Search Results

Search found 1082 results on 44 pages for 'gaurav kumar'.

Page 10/44 | < Previous Page | 6 7 8 9 10 11 12 13 14 15 16 17  | Next Page >

  • windows shell scripting through java

    - by GAURAV JAISWAL
    i am designing a desktop application like nero for removable media storage that also includes features of copyfast. i want to add an option of my own choice in the windows explorer right click menu. how can i do that? am i proceeding in the right direction?

    Read the article

  • Launch market place with id of an application that doesn't exist in the android market place

    - by Gaurav
    Hi, I am creating an application that checks the installation of a package and then launches the market-place with its id. When I try to launch market place with id of an application say com.mybrowser.android by throwing an intent android.intent.action.VIEW with url: market://details?id=com.mybrowser.android, the market place application does launches but crashes after launch. Note: the application com.mybrowser.android doesn't exists in the market-place. MyApplication is my application. $ adb logcat I/ActivityManager( 1030): Starting activity: Intent { act=android.intent.action.MAIN cat=[android.intent.category.LAUNCHER] flg=0x10200000 cmp=myapp.testapp/.MyApplication } I/ActivityManager( 1030): Start proc myapp.testapp for activity myapp.testapp/.MyApplication: pid=3858 uid=10047 gids={1015, 3003} I/MyApplication( 3858): [ Activity CREATED ] I/MyApplication( 3858): [ Activity STARTED ] I/MyApplication( 3858): onResume D/dalvikvm( 1109): GC freed 6571 objects / 423480 bytes in 73ms I/MyApplication( 3858): Pressed OK button I/MyApplication( 3858): Broadcasting Intent: android.intent.action.VIEW, data: market://details?id=com.mybrowser.android I/ActivityManager( 1030): Starting activity: Intent { act=android.intent.action.VIEW dat=market://details?id=com.mybrowser.android flg=0x10000000 cmp=com.android.ven ding/.AssetInfoActivity } I/MyApplication( 3858): onPause I/ActivityManager( 1030): Start proc com.android.vending for activity com.android.vending/.AssetInfoActivity: pid=3865 uid=10023 gids={3003} I/ActivityThread( 3865): Publishing provider com.android.vending.SuggestionsProvider: com.android.vending.SuggestionsProvider D/dalvikvm( 1030): GREF has increased to 701 I/vending ( 3865): com.android.vending.api.RadioHttpClient$1.handleMessage(): Handle DATA_STATE_CHANGED event: NetworkInfo: type: WIFI[], state: CONNECTED/CO NNECTED, reason: (unspecified), extra: (none), roaming: false, failover: false, isAvailable: true I/ActivityManager( 1030): Displayed activity com.android.vending/.AssetInfoActivity: 609 ms (total 7678 ms) D/dalvikvm( 1030): GC freed 10458 objects / 676440 bytes in 128ms I/MyApplication( 3858): [ Activity STOPPED ] D/dalvikvm( 3865): GC freed 3538 objects / 254008 bytes in 84ms W/dalvikvm( 3865): threadid=19: thread exiting with uncaught exception (group=0x4001b180) E/AndroidRuntime( 3865): Uncaught handler: thread AsyncTask #1 exiting due to uncaught exception E/AndroidRuntime( 3865): java.lang.RuntimeException: An error occured while executing doInBackground() E/AndroidRuntime( 3865): at android.os.AsyncTask$3.done(AsyncTask.java:200) E/AndroidRuntime( 3865): at java.util.concurrent.FutureTask$Sync.innerSetException(FutureTask.java:273) E/AndroidRuntime( 3865): at java.util.concurrent.FutureTask.setException(FutureTask.java:124) E/AndroidRuntime( 3865): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:307) E/AndroidRuntime( 3865): at java.util.concurrent.FutureTask.run(FutureTask.java:137) E/AndroidRuntime( 3865): at java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1068) E/AndroidRuntime( 3865): at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:561) E/AndroidRuntime( 3865): at java.lang.Thread.run(Thread.java:1096) E/AndroidRuntime( 3865): Caused by: java.lang.NullPointerException E/AndroidRuntime( 3865): at com.android.vending.AssetItemAdapter$ReloadLocalAssetInformationTask.doInBackground(AssetItemAdapter.java:845) E/AndroidRuntime( 3865): at com.android.vending.AssetItemAdapter$ReloadLocalAssetInformationTask.doInBackground(AssetItemAdapter.java:831) E/AndroidRuntime( 3865): at android.os.AsyncTask$2.call(AsyncTask.java:185) E/AndroidRuntime( 3865): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:305) E/AndroidRuntime( 3865): ... 