Search Results

Search found 36624 results on 1465 pages for 'open world'.

Page 482/1465 | < Previous Page | 478 479 480 481 482 483 484 485 486 487 488 489  | Next Page >

  • Spring.NET & Immediacy CMS (or how to inject to server side controls without using PageHandlerFactor

    - by Simon Rice
    Is there any way to inject dependencies into an Immediacy CMS control using Spring.NET, ideally without having to use to ContextRegistry when initialising the control? Update, with my own answer The issue here is that Immediacy already has a handler defined in web.config that deals with all aspx pages, & so it's not possible add an entry for Spring.NET's PageHandlerFactory in web.config as per a normal webforms app. That rules out making the control implement ISupportsWebDependencyInjection. Furthermore, most of Immediacy's generated pages are aspx pages that don't physically exist on the drive. I have changed the title of the question to reflect this. What I have done to get Dependency Injection working is: Add the usual entries to web.config for Spring.NET as outlined in the documentation, except for the adding the entry to the <httpHandlers> section. In this case I've got my object definitions in Spring.config. Create the following abstract base class that will deal with all of the Dependency Injection work: DIControl.cs public abstract class DIControl : ImmediacyControl { protected virtual string DIName { get { return this.GetType().Name; } } protected override void OnInit(EventArgs e) { if (ContextRegistry.GetContext().GetObject(DIName, this.GetType()) != null) ContextRegistry.GetContext().ConfigureObject(this, DIName); base.OnInit(e); } } For non-immediacy controls, you can make this server side control inherit from Control or whatever subclass of that you like. For any control with which you wish to use with Spring.NET's Inversion of Control container, define it to inherit from DIControl & add the relelvant entry to Spring.config, for example: SampleControl.cs public class SampleControl : DIControl, INamingContainer { public string Text { get; set; } protected string InjectedText { get; set; } public SampleControl() : base() { Text = "Hello world"; } protected override void RenderContents(HtmlTextWriter output) { output.Write(string.Format("{0} {1}", Text, InjectedText)); } } Spring.config <objects xmlns="http://www.springframework.net"> <object id="SampleControl" type="MyProject.SampleControl, MyAssembly"> <property name="InjectedText" value="from Spring.NET" /> </object> </objects> You can optionally override DIName if you wish to name your entry in Spring.config differently from the name of your class. Provided everything's done correctly, you will have the control writing out "Hello world from Spring.NET!" when used in a page. This solution uses Spring.NET's ContextRegistry from within the control, but I would be surprised if there's no way around that for Immediacy at least since the page objects themselves aren't accessible. However, can this be improved at all from a Spring.NET perspective? Is there maybe an Immediacy plugin that already does this that I'm completely unaware of? Or is there an approach that does this in a more elegant way? I'm open to suggestions.

    Read the article

  • RESTful principles question

    - by auser
    An intelligent coworker friend of mine brought up a question to me that I was uncertain how to answer and I'd like to pose it to the world. If a RESTful endpoint uses token-based authentication, aka a time-based token is required to access a resource and that token expires after a certain amount of time, would this violate the RESTful principle? In other words, if the same URL expires after a certain amount of time, so the resource returns a different response depending when it was requested, is that breaking REST?

    Read the article

  • Excel macro send rich mail using LotusNotes

    - by CC
    Hi everybody. I'm working on a small macro to send mail from excel 2007 using my Lotus Notes session. The sending mail part is working fine. Now I need to send in the body part, a part of a stylesheet (for instance the area from A1:B20). This area has colors, bold font. To send my email here is the code: Set oSess = CreateObject("Notes.NotesSession") Set oDB = oSess.GETDATABASE("", "") Call oDB.OPENMAIL flag = True If Not (oDB.IsOpen) Then flag = oDB.Open("", "") If Not flag Then MsgBox "Can't open mail file: " & oDB.SERVER & " " & oDB.FILEPATH End If On Error GoTo err_handler 'Building Message Set oDoc = oDB.CREATEDOCUMENT Set oItem = oDoc.CREATERICHTEXTITEM("BODY") oDoc.Form = "Memo" 'mail subject oDoc.Subject = "subject" 'mail body oDoc.sendto = "[email protected]" oDoc.body = "my text" oDoc.postdate = Date oDoc.SaveMessageOnSend = True oDoc.visable = True 'Sending Message oDoc.SEND False Does anybody has an idea about how to send a stylesheet ? Thanks alot.

