Search Results

Search found 33227 results on 1330 pages for 'open stackoverflow'.

Page 388/1330 | < Previous Page | 384 385 386 387 388 389 390 391 392 393 394 395  | Next Page >

  • Python UTF-16 encoding hex representation

    - by Romeno
    I have a string in Python 2.7.2 say u"\u0638". When I write it to file: f = open("J:\\111.txt", "w+") f.write(u"\u0638".encode('utf-16')) f.close() In hex it looks like: FF FE 38 06 When i print such a string to stdout i will see: '\xff\xfe8\x06'. The querstion: Where is \x38 in the string output to stdout? In other words why the string output to stdout is not '\xff\xfe\x38\x06'? If I write the string to file twice: f = open("J:\\111.txt", "w+") f.write(u"\u0638".encode('utf-16')) f.write(u"\u0638".encode('utf-16')) f.close() The hex representation in file contains byte order mark (BOM) \xff\xfe twice: FF FE 38 06 FF FE 38 06 I wonder what is the techique to avoid writting BOM in UTF-16 encoded strings?

    Read the article

  • Why Read In UTF-16LE File Won't Convert "\r\n" Into "\n" In Windows

    - by Dbger
    I am using Perl to read UTF-16LE files in Windows 7. If I read in an ascii file with following code: open CUR_FILE, "<", $asciiFile; Then each "\r\n" in file will be converted into a "\n" in memory; if I read in an UTF-16LE(windows 1200) file with following code: open CUR_FILE, "<:encoding(UTF-16LE)", $utf16leFile; Then "\r\n" will keep unchanged. This inconsistency cause problems when I trying to regexp lines with line breaks. My questions is: Is this how unicode works in Perl & Windows? Or Am I using the wrong code? Thanks so much!

    Read the article

  • Set up SSL/HTTPS in zend application via .htaccess

    - by davykiash
    I have been battling with .htaccess rules to get my SSL setup working right for the past few days.I get a requested URL not found error whenever I try access any requests that does not do through the index controller. For example this URL would work fine if I enter the it manually https://www.example.com/index.php/auth/register However my application has been built in such a way that the url should be this https://www.example.com/auth/register and that gives the requested URL not found error My other URLs such as https://www.example.com/index/faq https://www.example.com/index/blog https://www.example.com/index/terms work just fine. What rule do I need to write in my htaccess to get the URL https://www.example.com/auth/register working? My htaccess file looks like this RewriteEngine On RewriteCond %{HTTPS} off RewriteRule (.*) https://%{HTTP_HOST}%{REQUEST_URI} [L] RewriteCond %{REQUEST_FILENAME} -s [OR] RewriteCond %{REQUEST_FILENAME} -l [OR] RewriteCond %{REQUEST_FILENAME} -d RewriteRule ^.*$ - [NC,L] RewriteRule ^.*$ index.php [NC,L] I posted an almost similar question in stackoverflow

    Read the article

  • Ctrl+Click / Command+Click not working with analytics

    - by user347998
    Hi All, I created my own analytics for my site to track outbound click events using jquery. Now the thing with preventDefault() is that it does not allow for the Ctrl+Click or COmmand+click operation in the browser to open the link in new tab/window. So my solution was to detect e.metaKey || e.ctrlKey and use window.open. This does not work very great with safari unless the user changes browser behavior. I am wondering if anyone here knows what other analytics users do - like how does google etc deal with this problem in tracking outbound links? From this link: http://www.google.com/support/googleanalytics/bin/answer.py?hl=en&answer=55527 - looks like google will also face the same problem. Thoughts?

    Read the article

  • Problem with image path of html files viewed by webbrowser control

    - by Royson
    I have an webbrowser control on my form. I am able display html files in that control. But my page contains some images if i give absolute path to it then images are displayed. But if i give relative path then images are not shown in the pages. I have HtmlPages folder located at bin folder. And i am assigning FileStream source = new FileStream(@"..\HtmlPages\supportHtml.html", FileMode.Open, FileAccess.Read); webBrowser.DocumentStream = source; If i assign D:\myapp\bin\HtmlPages\file.png then there is no problem. My images are stored in same folder. If i open html files with webbrowser then images are displayed. What is the correct path to set ??

    Read the article

  • writing header in csv python with DictWriter

    - by user248237
    assume I have a csv.DictReader object and I want to write it out as a csv file. How can I do this? I thought of the following: dr = csv.DictReader(open(f), delimiter='\t') # process my dr object # ... # write out object output = csv.DictWriter(open(f2, 'w'), delimiter='\t') for item in dr: output.writerow(item) Is that the best way? More importantly, how can I make it so a header is written out too, in this case the object "dr"s .fieldnames property? thanks.