4 more I/Process ( 1030): Sending signal. PID: 3865 SIG: 3 I/dalvikvm( 3865): threadid=7: reacting to signal 3 I/dalvikvm( 3865): Wrote stack trace to '/data/anr/traces.txt' I/DumpStateReceiver( 1030): Added state dump to 1 crashes D/AndroidRuntime( 3865): Shutting down VM W/dalvikvm( 3865): threadid=3: thread exiting with uncaught exception (group=0x4001b180) E/AndroidRuntime( 3865): Uncaught handler: thread main exiting due to uncaught exception E/AndroidRuntime( 3865): java.lang.NullPointerException E/AndroidRuntime( 3865): at com.android.vending.controller.AssetInfoActivityController.getIdDeferToLocal(AssetInfoActivityController.java:637) E/AndroidRuntime( 3865): at com.android.vending.AssetInfoActivity.displayAssetInfo(AssetInfoActivity.java:556) E/AndroidRuntime( 3865): at com.android.vending.AssetInfoActivity.access$800(AssetInfoActivity.java:74) E/AndroidRuntime( 3865): at com.android.vending.AssetInfoActivity$LoadAssetInfoAction$1.run(AssetInfoActivity.java:917) E/AndroidRuntime( 3865): at android.os.Handler.handleCallback(Handler.java:587) E/AndroidRuntime( 3865): at android.os.Handler.dispatchMessage(Handler.java:92) E/AndroidRuntime( 3865): at android.os.Looper.loop(Looper.java:123) E/AndroidRuntime( 3865): at android.app.ActivityThread.main(ActivityThread.java:4363) E/AndroidRuntime( 3865): at java.lang.reflect.Method.invokeNative(Native Method) E/AndroidRuntime( 3865): at java.lang.reflect.Method.invoke(Method.java:521) E/AndroidRuntime( 3865): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:860) E/AndroidRuntime( 3865): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:618) E/AndroidRuntime( 3865): at dalvik.system.NativeStart.main(Native Method) I/Process ( 1030): Sending signal. PID: 3865 SIG: 3 W/ActivityManager( 1030): Process com.android.vending has crashed too many times: killing! D/ActivityManager( 1030): Force finishing activity com.android.vending/.AssetInfoActivity I/dalvikvm( 3865): threadid=7: reacting to signal 3 D/ActivityManager( 1030): Force removing process ProcessRecord{44e48548 3865:com.android.vending/10023} (com.android.vending/10023) However, when I try to launch the market place for a package that exists in the market place say com.opera.mini.android, everything works. Log for this case: D/dalvikvm( 966): GC freed 2781 objects / 195056 bytes in 99ms I/MyApplication( 1165): Pressed OK button I/MyApplication( 1165): Broadcasting Intent: android.intent.action.VIEW, data: market://details?id=com.opera.mini.android I/ActivityManager( 78): Starting activity: Intent { act=android.intent.action.VIEW dat=market://details?id=com.opera.mini.android flg=0x10000000 cmp=com.android.vending/.AssetInfoActivity } I/AndroidRuntime( 1165): AndroidRuntime onExit calling exit(0) I/WindowManager( 78): WIN DEATH: Window{44c72308 myapp.testapp/myapp.testapp.MyApplication paused=true} I/ActivityManager( 78): Process myapp.testapp (pid 1165) has died. I/WindowManager( 78): WIN DEATH: Window{44c72958 myapp.testapp/myapp.testapp.MyApplication paused=false} D/dalvikvm( 78): GC freed 31778 objects / 1796368 bytes in 142ms I/ActivityManager( 78): Displayed activity com.android.vending/.AssetInfoActivity: 214 ms (total 22866 ms) W/KeyCharacterMap( 978): No keyboard for id 65540 W/KeyCharacterMap( 978): Using default keymap: /system/usr/keychars/qwerty.kcm.bin V/RenderScript_jni( 966): surfaceCreated V/RenderScript_jni( 966): surfaceChanged V/RenderScript( 966): setSurface 480 762 0x573430 D/ViewFlipper( 966): updateRunning() mVisible=true, mStarted=true, mUserPresent=true, mRunning=true D/dalvikvm( 978): GC freed 10065 objects / 624440 bytes in 95ms Any ideas? Thanks in advance!

    Read the article

  • Drag and drop between frames - chrome

    - by Gaurav Saxena
    I have a website http://fewbs.com. I have a shortcuts (bookmarks) section onto the left. Here I provide menus and submenus and drag and drop of shortcuts and menus. Though I have been able to do it in IE and FF but its not working for opera and chrome. In IE it works by default, in FF by using -moz-user-focus: ignore; -moz-user-select: none;. Can anyone suggest how may I be able to achieve the same in opera and chrome?

