Search Results

Search found 33650 results on 1346 pages for 'line break'.

Page 367/1346 | < Previous Page | 363 364 365 366 367 368 369 370 371 372 373 374  | Next Page >

  • Adding Debian Sid as Package Repository?

    - by user1131467
    I am running 12.04 Precise beta (upgraded from 11.10 Oneiric) and I added the following line to my /etc/apt/source.list: deb http://http.us.debian.org/debian unstable main contrib non-free In order to get a newer version of a package (octave 3.6) that I needed but was not available in the precise repository. This worked fine, but now when I want to upgrade there is a large number of packages that need to get updated. I assume this is because sid has newer versions of many of the packages than precise. I've temporarily disabled the sid repository, and this works fine - however I am curious to know what would happen if I allowed all those upgrades to go through? Would it break my system? Are the structures of Ubuntu Precise and Debian Sid repositories fundamentally different somehow?

    Read the article

  • Can this word search algorithm be made faster?

    - by Ashwin Singh
    Problem: Find a match of word S in text T Given: S and T are part of spoken and written English. Example: Match 'Math' in 'I love Mathematics' NOTE: Ignore CASES. My algorithm: STEP 1) Convert S, T to char[] STEP 2) for i=0, i < T.length , i++ STEP 3) for j=S.length-1, j>0 , j-- STEP 3 is the magic, instead of going about matching M,A,T,H, this matches M, H, T and finally A. This helps in eliminating a lot of possible partial matches. For example, if I go sequentially like M A as in Boyer Moore's method ... it can match Matter, Mass, Matchstick etc. using M _ _ H will bring down size of partial matches. STEP 4) if S[j]!=T[i] -> break; else if j==i -> PRINT MATCH

    Read the article

  • ASP.NET AJAX Release History : Q1 2010 SP2 (version 2010.1.519)

    Common for all controls What's Fixed Fixed: Problem with RegisterWithScriptManager=false (MVC) and browsers without gzip support Fixed: $telerik.getLocation implementation, in case the element is a child of an element with position:fixed Visual Studio Extensions What's New Improved: Visual Studio 2010 support for upgrade notifications What's Fixed Fixed: Code language selection in WebSite does not work. RadAjax What's Fixed Fixed: RadAjax controls break on AJAX callback with ToolkitScriptManager...Did you know that DotNetSlackers also publishes .net articles written by top known .net Authors? We already have over 80 articles in several categories including Silverlight. Take a look: here.

