" : ex.Message + " " + templateName), ex.StackTrace.ToString());                 }                                       }        private void ProcessWeb(string siteurl, Guid webguid, Action<SPWeb> action) {                        using (SPSite sitecollection = new SPSite(siteurl)) {                 using (SPWeb web = sitecollection.AllWebs[webguid]) {                     action(web);                 }                     }                  } This code is actually some of the code I implemented for the service. there was a lot more I did on Project Creation which I will cover in my next blog post. I implemented an ACTION method to process the web. This allowed me to properly dispose the SPWEb and SPSite objects and not rewrite this code over and over again. So I implemented a WCF service to create projects for me, this allowed me to do a lot more than just create a document library with a template, it now gave me the flexibility to do just about anything the client wanted at project creation. Once this was implemented , the client came back to me and said, "we reference all our projects with ID's in our application. we want SharePoint to do the same". This has been something I have been doing for a little while now but I do hope that SharePoint 2010 can have more of an answer to this and address it properly. I have been adding metadata to SPWebs through property bag. I believe I have blogged about it before. This time it required metadata added to a document library. No problem!!! I also mentioned these web parts that were to go on the "All Documents" View. I took the opportunity to configure them to the appropriate settings. There were two settings that needed to be set on these web parts. One of them was a Project ID configured in the webpart properties. The following code enhances and replaces the "Act_CreateProject " method above:  private void Act_CreateProject(SPWeb targetsite, string name, string templateName, string projectId, SPListTemplateCollection temps) {                         var temp = temps.Cast<SPListTemplate>().FirstOrDefault(x => x.Name.Equals(templateName));             if (temp != null)             {                 SPLimitedWebPartManager wpmgr = null;                               try                 {                                         Guid listGuid = targetsite.Lists.Add(name, "", temp);                     SPList newList = targetsite.Lists[listGuid];                     SPFolder rootFolder = newList.RootFolder;                     rootFolder.Properties.Add(KEY, projectId);                     rootFolder.Update();                     if (rootFolder.ParentWeb != targetsite)                         rootFolder.ParentWeb.Dispose();                     if (!templateName.Contains("Natural"))                     {                         SPView alldocumentsview = newList.Views.Cast<SPView>().FirstOrDefault(x => x.Title.Equals(ALLDOCUMENTS));                         SPFile alldocfile = targetsite.GetFile(alldocumentsview.ServerRelativeUrl);                         wpmgr = alldocfile.GetLimitedWebPartManager(PersonalizationScope.Shared);                         ConfigureWebPart(wpmgr, projectId, CUSTOMWPNAME);                                              alldocfile.Update();                     }                                        if (newList.ParentWeb != targetsite)                         newList.ParentWeb.Dispose();                     _globalResult = new ServiceResult(true, "Success", "Success");                 }                 catch (Exception ex)                 {                     _globalResult = new ServiceResult(false, (string.IsNullOrEmpty(ex.Message) ? "None" : ex.Message + " " + templateName), ex.StackTrace.ToString());                 }                 finally                 {                     if (wpmgr != null)                     {                         wpmgr.Web.Dispose();                         wpmgr.Dispose();                     }                 }             }                         }       private void ConfigureWebPart(SPLimitedWebPartManager mgr, string prjId, string webpartname)         {             var wp = mgr.WebParts.Cast<System.Web.UI.WebControls.WebParts.WebPart>().FirstOrDefault(x => x.DisplayTitle.Equals(webpartname));             if (wp != null)             {                           (wp as ListRelationshipWebPart.ListRelationshipWebPart).ProjectID = prjId;                 mgr.SaveChanges(wp);             }         }   This Shows you how I was able to set metadata on the document library. It has to be added to the RootFolder of the document library, Unfortunately, the SPList does not have a Property bag that I can add a key\value pair to. It has to be done on the root folder. Now everything in the integration will reference projects by ID's and will not care about names. My, "DocLibExists" will now need to be changed because a web service is not set up to look at property bags.  I had to write another method on the Service to do the equivalent but with ID's instead of names.  The second thing you will notice about the code is the use of the Webpartmanager. I have seen several examples online, and also read a lot about memory leaks, The above code does not produce memory leaks. The web part manager creates an SPWeb, so just dispose it like I did. CONCLUSION This is a long long post so I will stop here for now, I will continue with more comparisons and limitations in my next post. My conclusion for this example is that Web Services will do the trick if you can suffer through CAML and if you are doing some simple operations. For Everything else, there's WCF! **** fireI apologize for the disorganization of this post, I was on a bus on a 12 hour trip to IOWA while I wrote it, I was half asleep and half awake, hopefully it makes enough sense to someone.