    Read the article

  • How can one extra rdf:about or rdf:ID properties from triples using SPARKQL?

    - by lennyks
    It seemed a trivial matter at the beginning but so far I had not managed to get unique identifier for a given resource using SPARKQL. What I mean is given and then some properties identifiying this resource in perfect world I want to first know how to retrieve an individual triple given some uri. I have tried naive approaches by writing statements in a WHERE clause such as ?x rdf:about ?y and ?x rdfs:about ?y. I hope I am being precise.

    Read the article

  • Need serious assembly help

    - by Jake
    I have been trying to learn assembly for a few years now. I get to do a "Hello, World" program but never further. I find it so hard. Is anyone able to point me to a place or maybe even themselves, teach me some? I have prior programming experice mainly in python. So i am not completely unfamiliar with programming.

    Read the article

  • How do you rotate a two dimensional array?

    - by swilliams
    Inspired by Raymond Chen's post, say you have a 4x4 two dimensional array, write a function that rotates it 90 degrees. Raymond links to a solution in pseudo code, but I'd like to see some real world stuff. [1][2][3][4] [5][6][7][8] [9][0][1][2] [3][4][5][6] Becomes: [3][9][5][1] [4][0][6][2] [5][1][7][3] [6][2][8][4] Update: Nick's answer is the most straightforward, but is there a way to do it better than n^2? What if the matrix was 10000x10000?

    Read the article

  • Upload and parse csv file with "universal newline" in python on Google App Engine

    - by greg
    Hi, I'm uploading a csv/tsv file from a form in GAE, and I try to parse the file with python csv module. Like describe here, uploaded files in GAE are strings. So I treat my uploaded string a file-like object : file = self.request.get('catalog') catalog = csv.reader(StringIO.StringIO(file),dialect=csv.excel_tab) But new lines in my files are not necessarily '\n' (thanks to excel..), and it generated an error : Error: new-line character seen in unquoted field - do you need to open the file in universal-newline mode? Does anyone know how to use StringIO.StringIO to treat strings like files open in universal-newline?

    Read the article

  • How do I run a vim script that alters the current buffer?

    - by Dan
    I'm trying to write a beautify.vim script that makes C-like code adhere to a standard that I can easily read. My file contains only substitution commands that all begin with %s/... However, when I try to run the script with my file open, in the manner :source beautify.vim, or :runtime beautify.vim, it runs but all the substitute commands state that their pattern wasn't found (patterns were tested by entering them manually and should work). Is there some way to make vim run the commands in the context of the current buffer? beautify.vim: " add spaces before open braces sil! :%s/\%>1c>\s\@<!{/ {/g " beautify for sil! :%s/for *( *\([^;]*\) *; *\([^;]*\) *; *\([^;]*\) *)/for (\1; \2; \3)/ " add spaces after commas sil! :%s/,\s\@!/, /g In my tests the first :s command should match (it matches when applied manually).

    Read the article

  • Nhibernate 3.0 and FluentNHibernate

    - by Keith Nicholas
    is anyone building the truck NHibernate and FluentNhibernate together? How's it working? are you using it for production systems? How is the Linq support? Is it nearly ready for release? Is there a nice and concise way to keep up to date with what is going on in the world of NHibernate? (ie, without having to read lots of blogs, and mailing lists )

    Read the article

  • Python file input string: how to handle escaped unicode characters?

    - by Michi
    In a text file (test.txt), my string looks like this: Gro\u00DFbritannien Reading it, python escapes the backslash: >>> file = open('test.txt', 'r') >>> input = file.readline() >>> input 'Gro\\u00DFbritannien' How can I have this interpreted as unicode? decode() and unicode() won't do the job. The following code writes Gro\u00DFbritannien back to the file, but I want it to be Großbritannien >>> input.decode('latin-1') u'Gro\\u00DFbritannien' >>> out = codecs.open('out.txt', 'w', 'utf-8') >>> out.write(input)