    Read the article

  • .attr("disabled", "disabled") problem

    - by meo
    i have this function where basically add and remove the disabled attribute form a input field: $(bla).click(function(){ if (something) { console.log($target.prev("input")) // gives out the right object $target.toggleClass("open").prev("input").attr("disabled", "disabled"); }else{ $target.toggleClass("open").prev("input").removeAttr("disabled"); //this works } }) the removeAttr works fine but when i need to add the disabled again it does just nothing. My console.log is triggering (and giving me back the right input field) so I'm sure my that my if statement works. But if i inspect the DOM with firebug the disabled attribute does not appear. can someone help me? PS: please don't focus on the function or the if statement itself, works fine its just that attr that dies not work for disabled...

    Read the article

  • DHCP server with database backend

    - by Cory J
    I have been looking around for something to replace my (ancient) ISC-DHCPd server. A DHCP server with a database backend sounds like a great idea to me, as I could then have a nice, friendly web interface to my server. Surprisingly, I can't any major open-source projects that offer this. Does anyone know of one? I have also read about modifying ISC to use a database backend...can anyone tell me if this solution is stable enough for a busy production server? Or is using a database a Bad Idea™ all together? PS - http://stackoverflow.com/questions/893887/dchp-with-database-backend looks like SO couldn't answer this old, similar question. EDIT: I am looking for something on a free OS platform, Linux or BSD. If there is something absolutely great that is Windows-only though, still interested.

    Read the article

  • Can somebody help me install this jBPM based workflow management suite?

    - by Eternal Saint
    1.Its a book Workflow Interface software available at sourceforge http://bookworkflowint.sourceforge.net/ Any instructions on installing and configuring it would be great especially in windows, however I can try Linux specific ones as well. I could not find any installation instructions. I posted this in stackoverflow by mistake and was directed here. 2.Can you guys suggest any good scanning/digitization workflow software (document imaging) that I can adopt to my scanner software? Infact even a simple one would do may be based on hotfolders. I just want to be able to track the uniqueid/barcode of the scanned book, its status so that its not scanned again. It books or manuscripts could be in millions page count. I thought of using some kind of generic bug tracking tool, just track a few fields, dont know if its the right choice Thank you very much

    Read the article

  • Is there any explorer.exe problem in windows 7 ?

    - by sml
    s += "<p style=\"text-align: left;\"><a href=\"javascript:window.print()\">PRINT</a></p>"; System.IO.File.WriteAllText(@"CheckForm.html", s); System.Diagnostics.ProcessStartInfo startInfo = new System.Diagnostics.ProcessStartInfo(); startInfo.FileName = "explorer.exe"; startInfo.Arguments = "CheckForm.html"; System.Diagnostics.Process.Start(startInfo); I'm having a trouble when I tried to open my c# windows application in windows 7 otherwise there is no problem. I couldn't open explorer.exe in Windows 7 with above code. Any suggestions?

    Read the article

  • importing a project into a svn repository question

    - by ajsie
    im using netbeans for svn. i open a project in netbeans and then i import it to a svn repo. it seems that although im only importing the project folder, svn creates .svn folders in all folders within this project folder. why is that? i thought that i was only creating .svn folders to checked out projects, not imported ones? now this folder acts very weird, when i open this folder as a project in netbeans, netbeans treats it like a svn folder some way. is this normal? cause i want this one to not be under SVN.

    Read the article

  • Python character count

    - by user74283
    I have been going over python tutorials in this resource. Everything is pretty clear in the below code which counts number of characters. Only section that i dont understand is the section where count assigned to a list and multiplied by 120. Can anyone explain what is the purpose of this in plain english please. def display(i): if i == 10: return 'LF' if i == 13: return 'CR' if i == 32: return 'SPACE' return chr(i) infile = open('alice_in_wonderland.txt', 'r') text = infile.read() infile.close() counts = 128 * [0] for letter in text: counts[ord(letter)] += 1 outfile = open('alice_counts.dat', 'w') outfile.write("%-12s%s\n" % ("Character", "Count")) outfile.write("=================\n") for i in range(len(counts)): if counts[i]: outfile.write("%-12s%d\n" % (display(i), counts[i])) outfile.close()