    Read the article

  • MVC 3 Remote Validation jQuery error on submit

    - by Richard Reddy
    I seem to have a weird issue with remote validation on my project. I am doing a simple validation check on an email field to ensure that it is unique. I've noticed that unless I put the cursor into the textbox and then remove it to trigger the validation at least once before submitting my form I will get a javascript error. e[h] is not a function jquery.min.js line 3 If I try to resubmit the form after the above error is returned everything works as expected. It's almost like the form tried to submit before waiting for the validation to return or something. Am I required to silently fire off a remote validation request on submit before submitting my form? Below is a snapshot of the code I'm using: (I've also tried GET instead of POST but I get the same result). As mentioned above, the code works fine but the form returns a jquery error unless the validation is triggered at least once. Model: public class RegisterModel { [Required] [Remote("DoesUserNameExist", "Account", HttpMethod = "POST", ErrorMessage = "User name taken.")] [Display(Name = "User name")] public string UserName { get; set; } [Required] [Display(Name = "Firstname")] public string Firstname { get; set; } [Display(Name = "Surname")] public string Surname { get; set; } [Required] [Remote("DoesEmailExist", "Account", HttpMethod = "POST", ErrorMessage = "Email taken.", AdditionalFields = "UserName")] [Display(Name = "Email address")] public string Email { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Password")] public string Password { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Confirm password")] public string ConfirmPassword { get; set; } [Display(Name = "Approved?")] public bool IsApproved { get; set; } } public class UserRoleModel { [Display(Name = "Assign Roles")] public IEnumerable<RoleViewModel> AllRoles { get; set; } public RegisterModel RegisterUser { get; set; } } Controller: // POST: /Account/DoesEmailExist // passing in username so that I can ignore the same email address for the same user on edit page [HttpPost] public JsonResult DoesEmailExist([Bind(Prefix = "RegisterUser.Email")]string Email, [Bind(Prefix = "RegisterUser.UserName")]string UserName) { var user = Membership.GetUserNameByEmail(Email); if (!String.IsNullOrEmpty(UserName)) { if (user == UserName) return Json(true); } return Json(user == null); } View: <script src="//ajax.googleapis.com/ajax/libs/jquery/1.7.1/jquery.min.js" type="text/javascript"></script> <script src="//ajax.googleapis.com/ajax/libs/jqueryui/1.8.17/jquery-ui.min.js" type="text/javascript"></script> <script type="text/javascript" src="/Content/web/js/jquery.unobtrusive-ajax.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.unobtrusive.min.js"></script> ...... @using (Html.BeginForm()) { @Html.AntiForgeryToken() <div class="titleh"> <h3>Edit a user account</h3> </div> <div class="body"> @Html.HiddenFor(model => model.RegisterUser.UserName) @Html.Partial("_CreateOrEdit", Model) <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(model => model.RegisterUser.IsApproved)</span> @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, true, new { @class = "uniform" }) Active @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, false, new { @class = "uniform" }) Disabled <div class="clear"></div> </div> <div class="button-box"> <input type="submit" name="submit" value="Save" class="st-button"/> @Html.ActionLink("Back to List", "Index", null, new { @class = "st-clear" }) </div> </div> } CreateEdit Partial View @model Project.Domain.Entities.UserRoleModel <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Firstname)</span> @Html.TextBoxFor(m => m.RegisterUser.Firstname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Firstname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Surname)</span> @Html.TextBoxFor(m => m.RegisterUser.Surname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Surname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Email)</span> @Html.TextBoxFor(m => m.RegisterUser.Email, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Email) <div class="clear"></div> </div> Thanks, Rich

    Read the article

  • Issues with the intended behavior of a Service layer?

    - by Rafael Cichocki
    This analysis makes sense, and states anything that avoids code duplication and simplifies maintenance speaks for a service layer. What is the technical behavior? When a service client references a service, does it do so at runtime, or does it happen at compile time? When I change something in the service layer code, will this change be automatically taken into account in all it's clients, or do they need to be individually recompiled? How does this make sense from a testing point of view - I have working code, based on some code from a service, but if that service changes, my code might break?!

    Read the article

  • What approaches can I take to lower the odds of introducing new bugs in a complex legacy app?

    - by m.edmondson
    Where I work I often have to develop (and bug fix) in an old system (.NET 1) whos code is complete spaghetti - with little thought given to variable names, program structure nor comments. Because of this it takes me ages to understand what bits need changed, and I often 'break' the existing software because I've made a modification. I really really want to spend a couple of months (with colleagues) going through it to refactor but existing developers both can't see the need - nor think theres time for this (the system is massive). I dread having to work on its code as it takes days to fix something only to find out I've broken something else. This obviously makes me look incompetent - so how can I deal with this?