    Read the article

  • Creating and writing file from a FileOutputStream in Java

    - by Althane
    Okay, so I'm working on a project where I use a Java program to initiate a socket connection between two classes (a FileSender and FileReceiver). My basic idea was that the FileSender would look like this: try { writer = new DataOutputStream(connect.getOutputStream()); } catch (IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } //While we have bytes to send while(filein.available() >0){ //We write them out to our buffer writer.write(filein.read(outBuffer)); writer.flush(); } //Then close our filein filein.close(); //And then our socket; connect.close(); } catch (IOException e) { // TODO Auto-generated catch block e.printStackTrace(); The constructor contains code that checks to see if the file exists, and that the socket is connected, and so on. Inside my FileReader is this though: input = recvSocket.accept(); BufferedReader br = new BufferedReader(new InputStreamReader(input.getInputStream())); FileOutputStream fOut= new FileOutputStream(filename); String line = br.readLine(); while(line != null){ fOut.write(line.getBytes()); fOut.flush(); line = br.readLine(); } System.out.println("Before RECV close statements"); fOut.close(); input.close(); recvSocket.close(); System.out.println("After RECV clsoe statements"); All inside a try-catch block. So, what I'm trying to do is have the FileSender reading in the file, converting to bytes, sending and flushing it out. FileReceiver, then reads in the bytes, writes to the fileOut, flushes, and continues waiting for more. I make sure to close all the things that I open, so... here comes the weird part. When I try and open the created text file in Eclipse, it tells me "An SWT error has occured ... recommended to exit the workbench... see .log for more details.". Another window pops up saying "Unhandled event loop exception, (no more handles)". However, if I try to open the sent text file in notepad2, I get ThisIsASentTextfile Which is good (well, minus the fact that there should be line breaks, but I'm working on that...). Does anyone know why this is happening? And while we're checking, how to add the line breaks? (And is this a particularly bad way to transfer files over java without getting some other libraries?)

    Read the article

  • Posting an action works... but no image

    - by Brian Rice
    I'm able to post an open graph action to facebook using the following url: https://graph.facebook.com/me/video.watches with the following post data: video=http://eqnetwork.com/home/video.html?f=8e7b4f27-8cbd-4430-84df-d9ccb46da45f.mp4 It seems to be getting the title from the open graph metatags at the "video" object. But, it's not getting the image (even though one is specified in the metatag "og:image"). Also, if I add this to the post data: picture=http://eqnetwork.com/icons/mgen/overplayThumbnail.ms?drid=14282&subType=ljpg&w=120&h=120&o=1&thumbnail= still no image. Any thoughts? Brian

    Read the article

  • Can't get multiple panel plots with chartSeries function from quantod package in R

    - by Milktrader
    Jeff Ryan's quantmod package is an excellent contribution to the R finance world. I like to use chartSeries() function, but when I try to get it to display multiple panes simultaneously, it doesn't work. par(mfrow=c(2,2)) chartSeries (SPX) chartSeries (SPX, subset="2010") chartSeries (NDX) chartSeries (NDX, subset="2010") would normally return a four-panel graphic as it does with the plot() function but in the chartSeries example it runs through all instances one at a time without creating a single four-panel graphic.

    Read the article

  • Reading a file with a supplied name in C++

    - by Cosmina
    I must read a file with a given name (it's caled "hamlet.txt"). The class used to read the file is defined like this #ifndef READWORDS_H #define READWORDS_H /** * ReadWords class. Provides mechanisms to read a text file, and return * capitalized words from that file. */ using namespace std; #include <string> #include <fstream> class ReadWords { public: /** * Constructor. Opens the file with the default name "text.txt". * Program exits with an error message if the file does not exist. */ ReadWords(); /** * Constructor. Opens the file with the given filename. * Program exits with an error message if the file does not exist. * @param filename - a C string naming the file to read. */ ReadWords(char *filename); My definition of the members of the classis this: #include<string> #include<fstream> #include<iostream> #include "ReadWords.h" using namespace std; ReadWords::ReadWords() { wordfile.open("text.txt"); if( !wordfile ) { cout<<"Errors while opening the file!"<<endl; } } ReadWords::ReadWords(char *filename) { wordfile.open(filename); if ( !wordfile ) { cout<<"Errors while opening the file!"<<endl; } wordfile>>nextword; } And the main to test it. using namespace std; #include #include #include "ReadWords.h" int main() { char name[30]; cout<<"Please input a name for the file that you wish to open"; cin>>name; ReadWords x( name[] ); } When I complie it gives me the error: main.cpp:14: error: expected primary-expression before ']' token I know it's got something to do with the function ReadWords( char *filename), but I do not know what. Any help please?