    Read the article

  • non-GUI connection to local Hyper-V VM without network

    - by sandro
    I have a virtual machine on Hyper-V manager (Windows 2008 R2) without a network configured on the VM. From a powershell script running on the host Windows server, I would like to query into the OS of that local VM for certain information (i.e. if a given process has finished completion). I am using codeplex's pshyperv module (https://pshyperv.codeplex.com/) to interact with Hyper-V manager, but the only cmdlet to connect to the vm is 'New-VMConnectSession', which launches a 'vmconnect.exe' connection to the VM. Since vmconnect.exe is essentially RDP, this is not very script-friendly. From within a host's powershell script, is there any way to send a command to a local virtual machine's OS and receive output, if no network is configured on the VM? (I believe Vmware's 'vmrun' utility has this capability) Another way to ask this question: Does Hyper-V have a non-GUI-based form of vmconnect.exe? (PS. Not sure if this was more stackoverflow or serverfault)

    Read the article

  • Why can't I get Python's urlopen() method to work?

    - by froadie
    Why isn't this simple Python code working? import urllib file = urllib.urlopen('http://www.google.com') print file.read() This is the error that I get: Traceback (most recent call last): File "C:\workspace\GarchUpdate\src\Practice.py", line 26, in <module> file = urllib.urlopen('http://www.google.com') File "C:\Python26\lib\urllib.py", line 87, in urlopen return opener.open(url) File "C:\Python26\lib\urllib.py", line 206, in open return getattr(self, name)(url) File "C:\Python26\lib\urllib.py", line 345, in open_http h.endheaders() File "C:\Python26\lib\httplib.py", line 892, in endheaders self._send_output() File "C:\Python26\lib\httplib.py", line 764, in _send_output self.send(msg) File "C:\Python26\lib\httplib.py", line 723, in send self.connect() File "C:\Python26\lib\httplib.py", line 704, in connect self.timeout) File "C:\Python26\lib\socket.py", line 514, in create_connection raise error, msg IOError: [Errno socket error] [Errno 10060] A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond I've tried it with several different pages but I can never get the urlopen method to execute correctly.

    Read the article

  • Jquery UI accordion question - how would you approach this?

    - by E.J. Brennan
    I am using jquery UI accordion control in one of my apps asp.net apps. The data for the accordion comes from a database, and each database record has an ID, a Title Field and a content field. The title is the heading, and the content is the data that shows up when the draw is opened... I'd like to be able to call my page like this: http://www.mywebsite.com/mypage.aspx?ID=123 and have it display all the data (as it does now), but then have the default 'drawer' of the accordion open to the section that corresponds to the ID number passed in on the url...there are about 50 sections on the page. Any suggestions on how to approach this? My questions is specific to the jquery accordion function, the rest I know. So where would be the best place to 'tag' the drawer with the unique ID's, and then what is the snippet of javascript code (I assume) that I would use 'open' that drawer based on the ID passed in?? Thanks!