    Read the article

  • Keep a programming language backwards compatible vs. fixing its flaws

    - by Radu Murzea
    First, some context (stuff that most of you know anyway): Every popular programming language has a clear evolution, most of the time marked by its version: you have Java 5, 6, 7 etc., PHP 5.1, 5.2, 5.3 etc. Releasing a new version makes new APIs available, fixes bugs, adds new features, new frameworks etc. So all in all: it's good. But what about the language's (or platform's) problems? If and when there's something wrong in a language, developers either avoid it (if they can) or they learn to live with it. Now, the developers of those languages get a lot of feedback from the programmers that use them. So it kind of makes sense that, as time (and version numbers) goes by, the problems in those languages will slowly but surely go away. Well, not really. Why? Backwards compatibility, that's why. But why is this so? Read below for a more concrete situation. The best way I can explain my question is to use PHP as an example: PHP is loved thousands of people and hated by just as many thousands. All languages have flaws, but apparently PHP is special. Check out this blog post. It has a very long list of so called flaws in PHP. Now, I'm not a PHP developer (not yet), but I read through all of it and I'm sure that a big chunk of that list are indeed real issues. (Not all of it, since it's potentially subjective). Now, if I was one of the guys who actively develops PHP, I would surely want to fix those problems, one by one. However, if I do that, then code that relies on a particular behaviour of the language will break if it runs on the new version. Summing it up in 2 words: backwards compatibility. What I don't understand is: why should I keep PHP backwards compatible? If I release PHP version 8 with all those problems fixed, can't I just put a big warning on it saying: "Don't run old code on this version !"? There is a thing called deprecation. We had it for years and it works. In the context of PHP: look at how these days people actively discourage the use of the mysql_* functions (and instead recommend mysqli_* and PDO). Deprecation works. We can use it. We should use it. If it works for functions, why shouldn't it work for entire languages? Let's say I (the developer of PHP) do this: Launch a new version of PHP (let's say 8) with all of those flaws fixed New projects will start using that version, since it's much better, clearer, more secure etc. However, in order not to abandon older versions of PHP, I keep releasing updates to it, fixing security issues, bugs etc. This makes sense for reasons that I'm not listing here. It's common practice: look for example at how Oracle kept updating version 5.1.x of MySQL, even though it mostly focused on version 5.5.x. After about 3 or 4 years, I stop updating old versions of PHP and leave them to die. This is fine, since in those 3 or 4 years, most projects will have switched to PHP 8 anyway. My question is: Do all these steps make sense? Would it be so hard to do? If it can be done, then why isn't it done? Yes, the downside is that you break backwards compatibility. But isn't that a price worth paying ? As an upside, in 3 or 4 years you'll have a language that has 90 % of its problems fixed.... a language much more pleasant to work with. Its name will ensure its popularity. EDIT: OK, so I didn't expressed myself correctly when I said that in 3 or 4 years people will move to the hypothetical PHP 8. What I meant was: in 3 or 4 years, people will use PHP 8 if they start a new project.

    Read the article

  • How should I manage a team with different skill levels?

    - by Jon Purdy
    I'll be working on a software project with some friends of mine, and I've been appointed technical lead. None of these guys is a bad programmer at all, but I do have significantly more experience than them. I need to be able to distribute the work among everyone on the team, while also making sure that we don't tread on one another's toes; that they meet the relatively high standards of quality and scalability that we need to make this project successful, without requiring me to review everything they commit. How should I maintain standards while avoiding micromanagement? Is it enough to make some diagrams, schedule some code reviews, and trust that I'll be able to fix anything that they might break, or should I go the TDD route and write explicit tests for the team to satisfy?

    Read the article

  • Google Webmasters tools crawl error caused by URL split into two lines

    - by Shiro
    I am looking in to Google Webmaster Tools - Crawl Error section. How should I handle for those URL due their system / application showed invalid URL. e.g http://www.example/images/products/s_=enlarge_16gb.jpg but, I dunno what happen to yahoo groups, it break the link into http://www.example/images/products/s_= enlarge_16gb.jpg and I only make the top part become hyperlink, which is http://www.example/images/products/s_= Because of the URL, Google show crawl error, I got few error because of this kind of result or because other people typo error. How do I prevent this. I am sure I don't have the right go and change other people post. What is the solution for this. Thanks!

    Read the article

  • Does anybody know what happens to money spent in the Ubuntu One Music Store?

    - by Dave
    I remember reading on the Canonical website around the launch of the Ubuntu One Music store that after revenue was divided between Canonical, 7 digital and the artists involved that all profit or a significant percentage would be donated to a charity. This information has either disappeared from their website or my detective skills have failed me once more. Does anybody happen to understand the break down of revenue generated by the Ubuntu One Music Store or even know where to find this information. Also it would be useful to know which charity benefits from this. (Not that that would impact upon my purchases or send me running to iTunes. ;) Promise)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • In the context of semantic versioning, does a change in the default configuration warrant a new major version?