    Read the article

  • ListView setOnItemClickListener and setOnItemSelectedListener to store the Selected Item Index

    - by Christophe
    Hi all, I have read on this site that it is necessary to customize the setOnItemSelectedListener and setOnItemClickListener of a ListView if we want to know the Index of the SelectedItem (.getSelectedItemPosition()). So that is what I do but it does not stores the position of the SekectedItem, instead i have always -1... What I want to do is just to give the user a way to delete items from a list by selected and Item and Clicking a button. See the code below : listViewPeople.setOnItemClickListener(new ListView.OnItemClickListener() { @Override public void onItemClick(AdapterView<?> a, View v, int i, long l) { try { // Remembers the selected Index listViewPeopleId = listViewPeople.getSelectedItemPosition(); } catch(Exception e) { System.out.println("Nay, cannot get the selected index"); } } }); listViewPeople.setOnItemSelectedListener(new ListView.OnItemSelectedListener() { @Override public void onItemSelected(AdapterView<?> a, View v, int i, long l) { try { // Remembers the selected Index listViewPeopleId = listViewPeople.getSelectedItemPosition(); System.out.println("Yay, set the selected index " + listViewPeopleId); } catch(Exception e) { System.out.println("Nay, cannot get the selected index " + listViewPeopleId); } } @Override public void onNothingSelected(AdapterView<?> arg0) { try { // Remembers nothing selected listViewPeopleId = -1; System.out.println("Yay, set that nothing is selected " + listViewPeopleId); } catch(Exception e) { System.out.println("Nay, cannot set that nothing is selected " + listViewPeopleId); } } }); What's wrong?? Thank you for your help! Christophe

    Read the article

  • CA2000 and disposal of WCF client

    - by Mayo
    There is plenty of information out there concerning WCF clients and the fact that you cannot simply rely on a using statement to dispose of the client. This is because the Close method can throw an exception (i.e. if the server hosting the service doesn't respond). I've done my best to implement something that adheres to the numerous suggestions out there. public void DoSomething() { MyServiceClient client = new MyServiceClient(); // from service reference try { client.DoSomething(); } finally { client.CloseProxy(); } } public static void CloseProxy(this ICommunicationObject proxy) { if (proxy == null) return; try { if (proxy.State != CommunicationState.Closed && proxy.State != CommunicationState.Faulted) { proxy.Close(); } else { proxy.Abort(); } } catch (CommunicationException) { proxy.Abort(); } catch (TimeoutException) { proxy.Abort(); } catch { proxy.Abort(); throw; } } This appears to be working as intended. However, when I run Code Analysis in Visual Studio 2010 I still get a CA2000 warning. CA2000 : Microsoft.Reliability : In method 'DoSomething()', call System.IDisposable.Dispose on object 'client' before all references to it are out of scope. Is there something I can do to my code to get rid of the warning or should I use SuppressMessage to hide this warning once I am comfortable that I am doing everything possible to be sure the client is disposed of? Related resources that I've found: http://www.theroks.com/2011/03/04/wcf-dispose-problem-with-using-statement/ http://www.codeproject.com/Articles/151755/Correct-WCF-Client-Proxy-Closing.aspx http://codeguru.earthweb.com/csharp/.net/net_general/tipstricks/article.php/c15941/