    Read the article

  • Python - Converting CSV to Objects - Code Design

    - by victorhooi
    Hi, I have a small script we're using to read in a CSV file containing employees, and perform some basic manipulations on that data. We read in the data (import_gd_dump), and create an Employees object, containing a list of Employee objects (maybe I should think of a better naming convention...lol). We then call clean_all_phone_numbers() on Employees, which calls clean_phone_number() on each Employee, as well as lookup_all_supervisors(), on Employees. import csv import re import sys #class CSVLoader: # """Virtual class to assist with loading in CSV files.""" # def import_gd_dump(self, input_file='Gp Directory 20100331 original.csv'): # gd_extract = csv.DictReader(open(input_file), dialect='excel') # employees = [] # for row in gd_extract: # curr_employee = Employee(row) # employees.append(curr_employee) # return employees # #self.employees = {row['dbdirid']:row for row in gd_extract} # Previously, this was inside a (virtual) class called "CSVLoader". # However, according to here (http://tomayko.com/writings/the-static-method-thing) - the idiomatic way of doing this in Python is not with a class-fucntion but with a module-level function def import_gd_dump(input_file='Gp Directory 20100331 original.csv'): """Return a list ('employee') of dict objects, taken from a Group Directory CSV file.""" gd_extract = csv.DictReader(open(input_file), dialect='excel') employees = [] for row in gd_extract: employees.append(row) return employees def write_gd_formatted(employees_dict, output_file="gd_formatted.csv"): """Read in an Employees() object, and write out each Employee() inside this to a CSV file""" gd_output_fieldnames = ('hrid', 'mail', 'givenName', 'sn', 'dbcostcenter', 'dbdirid', 'hrreportsto', 'PHFull', 'PHFull_message', 'SupervisorEmail', 'SupervisorFirstName', 'SupervisorSurname') try: gd_formatted = csv.DictWriter(open(output_file, 'w', newline=''), fieldnames=gd_output_fieldnames, extrasaction='ignore', dialect='excel') except IOError: print('Unable to open file, IO error (Is it locked?)') sys.exit(1) headers = {n:n for n in gd_output_fieldnames} gd_formatted.writerow(headers) for employee in employees_dict.employee_list: # We're using the employee object's inbuilt __dict__ attribute - hmm, is this good practice? gd_formatted.writerow(employee.__dict__) class Employee: """An Employee in the system, with employee attributes (name, email, cost-centre etc.)""" def __init__(self, employee_attributes): """We use the Employee constructor to convert a dictionary into instance attributes.""" for k, v in employee_attributes.items(): setattr(self, k, v) def clean_phone_number(self): """Perform some rudimentary checks and corrections, to make sure numbers are in the right format. Numbers should be in the form 0XYYYYYYYY, where X is the area code, and Y is the local number.""" if self.telephoneNumber is None or self.telephoneNumber == '': return '', 'Missing phone number.' else: standard_format = re.compile(r'^\+(?P<intl_prefix>\d{2})\((?P<area_code>\d)\)(?P<local_first_half>\d{4})-(?P<local_second_half>\d{4})') extra_zero = re.compile(r'^\+(?P<intl_prefix>\d{2})\(0(?P<area_code>\d)\)(?P<local_first_half>\d{4})-(?P<local_second_half>\d{4})') missing_hyphen = re.compile(r'^\+(?P<intl_prefix>\d{2})\(0(?P<area_code>\d)\)(?P<local_first_half>\d{4})(?P<local_second_half>\d{4})') if standard_format.search(self.telephoneNumber): result = standard_format.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), '' elif extra_zero.search(self.telephoneNumber): result = extra_zero.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), 'Extra zero in area code - ask user to remediate. ' elif missing_hyphen.search(self.telephoneNumber): result = missing_hyphen.search(self.telephoneNumber) return '0' + result.group('area_code') + result.group('local_first_half') + result.group('local_second_half'), 'Missing hyphen in local component - ask user to remediate. ' else: return '', "Number didn't match recognised format. Original text is: " + self.telephoneNumber class Employees: def __init__(self, import_list): self.employee_list = [] for employee in import_list: self.employee_list.append(Employee(employee)) def clean_all_phone_numbers(self): for employee in self.employee_list: #Should we just set this directly in Employee.clean_phone_number() instead? employee.PHFull, employee.PHFull_message = employee.clean_phone_number() # Hmm, the search is O(n^2) - there's probably a better way of doing this search? def lookup_all_supervisors(self): for employee in self.employee_list: if employee.hrreportsto is not None and employee.hrreportsto != '': for supervisor in self.employee_list: if supervisor.hrid == employee.hrreportsto: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = supervisor.mail, supervisor.givenName, supervisor.sn break else: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = ('Supervisor not found.', 'Supervisor not found.', 'Supervisor not found.') else: (employee.SupervisorEmail, employee.SupervisorFirstName, employee.SupervisorSurname) = ('Supervisor not set.', 'Supervisor not set.', 'Supervisor not set.') #Is thre a more pythonic way of doing this? def print_employees(self): for employee in self.employee_list: print(employee.__dict__) if __name__ == '__main__': db_employees = Employees(import_gd_dump()) db_employees.clean_all_phone_numbers() db_employees.lookup_all_supervisors() #db_employees.print_employees() write_gd_formatted(db_employees) Firstly, my preamble question is, can you see anything inherently wrong with the above, from either a class design or Python point-of-view? Is the logic/design sound? Anyhow, to the specifics: The Employees object has a method, clean_all_phone_numbers(), which calls clean_phone_number() on each Employee object inside it. Is this bad design? If so, why? Also, is the way I'm calling lookup_all_supervisors() bad? Originally, I wrapped the clean_phone_number() and lookup_supervisor() method in a single function, with a single for-loop inside it. clean_phone_number is O(n), I believe, lookup_supervisor is O(n^2) - is it ok splitting it into two loops like this? In clean_all_phone_numbers(), I'm looping on the Employee objects, and settings their values using return/assignment - should I be setting this inside clean_phone_number() itself? There's also a few things that I'm sorted of hacked out, not sure if they're bad practice - e.g. print_employee() and gd_formatted() both use __dict__, and the constructor for Employee uses setattr() to convert a dictionary into instance attributes. I'd value any thoughts at all. If you think the questions are too broad, let me know and I can repost as several split up (I just didn't want to pollute the boards with multiple similar questions, and the three questions are more or less fairly tightly related). Cheers, Victor

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • If ssh connection fails using SOCKS then what? Automate switch to no proxy?

