Search Results

Search found 1073 results on 43 pages for 'anil kumar'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 10/43 | < Previous Page | 6 7 8 9 10 11 12 13 14 15 16 17  | Next Page >

  • In ParallelPython, a method of an object ( object.func() ) fails to manipulate a variable of an object ( object.value )

    - by mehmet.ali.anil
    With parallelpython, I am trying to convert my old serial code to parallel, which heavily relies on objects that have methods that change that object's variables. A stripped example in which I omit the syntax in favor of simplicity: class Network: self.adjacency_matrix = [ ... ] self.state = [ ... ] self.equilibria = [ ... ] ... def populate_equilibria(self): # this function takes every possible value that self.state can be in # runs the boolean dynamical system # and writes an integer within self.equilibria for each self.state # doesn't return anything I call this method as: Code: j1 = jobserver.submit(net2.populate_equilibria,(),(),("numpy as num")) The job is sumbitted, and I know that a long computation takes place, so I speculate that my code is ran. The problem is, i am new to parallelpython , I was expecting that, when the method is called, the variable net2.equilibria would be written accordingly, and I would get a revised object (net2) . That is how my code works, independent objects with methods that act upon the object's variables. Rather, though the computation is apparent, and reasonably timed, the variable net2.equilibria remains unchanged. As if PP only takes the function and the object, computes it elsewhere, but never returns the object, so I am left with the old one. What do I miss? Thanks in advance.

    Read the article

  • How web browser works ?

    - by Anil Namde
    I have tired to find good documentation of browsers using google but failed to get what i am looking for. Can some one guide me to location where i can actually see how browser functions. The whole purpose of the exercise is to get answers for following queries and more like these.... How images, css and js files are downloaded How js is executed How Ajax request is executed and many more like these..... Thanks all,

    Read the article

  • sort items based on their appears count

    - by ANIL MANE
    Hello Experts, I have data like this d b c a d c b a b c a c a d c if you analyse, you will find the appearance of each element as follows a: 4 b: 3 c: 5 d: 2 According to appearance my sorted elements would be c,a,b,d and final output should be c b d a d c b a b c a c a d c Any clue, how we can achieve this using sql query ?

    Read the article

  • how to find maximum frequent item sets from large transactional data file

    - by ANIL MANE
    Hi, I have the input file contains large amount of transactions like Transaction ID Items T1 Bread, milk, coffee, juice T2 Juice, milk, coffee T3 Bread, juice T4 Coffee, milk T5 Bread, Milk T6 Coffee, Bread T7 Coffee, Bread, Juice T8 Bread, Milk, Juice T9 Milk, Bread, Coffee, T10 Bread T11 Milk T12 Milk, Coffee, Bread, Juice i want the occurrence of every unique item like Item Name Count Bread 9 Milk 8 Coffee 7 Juice 6 and from that i want an a fp-tree now by traversing this tree i want the maximal frequent itemsets as follows The basic idea of method is to dispose nodes in each “layer” from bottom to up. The concept of “layer” is different to the common concept of layer in a tree. Nodes in a “layer” mean the nodes correspond to the same item and be in a linked list from the “Head Table”. For nodes in a “layer” NBN method will be used to dispose the nodes from left to right along the linked list. To use NBN method, two extra fields will be added to each node in the ordered FP-Tree. The field tag of node N stores the information of whether N is maximal frequent itemset, and the field count’ stores the support count information in the nodes at left. In Figure, the first node to be disposed is “juice: 2”. If the min_sup is equal to or less than 2 then “bread, milk, coffee, juice” is a maximal frequent itemset. Firstly output juice:2 and set the field tag of “coffee:3” as “false” (the field tag of each node is “true” initially ). Next check whether the right four itemsets juice:1 be the subset of juice:2. If the itemset one node “juice:1” corresponding to is the subset of juice:2 set the field tag of the node “false”. In the following process when the field tag of the disposed node is FALSE we can omit the node after the same tagging. If the min_sup is more than 2 then check whether the right four juice:1 is the subset of juice:2. If the itemset one node “juice:1” corresponding to is the subset of juice:2 then set the field count’ of the node with the sum of the former count’ and 2 After all the nodes “juice” disposed ,begin to dispose the node “coffee:3”. Any suggestions or available source code, welcome. thanks in advance