    - by michielvoo
    My module is enabled by default (i.e. when you add the module). There's also a configuration you can optionally use, which supports an enabled="true|false" setting. This way the module can be disabled after it's been added, without the need to remove the module. But I realized the module doesn't play nicely with another module that is also enabled by default. I am considering changing my module so it's not be enabled by default. This would break for anyone that has not explicitly enabled it with the enabled="true" configuration setting. Should I wait for v2.0 for this? semver.org mentions the public API and breaking changes, not configuration. Is it generally accepted that configuration is part of the public API?

    Read the article

  • Android Bitmap : collision Detecting [on hold]

    - by user2505374
    I am writing an Android game right now and I would need some help in the collision of the wall on screen. When I drag the ball in the top and right it able to collide in wall but when I drag it faster it was able to overlap in the wall. public boolean onTouchEvent(MotionEvent event) { int x = (int) event.getX(); int y = (int) event.getY(); switch (event.getAction()) { // if the player moves case MotionEvent.ACTION_MOVE: { if (playerTouchRect.contains(x, y)) { boolean left = false; boolean right = false; boolean up = false; boolean down = false; boolean canMove = false; boolean foundFinish = false; if (x != pLastXPos) { if (x < pLastXPos) { left = true; } else { right = true; } pLastXPos = x; } if (y != pLastYPos) { if (y < pLastYPos) { up = true; } else { down = true; } pLastYPos = y; } plCellRect = getRectFromPos(x, y); newplRect.set(playerRect); newplRect.left = x - (int) (playerRect.width() / 2); newplRect.right = x + (int) (playerRect.width() / 2); newplRect.top = y - (int) (playerRect.height() / 2); newplRect.bottom = y + (int) (playerRect.height() / 2); int currentRow = 0; int currentCol = 0; currentRow = getRowFromYPos(newplRect.top); currentCol = getColFromXPos(newplRect.right); if(!canMove){ canMove = mapManager.getCurrentTile().pMaze[currentRow][currentCol] == Cell.wall; canMove =true; } finishTest = mapManager.getCurrentTile().pMaze[currentRow][currentCol]; foundA = finishTest == Cell.valueOf(letterNotGet + ""); canMove = mapManager.getCurrentTile().pMaze[currentRow][currentCol] != Cell.wall; canMove = (finishTest == Cell.floor || finishTest == Cell.pl) && canMove; if (canMove) { invalidate(); setTitle(); } if (foundA) { mapManager.getCurrentTile().pMaze[currentRow][currentCol] = Cell.floor; // finishTest letterGotten.add(letterNotGet); playCurrentLetter(); /*sounds.play(sExplosion, 1.0f, 1.0f, 0, 0, 1.5f);*/ foundS = letterNotGet == 's'; letterNotGet++; }if(foundS){ AlertDialog.Builder builder = new AlertDialog.Builder(mainActivity); builder.setTitle(mainActivity.getText(R.string.finished_title)); LayoutInflater inflater = mainActivity.getLayoutInflater(); View view = inflater.inflate(R.layout.finish, null); builder.setView(view); View closeButton =view.findViewById(R.id.closeGame); closeButton.setOnClickListener(new OnClickListener() { @Override public void onClick(View clicked) { if(clicked.getId() == R.id.closeGame) { mainActivity.finish(); } } }); AlertDialog finishDialog = builder.create(); finishDialog.show(); } else { Log.d(TAG, "INFO: updated player position"); playerRect.set(newplRect); setTouchZone(); updatePlayerCell(); } } // end of (CASE) if playerTouch break; } // end of (SWITCH) Case motion }//end of Switch return true; }//end of TouchEvent private void finish() { // TODO Auto-generated method stub } public int getColFromXPos(int xPos) { val = xPos / (pvWidth / mapManager.getCurrentTile().pCols); if (val == mapManager.getCurrentTile().pCols) { val = mapManager.getCurrentTile().pCols - 1; } return val; } /** * Given a y pixel position, return the row of the cell it is in This is * used when determining the type of adjacent Cells. * * @param yPos * y position in pixels * @return The cell this position is in */ public int getRowFromYPos(int yPos) { val = yPos / (pvHeight / mapManager.getCurrentTile().pRows); if (val == mapManager.getCurrentTile().pRows) { val = mapManager.getCurrentTile().pRows - 1; } return val; } /** * When preserving the position we need to know which cell the player is in, * so calculate it from the centre on its Rect */ public void updatePlayerCell() { plCell.x = (playerRect.left + (playerRect.width() / 2)) / (pvWidth / mapManager.getCurrentTile().pCols); plCell.y = (playerRect.top + (playerRect.height() / 2)) / (pvHeight / mapManager.getCurrentTile().pRows); if (mapManager.getCurrentTile().pMaze[plCell.y][plCell.x] == Cell.floor) { for (int row = 0; row < mapManager.getCurrentTile().pRows; row++) { for (int col = 0; col < mapManager.getCurrentTile().pCols; col++) { if (mapManager.getCurrentTile().pMaze[row][col] == Cell.pl) { mapManager.getCurrentTile().pMaze[row][col] = Cell.floor; break; } } } mapManager.getCurrentTile().pMaze[plCell.y][plCell.x] = Cell.pl; } } public Rect getRectFromPos(int x, int y) { calcCell.left = ((x / cellWidth) + 0) * cellWidth; calcCell.right = calcCell.left + cellWidth; calcCell.top = ((y / cellHeight) + 0) * cellHeight; calcCell.bottom = calcCell.top + cellHeight; Log.d(TAG, "Rect: " + calcCell + " Player: " + playerRect); return calcCell; } public void setPlayerRect(Rect newplRect) { playerRect.set(newplRect); } private void setTouchZone() { playerTouchRect.set( playerRect.left - playerRect.width() / TOUCH_ZONE, playerRect.top - playerRect.height() / TOUCH_ZONE, playerRect.right + playerRect.width() / TOUCH_ZONE, playerRect.bottom + playerRect.height() / TOUCH_ZONE); } public Rect getPlayerRect() { return playerRect; } public Point getPlayerCell() { return plCell; } public void setPlayerCell(Point cell) { plCell = cell; }