    - by Benjamin Jones
    Right now I am using plink in a batch routine that reconnects to my SSH server if I loose connection. I use my plink connection & socks proxy (firefox) to forward all my browser traffic. Works great EXCEPT for one thing! If I can't get to my ssh server for some ODD reason I have to go to options in firefox and revert back my settings to NO Proxy. It can be done, but its annoying! So how would I keep my SOCKS Proxy connection in firefox, but if I cant connect to my SSH Server, how can I automatically switch to the autodetect proxy/no proxy settings in firefox? I would think that I could use the Firefox command line arguments and a batch routine to do so, but I do not believe this is possible. I do see via this link where the proxy settings are stored, but does that mean I have to change the proxy settings depending on my senario above within the .js file? http://stackoverflow.com/questions/843340/firefox-proxy-settings-via-command-line

    Read the article

  • virtual machines and cryptography

    - by Unknown
    I suspect I'm a bit offtopic with the site mission, but it seems me more fitting for the question than stackoverflow i'm in preparing to create a vm with sensible data (personal use, it will be a web+mail+... appliance of sorts), i'd like to protect the data even with cryptography; the final choice have to be cross-platform for the host basically, I have to choose between guest system-level cryptography (say, dm-crypt or similar) or host level cryptography with truecrypt. do you think that the "truecrypt-volume contained virtualized disks" approach will hit the i/o performance of the vm badly (and therefore dm-crypt like approaches into the vm would be better), or is it doable? I'd like to protect all the guest data, not only my personal data, to be able to suspend the vm freely without worrying for the swap partition, etc

    Read the article

  • Create an assembly in memory

    - by Jared I
    I'd like to create an assembly in memory, using an using the classes in Reflection.Emit Currently, I can create the assembly and get it's bytes using something like AssemblyBuilder builder = AppDomain.CurrentDomain.DefineDynamicAssembly(..., AssemblyBuilderAccess.Save); ... create the assembly ... builder.Save(targetFileName); using(FileStream fs = File.Open(targetFileName, FileMode.Open)) { ... read the bytes from the file stream ... } However, it does so by creating a file on the local filesystem. I don't actually need the file, just the bytes that would be in the file. Is it possible to create the assembly without writing any files?

    Read the article

  • Sharepoint checkin/checkout

    - by Prashanth
    We have a sharepoint based application that uses a custom database for storing metadata/files (which could also be on a file share) My question is how can the standard file checkin/check out option in document library be customized? The javascript file ows.js in the layouts folder contains the functions that provide checkin/check out/ open file functionality. Behind the scenes it relies on a combination of HTTP Post/GET methods + SOAP + an activeX control to achieve the desired functionality. Customizing these javascript function seems tedious/error prone. Note that we have a web service that exposes endpoints, for retrieving necessary file information/data from the backend. The difficulty is in integrating it with the sharepoint js functions, due to lack of proper documentation. (Also the js functions might change over different versions of sharepoint) Also is it possible to create files/open files etc from the cache area on the client machine from server side code?

    Read the article

  • ADO.NET: Faster way to check if the database server is accessible?

    - by lotana
    At the moment I am using this code to check if the database is accessible: public bool IsDatabaseOnline(string con) { bool isConnected = false; SQLConnection connect = null; try { connect = new SQLConnection(con); connect.Open(); isConnected = true; } catch (Exception e) { isConnected = false; } finally { if (connect != null) connect.Close(); } return isConnected; } While this code works fine, there is a disadvantage. If the server is not online it spends about 4 full seconds trying to open the connection before deciding that it is not available. Is there a way to test the connection without trying to actually opening it and waiting for the timeout? Something like a database-equivalent of ping?

    Read the article

  • Cocoa AppKit - Dismissing a modal window (i.e. popup or contextual menu) and pressing the button cu

    - by hishamk
    Basically I want to create the effect of that provided in the system's menu bar. A user presses on one of the menu headings, and as he moves across the different headings, the menus open up automatically. The snag is that if I open a pop-up menu for a button, the user has to click again to dismiss it. The entire runloop is on hold as I believe the pop-up menu is modal. How do I go about being able to send a [somePopUpMenu cancelTracking] when the user moves to the next button? Cheers

    Read the article

< Previous Page | 384 385 386 387 388 389 390 391 392 393 394 395  | Next Page >