    Read the article

  • Need tips for better usability for tabular data with pagination

    - by Anil Namde
    Hi all, Just another day i found myself writing code to show data on the UI. I am again using DataGrid/GridView (ASP.NET), User Id as link button (clickable) to redirect user to another page. User having hard time to find where to click(Though the link has underline and hand pointer as usual on hover) just another common table like structure Following are the columns for example, User ID (Link button), User Name, First Name, Last Name, Date Of Birth Now i would like to make it better form the usability point of view. Can someone suggest a good link, example or suggestions to make it better. Thanks all,

    Read the article

  • Show PDF in HTML in web

    - by Anil
    Hi, I'm using the object tag to render PDF in HTML, but I'm doing it in MVC like this: <object data="/JDLCustomer/GetPDFData?projID=<%=ViewData["ProjectID"]%>&folder=<%=ViewData["Folder"] %>" type="application/pdf" width="960" height="900"> </object> and Controller/Action is public void GetPDFData(string projID, Project_Thin.Folders folder) { Highmark.BLL.Models.Project proj = GetProject(projID); List<File> ff = proj.GetFiles(folder, false); if (ff != null && ff.Count > 0 && ff.Where(p => p.FileExtension == "pdf").Count() > 0) { ff = ff.Where(p => p.FileExtension == "pdf").ToList(); Response.ClearHeaders(); Highmark.BLL.PDF.JDLCustomerPDF pdfObj = new JDLCustomerPDF(ff, proj.SimpleDbID); byte[] bArr = pdfObj.GetPDF(Response.OutputStream); pdfObj = null; Response.ContentType = "application/" + System.IO.Path.GetExtension("TakeOffPlans").Replace(".", ""); Response.AddHeader("Content-disposition", "attachment; filename=\"TakeOffPlans\""); Response.BinaryWrite(bArr); Response.Flush(); } } The problem is, as I'm downloading data first from server and then return the byte data, it is taking some time in downloading, so I want to show some kind of progress to show processing. Please help me on this.

    Read the article

  • Inserting text in TextBox at cursor

    - by Anil
    Hi all I have a textbox in aspx page in which the user enters text. Now when user clicks on a button called "Sin" the textbox should show "Sin[]" and the cursor has to be placed in between brackets.Like as follows "Sin[<cursor here]" Now when the user clicks on some other button say "Cos" the textbox text should show "Sin[Cos[]]" and the cursor has be placed between the brackets of Cos as follows: "Sin[Cos[<cursor here]]". How is this handled. Any simple code please.. Thanks in advance

    Read the article

  • sort data in c language

    - by ANIL MANE
    Hello C experts, I need little help on following requirement, as I know very little about C syntaxes. I have data in a file like this 73 54 57 [52] 75 73 65 [23] 65 54 57 [22] 22 59 71 [12] 22 28 54 [2] 65 22 54 73 [12] 65 28 54 73 [52] 22 28 65 73 [42] 65 54 57 73 [22] 22 28 54 73 [4] Where values in bracket denotes the occurrence of that series. I need to sort this data based on the occurrence of the data descending with maximum elements on the top as follows 65 28 54 73 [52] 22 28 65 73 [42] 65 54 57 73 [22] 65 22 54 73 [12] 22 28 54 73 [4] 28 59 71 [122] 73 54 57 [52] 22 28 65 [26] .. . . . and so on... Can someone give me a quick code for this. Thanks in advance.