    Read the article

  • Breaking 1NF to model subset constraints. Does this sound sane?

    - by Chris Travers
    My first question here. Appologize if it is in the wrong forum but this seems pretty conceptual. I am looking at doing something that goes against conventional wisdom and want to get some feedback as to whether this is totally insane or will result in problems, so critique away! I am on PostgreSQL 9.1 but may be moving to 9.2 for this part of this project. To re-iterate: Does it seem sane to break 1NF in this way? I am not looking for debugging code so much as where people see problems that this might lead. The Problem In double entry accounting, financial transactions are journal entries with an arbitrary number of lines. Each line has either a left value (debit) or a right value (credit) which can be modelled as a single value with negatives as debits and positives as credits or vice versa. The sum of all debits and credits must equal zero (so if we go with a single amount field, sum(amount) must equal zero for each financial journal entry). SQL-based databases, pretty much required for this sort of work, have no way to express this sort of constraint natively and so any approach to enforcing it in the database seems rather complex. The Write Model The journal entries are append only. There is a possibility we will add a delete model but it will be subject to a different set of restrictions and so is not applicable here. If and when we allow deletes, we will probably do them using a simple ON DELETE CASCADE designation on the foreign key, and require that deletes go through a dedicated stored procedure which can enforce the other constraints. So inserts and selects have to be accommodated but updates and deletes do not for this task. My Proposed Solution My proposed solution is to break first normal form and model constraints on arrays of tuples, with a trigger that breaks the rows out into another table. CREATE TABLE journal_line ( entry_id bigserial primary key, account_id int not null references account(id), journal_entry_id bigint not null, -- adding references later amount numeric not null ); I would then add "table methods" to extract debits and credits for reporting purposes: CREATE OR REPLACE FUNCTION debits(journal_line) RETURNS numeric LANGUAGE sql IMMUTABLE AS $$ SELECT CASE WHEN $1.amount < 0 THEN $1.amount * -1 ELSE NULL END; $$; CREATE OR REPLACE FUNCTION credits(journal_line) RETURNS numeric LANGUAGE sql IMMUTABLE AS $$ SELECT CASE WHEN $1.amount > 0 THEN $1.amount ELSE NULL END; $$; Then the journal entry table (simplified for this example): CREATE TABLE journal_entry ( entry_id bigserial primary key, -- no natural keys :-( journal_id int not null references journal(id), date_posted date not null, reference text not null, description text not null, journal_lines journal_line[] not null ); Then a table method and and check constraints: CREATE OR REPLACE FUNCTION running_total(journal_entry) returns numeric language sql immutable as $$ SELECT sum(amount) FROM unnest($1.journal_lines); $$; ALTER TABLE journal_entry ADD CONSTRAINT CHECK (((journal_entry.running_total) = 0)); ALTER TABLE journal_line ADD FOREIGN KEY journal_entry_id REFERENCES journal_entry(entry_id); And finally we'd have a breakout trigger: CREATE OR REPLACE FUNCTION je_breakout() RETURNS TRIGGER LANGUAGE PLPGSQL AS $$ BEGIN IF TG_OP = 'INSERT' THEN INSERT INTO journal_line (journal_entry_id, account_id, amount) SELECT NEW.id, account_id, amount FROM unnest(NEW.journal_lines); RETURN NEW; ELSE RAISE EXCEPTION 'Operation Not Allowed'; END IF; END; $$; And finally CREATE TRIGGER AFTER INSERT OR UPDATE OR DELETE ON journal_entry FOR EACH ROW EXECUTE_PROCEDURE je_breaout(); Of course the example above is simplified. There will be a status table that will track approval status allowing for separation of duties, etc. However the goal here is to prevent unbalanced transactions. Any feedback? Does this sound entirely insane? Standard Solutions? In getting to this point I have to say I have looked at four different current ERP solutions to this problems: Represent every line item as a debit and a credit against different accounts. Use of foreign keys against the line item table to enforce an eventual running total of 0 Use of constraint triggers in PostgreSQL Forcing all validation here solely through the app logic. My concerns are that #1 is pretty limiting and very hard to audit internally. It's not programmer transparent and so it strikes me as being difficult to work with in the future. The second strikes me as being very complex and required a series of contraints and foreign keys against self to make work, and therefore it strikes me as complex, hard to sort out at least in my mind, and thus hard to work with. The fourth could be done as we force all access through stored procedures anyway and this is the most common solution (have the app total things up and throw an error otherwise). However, I think proof that a constraint is followed is superior to test cases, and so the question becomes whether this in fact generates insert anomilies rather than solving them. If this is a solved problem it isn't the case that everyone agrees on the solution....

    Read the article

  • Doing practice jobsearch/technical interviews?

    - by Beekguk
    I graduated college last year & I've never gone through the interview process - my current programming position evolved out of projects I did in school, but in a few months I'm making a clean break and moving across the country so I'm going to have to face a "grown-up" jobsearch. I'm kind of scared of technical interviews - I think I'm pretty good at my job and my hobby programming projects ... but what if it turns out I'm part of that group that thinks they're qualified, but really just cause despair at the state of education in the hearts of interviewers? So, I'm thinking of doing a "practice" job hunt in my current city to get an idea of what it's like and what kind of experience/expertise employers are really looking for. Is this a dick move ethically (applying to/interviewing for jobs I can't take)? If so, is there another good way to prepare for technical interviews, especially those little trick puzzle-type questions?