    Read the article

  • Camera Preview App in Android throwing many errors (Nexus 4)

    - by Jagatheesan Jack
    I am trying to develop a camera app that takes a picture and saves it in a SQLite database. I get a lot of errors when executing the application. My code is as below. Any idea? CameraActivity.java private Camera mCamera; private CameraPreview mPreview; private int CAMERA_RETURN_CODE=100; private static final String TAG = "Take_Picture"; public static final int MEDIA_TYPE_IMAGE = 1; public static final int MEDIA_TYPE_VIDEO = 2; private Bitmap cameraBmp; private int MAX_FACES = 1; private Face[] faceList; public RectF[] rects; private Canvas canvas; private Drawable pictureDataDrawable; private MySQLiteHelper database; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.camera_activity); //this.requestWindowFeature(Window.FEATURE_NO_TITLE); //Create an instance of Camera mCamera = getCameraInstance(); setCameraDisplayOrientation(this, 0, mCamera); // Create our Preview view and set it as the content of our activity. mPreview = new CameraPreview(this, mCamera); FrameLayout preview = (FrameLayout) findViewById(R.id.camera_preview); preview.addView(mPreview); database = new MySQLiteHelper(getApplicationContext()); Button captureButton = (Button) findViewById(R.id.button_capture); captureButton.setOnClickListener( new View.OnClickListener() { private PictureCallback mPicture; @Override public void onClick(View v) { //mCamera.startPreview(); // get an image from the camera mCamera.takePicture(null, null, mPicture); PictureCallback mPicture = new PictureCallback() { @Override public void onPictureTaken(byte[] data, Camera camera) { try{ if (data != null) database.addEntry(data); //mCamera.startPreview(); } catch(Exception e){ Log.d(TAG, e.getMessage()); } } } ); } /** A safe way to get an instance of the Camera object. */ public static Camera getCameraInstance(){ Camera c = null; try { c = Camera.open(c.getNumberOfCameras()-1); // attempt to get a Camera instance } catch (Exception e){ // Camera is not available (in use or does not exist) } return c; // returns null if camera is unavailable } public static void setCameraDisplayOrientation(Activity activity, int cameraId, android.hardware.Camera camera) { android.hardware.Camera.CameraInfo info = new android.hardware.Camera.CameraInfo(); android.hardware.Camera.getCameraInfo(cameraId, info); int rotation = activity.getWindowManager().getDefaultDisplay() .getRotation(); int degrees = 360; /*switch (rotation) { case Surface.ROTATION_0: degrees = 0; break; case Surface.ROTATION_90: degrees = 90; break; case Surface.ROTATION_180: degrees = 180; break; case Surface.ROTATION_270: degrees = 270; break; }*/ int result; if (info.facing == Camera.CameraInfo.CAMERA_FACING_FRONT) { result = (info.orientation + degrees) % 360; result = (360 - result) % 360; // compensate the mirror } else { // back-facing result = (info.orientation - degrees + 360) % 360; } camera.setDisplayOrientation(result); } @Override protected void onPause() { super.onPause(); //releaseMediaRecorder(); // if you are using MediaRecorder, release it first releaseCamera(); // release the camera immediately on pause event } private void releaseCamera(){ if (mCamera != null){ mCamera.release(); // release the camera for other applications mCamera = null; } } public void startFaceDetection(){ // Try starting Face Detection Camera.Parameters params = mCamera.getParameters(); // start face detection only *after* preview has started if (params.getMaxNumDetectedFaces() > 0){ // camera supports face detection, so can start it: mCamera.startFaceDetection(); } } CameraPreview.java public class CameraPreview extends SurfaceView implements SurfaceHolder.Callback { private SurfaceHolder mHolder; private Camera mCamera; private String TAG; private List<Size> mSupportedPreviewSizes; public CameraPreview(Context context, Camera camera) { super(context); mCamera = camera; // Install a SurfaceHolder.Callback so we get notified when the // underlying surface is created and destroyed. mHolder = getHolder(); mHolder.addCallback(this); // deprecated setting, but required on Android versions prior to 3.0 mHolder.setType(SurfaceHolder.SURFACE_TYPE_PUSH_BUFFERS); } public void surfaceCreated(SurfaceHolder holder) { // The Surface has been created, now tell the camera where to draw the preview. try { mCamera.setPreviewDisplay(holder); mCamera.setDisplayOrientation(90); mCamera.startPreview(); } catch (IOException e) { Log.d(TAG, "Error setting camera preview: " + e.getMessage()); } } public void surfaceDestroyed(SurfaceHolder holder) { // empty. Take care of releasing the Camera preview in your activity. } public void surfaceChanged(SurfaceHolder holder, int format, int w, int h) { // If your preview can change or rotate, take care of those events here. // Make sure to stop the preview before resizing or reformatting it. if (mHolder.getSurface() == null){ // preview surface does not exist return; } // stop preview before making changes try { mCamera.stopPreview(); } catch (Exception e){ // ignore: tried to stop a non-existent preview } try { mCamera.setPreviewDisplay(mHolder); mCamera.startPreview(); } catch (Exception e){ Log.d(TAG, "Error starting camera preview: " + e.getMessage()); } } public void setCamera(Camera camera) { if (mCamera == camera) { return; } mCamera = camera; if (mCamera != null) { List<Size> localSizes = mCamera.getParameters().getSupportedPreviewSizes(); mSupportedPreviewSizes = localSizes; requestLayout(); try { mCamera.setPreviewDisplay(mHolder); } catch (IOException e) { e.printStackTrace(); } /* Important: Call startPreview() to start updating the preview surface. Preview must be started before you can take a picture. */ mCamera.startPreview(); } } MySQLiteHelper.java private static final int count = 0; public static final String TABLE_IMAGE = "images"; public static final String COLUMN_ID = "_id"; public static final String PICTURE_DATA = "picture"; public static final String DATABASE_NAME = "images.db"; public static final int DATABASE_VERSION = 1; public static final String DATABASE_CREATE = "create table " + TABLE_IMAGE + "(" + COLUMN_ID + " integer primary key autoincrement, " + PICTURE_DATA + " blob not null);"; public static SQLiteDatabase database; private static String TAG = "test"; public MySQLiteHelper(Context context) { super(context, DATABASE_NAME, null, DATABASE_VERSION); // TODO Auto-generated constructor stub } public MySQLiteHelper(Context context, String name, CursorFactory factory, int version, DatabaseErrorHandler errorHandler) { super(context, name, factory, version, errorHandler); // TODO Auto-generated constructor stub } @Override public void onCreate(SQLiteDatabase database) { database.execSQL(DATABASE_CREATE); } @Override public void onUpgrade(SQLiteDatabase db, int oldVersion, int newVersion) { Log.w(MySQLiteHelper.class.getName(), "Upgrading database from version " + oldVersion + " to " + newVersion + ", which will destroy all old data"); db.execSQL("DROP TABLE IF EXISTS " + TABLE_IMAGE); onCreate(db); } /** * @param args */ public static void main(String[] args) { // TODO Auto-generated method stub } public void addEntry(byte [] array) throws SQLiteException{ ContentValues cv = new ContentValues(); //cv.put(KEY_NAME, name); cv.put(PICTURE_DATA, array); database.insert( TABLE_IMAGE, null, cv ); Log.w(TAG , "added " +count+ "images"); database.close(); } Errors 11-07 23:28:39.050: E/mm-libcamera2(176): PROFILE HAL: stopPreview(): E: 1383838119.067589459 11-07 23:28:39.050: E/mm-camera(201): config_MSG_ID_STOP_ACK: streamon_mask is not clear. Should not call PP_Release_HW 11-07 23:28:39.090: E/QCameraHWI(176): android::status_t android::QCameraHardwareInterface::setPreviewWindow(preview_stream_ops_t*):Received Setting NULL preview window 11-07 23:28:39.090: E/QCameraHWI(176): android::status_t android::QCameraHardwareInterface::setPreviewWindow(preview_stream_ops_t*): mPreviewWindow = 0x0x0, mStreamDisplay = 0x0xb8a9df90 11-07 23:28:39.090: E/mm-camera(201): config_shutdown_pp Camera not in streaming mode. Returning. 11-07 23:28:39.090: E/mm-camera(201): vfe_ops_deinit: E 11-07 23:28:39.120: E/qcom_sensors_hal(533): hal_process_report_ind: Bad item quality: 11 11-07 23:28:39.310: E/qcom_sensors_hal(533): hal_process_report_ind: Bad item quality: 11 11-07 23:28:39.330: E/mm-camera(201): sensor_load_chromatix: libchromatix_imx119_preview.so: 30 11-07 23:28:39.340: E/mm-camera(201): vfe_ops_init: E 11-07 23:28:39.360: E/mm-camera(201): vfe_legacy_stats_buffer_init: AEC_STATS_BUFNUM 11-07 23:28:39.360: E/mm-camera(201): vfe_legacy_stats_buffer_init: AEC_STATS_BUFNUM 11-07 23:28:39.360: E/mm-camera(201): mctl_init_stats_proc_info: snap_max_line_cnt =25776 11-07 23:28:39.440: E/QCameraHWI(176): android::status_t android::QCameraHardwareInterface::setPreviewWindow(preview_stream_ops_t*): mPreviewWindow = 0x0xb8aa1780, mStreamDisplay = 0x0xb8a9df90 11-07 23:28:39.440: E/mm-camera(201): config_proc_CAMERA_SET_INFORM_STARTPREVIEW 11-07 23:28:39.450: E/mm-camera(201): config_update_stream_info Storing stream parameters for video inst 1 as : width = 640, height 480, format = 1 inst_handle = 810081 cid = 0 11-07 23:28:39.490: E/mm-camera(201): config_update_stream_info Storing stream parameters for video inst 3 as : width = 640, height 480, format = 1 inst_handle = 830083 cid = 0 11-07 23:28:39.490: E/mm-camera(201): config_update_stream_info Storing stream parameters for video inst 4 as : width = 512, height 384, format = 1 inst_handle = 840084 cid = 0 11-07 23:28:39.500: E/mm-camera(201): config_decide_vfe_outputs: Ports Used 3, Op mode 1 11-07 23:28:39.500: E/mm-camera(201): config_decide_vfe_outputs Current mode 0 Full size streaming : Disabled 11-07 23:28:39.500: E/mm-camera(201): config_decide_vfe_outputs: Primary: 640x480, extra_pad: 0x0, Fmt: 1, Type: 1, Path: 1 11-07 23:28:39.500: E/mm-camera(201): config_decide_vfe_outputs: Secondary: 640x480, extra_pad: 0x0, Fmt: 1, Type: 3, Path: 4 11-07 23:28:39.510: E/mm-camera(201): config_update_inst_handles Updated the inst handles as 810081, 830083, 0, 0 11-07 23:28:39.631: E/mm-camera(201): sensor_load_chromatix: libchromatix_imx119_preview.so: 30 11-07 23:28:39.631: E/mm-camera(201): camif_client_set_params: camif has associated with obj mask 0x1 11-07 23:28:39.631: E/mm-camera(201): config_v2_CAMERA_START_common CAMIF_PARAMS_ADD_OBJ_ID failed -1 11-07 23:28:39.641: E/mm-camera(201): vfe_operation_config: format 3 11-07 23:28:39.641: E/mm-camera(201): vfe_operation_config:vfe_op_mode=5 11-07 23:28:39.641: E/mm-camera(201): Invalid ASD Set Params Type 11-07 23:28:39.641: E/mm-camera(201): vfe_set_bestshot: Bestshot mode not changed

    Read the article

< Previous Page | 32 33 34 35 36 37 38 39 40 41 42 43  | Next Page >