    Read the article

  • Display PDF in Html

    - by anil
    Hi, i want to show PDF in a view in MVC, following function return file public ActionResult TakeoffPlans(string projID) { Highmark.BLL.Models.Project proj = GetProject(projID); List ff = proj.GetFiles(Project_Thin.Folders.CompletedTakeoff, false); ViewData["HasFile"] = "0"; if (ff != null && ff.Count 0 && ff.Where(p = p.FileExtension == "pdf").Count() 0) { ViewData["HasFile"] = "1"; } ViewData["ProjectID"] = projID; ViewData["Folder"] = Project_Thin.Folders.CompletedTakeoff; //return View("UcRenderPDF"); string fileName = Server.MapPath("~/Content/Project List Update 2.pdf"); return File(fileName, "application/pdf", Server.HtmlEncode(fileName)); } but it display some bad data in view, please help me on this

    Read the article

  • Download estimator control using JavaScript and Ajax

    - by Anil Namde
    I would like to implement the download estimator using the JavaScript and the Ajax. I have gone trough Google to find the existing implementations for the download estimator and i found most of the time asking user bandwidth and then calculating the number is strategy. It good approach and there is hardly anything on reliable to get the estimated time right. What i would like to try is use Ajax to request file size 100KB - 200 KB and do the maths get the number and update the display. Now this is surrounded with so many questions like network, number of packets formed, proxies etc ? These all factors are sufficient to turn down the approach. But THIS IS HOW I HAVE TO DO THIS ? Now i would like here inputs from you all to make it better (as good discussion)? what all can be added to this ? Can we get to know bandwidth user using without asking ?

    Read the article

  • JQuery val() does not work for textarea in Opera

    - by Anil Soman
    I am displaying a modal dialog using jQuery. This dialog has a textarea control on it. But on submitting this dialog, the value of this textarea is not recognized by jQyery for some reason. It always comes blank. This works perfectly in other browsers. I put alert to display the value but it looks blank. Can anybody help me in this regards? Controls <input type="text" id="txtGroupName"/> <textarea rows="3" cols="30" id="txtDescription"></textarea> jQuery code which used this value var postData = new Object(); postData.GroupName = $('#txtGroupName').val(); postData.Description = $('#txtDescription').val(); $('#txtDescription').val() comes blank but $('#txtGroupName').val() is read correctly as it is a input field. One more finding about this issue: When I put alert in my update function after populating the control value on page load, this alert displays the existing value properly. But it displays only existing value. It does not display the edited value after submitting the modal box.

    Read the article

  • how to retrieve distinct values from multiple columns

    - by ANIL MANE
    Hello Experts, I have a flat text file data which I import into MSSQL table. It creates and table with specified name along with multiple columns as per data file. now I need a query which will return the data and its count. e.g. data file : BREAD,MILK BREAD,DIAPER,BEER,EGGS MILK,DIAPER,BEER,COKE BREAD,MILK,DIAPER,BEER BREAD,MILK,DIAPER,COKE BREAD,ICE,MANGO JUICE,BURGER Result should be BREAD | 5 MILK | 4 DIAPER| 4 and so on.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Can i use microsoft ajax tab controls SKIN only ?

    - by Anil Namde
    I like YUI's Tab, to use its look and feel for own tab like implementation we just have to include yui tabs CSS and use markups and css classes and done. example below, <link rel="stylesheet" type="text/css" href="http://yui.yahooapis.com/2.8.0r4/build/tabview/assets/skins/sam/tabview.css" /> <ul class="yui-nav"> <li><a href="#tab1"><em>Tab One Label</em></a></li> <li class="selected"><a href="#tab2"><em>Tab Two Label</em></a></li> <li><a href="#tab3"><em>Tab Three Label</em></a></li> </ul> Now i have a site where Microsort's tab tab controls are used and there are some which are old simple tabs. Now i would like to change these old tabs to Microsoft tab structures just by using CSS if possible as we have done above for YUI. Is that possible to do that using CSS/file? How it can be done for Microsofts tab?

    Read the article

  • Outof memeory error in java

    - by anil
    hi we are getting out of memory exception for one of our process which is running in unix environmnet . how to identify the bug (we observed that there is very little chance of memory leaks in our java process). so whatelse we need analyse to find the rootcauase

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 6 7 8 9 10 11 12 13 14 15 16 17  | Next Page >