    Read the article

  • what's the purpose of fcntl with parameter F_DUPFD

    - by Daniel
    I traced an oracle process, and find it first open a file /etc/netconfig as file handle 11, and then duplicate it as 256 by calling fcntl with parameter F_DUPFD, and then close the original file handle 11. Later it read using file handle 256. So what's the point to duplicate the file handle? Why not just work on the original file handle? 12931: 0.0006 open("/etc/netconfig", O_RDONLY|O_LARGEFILE) = 11 12931: 0.0002 fcntl(11, F_DUPFD, 0x00000100) = 256 12931: 0.0001 close(11) = 0 12931: 0.0002 read(256, " # p r a g m a i d e n".., 1024) = 1024 12931: 0.0003 read(256, " t s t p i _ c".., 1024) = 215 12931: 0.0002 read(256, 0x106957054, 1024) = 0 12931: 0.0001 lseek(256, 0, SEEK_SET) = 0 12931: 0.0002 read(256, " # p r a g m a i d e n".., 1024) = 1024 12931: 0.0003 read(256, " t s t p i _ c".., 1024) = 215 12931: 0.0003 read(256, 0x106957054, 1024) = 0 12931: 0.0001 close(256) = 0

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Yes, another thread question...

    - by Michael
    I can't understand why I am loosing control of my GUI even though I am implementing a thread to play a .wav file. Can someone pin point what is incorrect? #!/usr/bin/env python import wx, pyaudio, wave, easygui, thread, time, os, sys, traceback, threading import wx.lib.delayedresult as inbg isPaused = False isStopped = False class Frame(wx.Frame): def __init__(self): print 'Frame' wx.Frame.__init__(self, parent=None, id=-1, title="Jasmine", size=(720, 300)) #initialize panel panel = wx.Panel(self, -1) #initialize grid bag sizer = wx.GridBagSizer(hgap=20, vgap=20) #initialize buttons exitButton = wx.Button(panel, wx.ID_ANY, "Exit") pauseButton = wx.Button(panel, wx.ID_ANY, 'Pause') prevButton = wx.Button(panel, wx.ID_ANY, 'Prev') nextButton = wx.Button(panel, wx.ID_ANY, 'Next') stopButton = wx.Button(panel, wx.ID_ANY, 'Stop') #add widgets to sizer sizer.Add(pauseButton, pos=(1,10)) sizer.Add(prevButton, pos=(1,11)) sizer.Add(nextButton, pos=(1,12)) sizer.Add(stopButton, pos=(1,13)) sizer.Add(exitButton, pos=(5,13)) #initialize song time gauge #timeGauge = wx.Gauge(panel, 20) #sizer.Add(timeGauge, pos=(3,10), span=(0, 0)) #initialize menuFile widget menuFile = wx.Menu() menuFile.Append(0, "L&oad") menuFile.Append(1, "E&xit") menuBar = wx.MenuBar() menuBar.Append(menuFile, "&File") menuAbout = wx.Menu() menuAbout.Append(2, "A&bout...") menuAbout.AppendSeparator() menuBar.Append(menuAbout, "Help") self.SetMenuBar(menuBar) self.CreateStatusBar() self.SetStatusText("Welcome to Jasime!") #place sizer on panel panel.SetSizer(sizer) #initialize icon self.cd_image = wx.Image('cd_icon.png', wx.BITMAP_TYPE_PNG) self.temp = self.cd_image.ConvertToBitmap() self.size = self.temp.GetWidth(), self.temp.GetHeight() wx.StaticBitmap(parent=panel, bitmap=self.temp) #set binding self.Bind(wx.EVT_BUTTON, self.OnQuit, id=exitButton.GetId()) self.Bind(wx.EVT_BUTTON, self.pause, id=pauseButton.GetId()) self.Bind(wx.EVT_BUTTON, self.stop, id=stopButton.GetId()) self.Bind(wx.EVT_MENU, self.loadFile, id=0) self.Bind(wx.EVT_MENU, self.OnQuit, id=1) self.Bind(wx.EVT_MENU, self.OnAbout, id=2) #Load file usiing FileDialog, and create a thread for user control while running the file def loadFile(self, event): foo = wx.FileDialog(self, message="Open a .wav file...", defaultDir=os.getcwd(), defaultFile="", style=wx.FD_MULTIPLE) foo.ShowModal() self.queue = foo.GetPaths() self.threadID = 1 while len(self.queue) != 0: self.song = myThread(self.threadID, self.queue[0]) self.song.start() while self.song.isAlive(): time.sleep(2) self.queue.pop(0) self.threadID += 1 def OnQuit(self, event): self.Close() def OnAbout(self, event): wx.MessageBox("This is a great cup of tea.", "About Jasmine", wx.OK | wx.ICON_INFORMATION, self) def pause(self, event): global isPaused isPaused = not isPaused def stop(self, event): global isStopped isStopped = not isStopped class myThread (threading.Thread): def __init__(self, threadID, wf): self.threadID = threadID self.wf = wf threading.Thread.__init__(self) def run(self): global isPaused global isStopped self.waveFile = wave.open(self.wf, 'rb') #initialize stream self.p = pyaudio.PyAudio() self.stream = self.p.open(format = self.p.get_format_from_width(self.waveFile.getsampwidth()), channels = self.waveFile.getnchannels(), rate = self.waveFile.getframerate(), output = True) self.data = self.waveFile.readframes(1024) isPaused = False isStopped = False #main play loop, with pause event checking while self.data != '': # while isPaused != True: # if isStopped == False: self.stream.write(self.data) self.data = self.waveFile.readframes(1024) # elif isStopped == True: # self.stream.close() # self.p.terminate() self.stream.close() self.p.terminate() class App(wx.App): def OnInit(self): self.frame = Frame() self.frame.Show() self.SetTopWindow(self.frame) return True def main(): app = App() app.MainLoop() if __name__=='__main__': main()