    Read the article

  • Why is Ubuntu unmounting my primary hard drive?

    - by Twisol
    I'm running Ubuntu 10.10 on my laptop (an Asus G73j), dual-booting Windows 7 if that matters. After using the computer for couple of hours or so, I get a popup complaining that a file was unmounted, then my GNOME desktop panels disappear. I can't save any unsaved work (the file browser shows "Filesystem" as totally empty), and other programs break in odd ways (like Chrome can't browse to any new pages, but keeps current ones going... at least I still have Pandora to listen to when this happens!). I've tried looking in the system logs to no avail; I'm assuming that it can't write any errors to the logs because, of course, the logs are on the primary hard drives. This started happening maybe a few days ago. Yesterday I upgraded from 10.4, but I believe it was happening before then. Any advice for figuring this out?

    Read the article

  • OOP private method parameters coding style

    - by Jake
    After coding for many years as a solo programmer, I have come to feel that most of the time there are many benefits to write private member functions with all of the used member variables included in the parameter list, especially development stage. This allow me to check at one look what member variables are used and also allow me to supply other values for tests and debugging. Also, a change in code by removing a particular member variable can break many functions. In this case however, the private function remains isolated am I can still call it using other values without fixing the function. Is this a bad idea afterall, especially in a team environment? Is it like redundant or confusing, or are there better ways?

    Read the article

  • General solution to solve different sports results in different languages

    - by sq2
    I currently have some code that checks if squash and tennis scores are valid, both in javascript and PHP. This results in 4 blocks of code existing, 2 languages * 2 sports, which does not scale well should any extra sports come around, or extra languages... How can one describe the valid scores of games via a settings/text file, so that each language can parse them and apply these rules. I'm stumped with the strange tie break situations in tennis should it reach 6-6 in a set, and also infinite play off in the final set should it reach 2 sets all. ie: tennis = { "format": [ { "name": "sets" "min": 3, "max": 5, "winby": 1 }, { "name": "games" "min": 6, "max": 7, "winby": 2 } ] } squash = { "format": [ { "name": "games" "min": 3, "max": 5, "winby": 1 }, { "name": "points" "min": 15, "max": 0, "winby": 2 } ] }

    Read the article

  • Webcast WebCenter Content, April 11th, 2012

    - by rituchhibber
    Our next WebCenter Content webcast will be on April 10th, 2012. This WebCast will help you to prepare yourself for the WebCenter Content Certified Implementation Specialist EXAM. Webcast Details: Date Topic Speaker Web Call Details Intercall Details  April 10th                WebCenter Content   Refresh     Course      Markus NeubauerSilburyWebCenter ContentSpecialized Partner Join Webcast Dial-in numbers:CC/SP: 1579222/9221 Time: 12:00 -15:00 CET Break around 13:30 Conference ID/Key: 9819145/1004 For more details, please click here.

    Read the article

  • How To Install and Use ADB, the Android Debug Bridge Utility

    - by Chris Hoffman
    ADB, Android Debug Bridge, is a command-line utility included with Google’s Android SDK. ADB can control your device over USB from a computer, copy files back and forth, install and uninstall apps, run shell commands, and more. We’ve covered some other tricks that require ADB in the past, including backing up and restoring your smartphone or tablet and installing Android apps to your SD card by default. ADB is used for a variety of geeky Android tricks. Image Credit: LAI Ryanne on Flickr HTG Explains: How Antivirus Software Works HTG Explains: Why Deleted Files Can Be Recovered and How You Can Prevent It HTG Explains: What Are the Sys Rq, Scroll Lock, and Pause/Break Keys on My Keyboard?

    Read the article

  • Unable to access the server via SSH?