    Read the article

  • Ruby Thread with "watchdog"

    - by Sergio Campamá
    I'm implementing a ruby server for handling sockets being created from GPRS modules. The thing is that when the module powers down, there's no indication that the socket closed. I'm doing threads to handle multiple sockets with the same server. What I'm asking is this: Is there a way to use a timer inside a thread, reset it after every socket input, and that if it hits the timeout, closes the thread? Where can I find more information about this? EDIT: Code example that doesn't detect the socket closing require 'socket' server = TCPServer.open(41000) loop do Thread.start(server.accept) do |client| puts "Client connected" begin loop do line = client.readline open('log.txt', 'a') { |f| f.puts line.strip } end rescue puts "Client disconnected" end end end

    Read the article

  • Error opening streamreader because file is used by another process

    - by Geri Langlois
    I am developing an application to read an excel spreadsheet, validate the data and then map it to a sql table. The process is to read the file via a streamreader, validate the data, manually make corrections to the excel spreadsheet, validate again -- repeat this process until all data validates. If the excel spreadsheet is open, then when I attempt to read the data via a streamreader I get an error, "The process cannot access the file ... because it is being used by another process." Is there a way to remove the lock or otherwise read the data into a streamreader without having to open and close excel each time?

    Read the article

  • PostgreSQL or MS SQL Server?

    - by mmiika
    I'm considering using PostgreSQL with a .Net web app. Basically 3 reasons: Mature Geo Queries Small footprint + Linux Price I'm wondering a bit about tools though, SQL Server Profiler and query plans and performance monitors have been helpful. How is this world with Postgres? Some other things I should consider? Edit: Will most likely use NHibernate as ORM

    Read the article

  • Who Uses Real Time Java?

    - by Jon
    I noticed that Real Time Java 2.2 was released back in September, seems to have come a long way from when I last looked at it. However, does anybody know of any real world uses, commercial or academic to date? http://java.sun.com/javase/technologies/realtime/index.jsp

    Read the article

< Previous Page | 478 479 480 481 482 483 484 485 486 487 488 489  | Next Page >