    - by Rishee
    when I am trying to access the server through ssh it says: ssh: connect to host xx.yyy.zzz.x port 22: Connection refused and on the server in auth.log it shows following log entry: Address xx.yyy.zzz.x maps to xx.yyy.zzz.x.static-pune-vsnl.net.in, but this does not map back to the address - POSSIBLE BREAK-IN ATTEMPT! I have created a user account for that user and it is also in enabled status. Requested info It is Ubuntu 11.10 It is configured as SSH Server using openssh-server I am trying to connect to this server using Putty from Windows 7 i.e. My Desktop I have also asked this in superuser as per the request of @zpletan and link to that question is given below. http://superuser.com/questions/408080/unable-to-access-the-server-via-ssh Thanks in advance.

    Read the article

  • HTG Explains: How System Restore Works in Windows

    - by Chris Hoffman
    System Restore is a Windows feature that can help fix some crashes and other computer problems. To know when to use it, you’ll have to understand just how System Restore works. System Restore can’t solve every problem – for example, you can’t use it to restore your personal files if they’re accidentally deleted or modified. However, it’s another tool you can use when your computer isn’t working properly. HTG Explains: How Antivirus Software Works HTG Explains: Why Deleted Files Can Be Recovered and How You Can Prevent It HTG Explains: What Are the Sys Rq, Scroll Lock, and Pause/Break Keys on My Keyboard?

    Read the article

  • Tip #15: How To Debug Unit Tests During Maven Builds

    - by ByronNevins
    It must be really really hard to step through unit tests in a debugger during a maven build.  Right? Wrong! Here is how i do it: 1) Set up these environmental variables: MAVEN_OPTS=-Xmx1024m -Xms256m -XX:MaxPermSize=512mMAVEN_OPTS_DEBUG=-Xmx1024m -Xms256m -XX:MaxPermSize=512m  -Xdebug (no line break here!!)  -Xrunjdwp:transport=dt_socket,server=y,suspend=y,address=9999MAVEN_OPTS_REG=-Xmx1024m -Xms256m -XX:MaxPermSize=512m 2) create 2 scripts or aliases like so:  maveny.bat: set MAVEN_OPTS=%MAVEN_OPTS_DEBUG% mavenn.bat: set MAVEN_OPTS=%MAVEN_OPTS_REG%    To debug do this: run maveny.bat run mvn install attach your debugger to port 9999 (set breakpoints of course) When maven gets to the unit test phase it will hit your breakpoint and wait for you. When done debugging simply run mavenn.bat Notes If it takes a while to do the build then you don't really need to set the suspend=y flag. If you set the suspend=n flag then you can just leave it -- but only one maven build can run at a time because of the debug port conflict.

    Read the article

  • How to Implement a Parallel Workflow

    - by Paul
    I'm trying to implement a parallel split task using a workflow system. I'm using .NET but my process is very simple and I don't want to use WF or anything heavy like that. I've tried using Stateless. So far is was easy to set up and run, but I may be using the wrong tool for the job because I'm not sure how you're supposed to model parallel split workflows, where you have multiple sub-tasks required before you can advance to the next state, but the steps don't require being performed in any particular order. I can easily use the dynamic configuration options to check my data model manually to see if the model is in the correct state (all sub-tasks completed) and can transition to the next state, but this seems to completely break the workflow paradigm. What is the proper, orthodox way to implement a parallel split process? Thanks

    Read the article

  • Skills to Focus on to land Big 5 Software Engineer Position

    - by Megadeth.Metallica
    Guys, I'm in my penultimate quarter of grad school and have a software engineering internship lined up at a big 5 tech company. I have dabbled a lot recently in Python and am average at Java. I want to prepare myself for coding interviews when I apply for new grad positions at the Big 5 tech companies when I graduate at the end of this year. Since I want to have a good shot at all 5 companies (Amazon,Google,Yahoo,Microsoft and Apple) - Should I focus my time and effort on mastering and improving my Java. Or is my time better spent checking out other languages and tools ( Attracted to RoR, Clojure, Git, C# ) I am planning to spend my spring break implementing all the common algorithms and Data structure out of my algorithms textbook in Java.

    Read the article

< Previous Page | 363 364 365 366 367 368 369 370 371 372 373 374  | Next Page >