    Read the article

  • Integers not properly returned from a property list (plist) array in Objective-C

    - by Gaurav
    In summary, I am having a problem where I read what I expect to be an NSNumber from an NSArray contained in a property list and instead of getting a number such as '1', I get what looks to be a memory address (i.e. '61879840'). The numbers are clearly correct in the property list. Below is my process for creating the property list and reading it back. Creating the property list I have created a simple Objective-C property list with arrays of integers within one root array: <array> <array> <integer>1</integer> <integer>2</integer> </array> <array> <integer>1</integer> <integer>2</integer> <integer>5</integer> </array> ... more arrays with integers ... </array> The arrays are NSArray objects and the integers are NSNumber objects. The property list has been created and serialized using the following code: // factorArray is an NSArray that contains NSArrays of NSNumbers as described above // serialize and compress factorArray as a property list, Factors-bin.plist NSString *error; NSString *rootPath = [NSSearchPathForDirectoriesInDomains(NSDocumentDirectory, NSUserDomainMask, YES) objectAtIndex:0]; NSString *plistPath = [rootPath stringByAppendingPathComponent:@"Factors-bin.plist"]; NSData *plistData = [NSPropertyListSerialization dataFromPropertyList:factorArray format:NSPropertyListBinaryFormat_v1_0 errorDescription:&error]; Inspecting the created plist, all values and types are correct. Reading the property list The property list is read in as Data and then converted to an NSArray: NSString *path = [[NSBundle mainBundle] pathForResource:@"Factors" ofType:@"plist"]; NSData *plistData = [[NSData alloc] initWithContentsOfFile:path]; NSPropertyListFormat format; NSString *error = nil; NSArray *factorData = (NSArray *)[NSPropertyListSerialization propertyListFromData:plistData mutabilityOption:NSPropertyListImmutable format:&format errorDescription:&error]; Cycling through factorData to see what it contains is where I see the erroneous integers: for (int i = 0; i < 10; i++) { NSArray *factorList = (NSArray *)[factorData objectAtIndex:i]; NSLog(@"Factors of %d\n", i + 1); for (int j = 0; j < [factorList count]; j++) { NSLog(@" %d\n", (NSNumber *)[factorList objectAtIndex:j]); } } I see all the correct number of values, but the values themselves are incorrect, i.e.: Factors of 3 61879840 (should be 1) 61961200 (should be 3) Factors of 4 61879840 (should be 1) 61943472 (should be 2) 61943632 (should be 4) Factors of 5 61879840 (should be 1) 61943616 (should be 5)

    Read the article

  • Treeset to order elements in descending order

    - by Gaurav Saini
    Here is the piece of code that I have used for Java 5.0 TreeSet<Integer> treeSetObj = new TreeSet<Integer>( Collections.reverseOrder() ) ; Collections.reverseOrder() is used to obtain a comparator in order to reverse the way the elements are stored and iterated. Is there a more optimized way of doing it?

    Read the article

  • Django facebook integration error

    - by Gaurav
    I'm trying to integrate facebook into my application so that users can use their FB login to login to my site. I've got everything up and running and there are no issues when I run my site using the command line python manage.py runserver But this same code refuses to run when I try and run it through Apache. I get the following error: Environment: Request Method: GET Request URL: http://helvetica/foodfolio/login Django Version: 1.1.1 Python Version: 2.6.4 Installed Applications: ['django.contrib.auth', 'django.contrib.contenttypes', 'django.contrib.sessions', 'django.contrib.sites', 'foodfolio.app', 'foodfolio.facebookconnect'] Installed Middleware: ('django.contrib.sessions.middleware.SessionMiddleware', 'facebook.djangofb.FacebookMiddleware', 'django.middleware.common.CommonMiddleware', 'django.contrib.auth.middleware.AuthenticationMiddleware', 'facebookconnect.middleware.FacebookConnectMiddleware') Template error: In template /home/swat/website-apps/foodfolio/facebookconnect/templates/facebook/js.html, error at line 2 Caught an exception while rendering: No module named app.models 1 : <script type="text/javascript"> 2 : FB_RequireFeatures(["XFBML"], function() {FB.Facebook.init("{{ facebook_api_key }}", " {% url facebook_xd_receiver %} ")}); 3 : 4 : function facebookConnect(loginForm) { 5 : FB.Connect.requireSession(); 6 : FB.Facebook.get_sessionState().waitUntilReady(function(){loginForm.submit();}); 7 : } 8 : function pushToFacebookFeed(data){ 9 : if(data['success']){ 10 : var template_data = data['template_data']; 11 : var template_bundle_id = data['template_bundle_id']; 12 : feedTheFacebook(template_data,template_bundle_id,function(){}); Traceback: File "/usr/lib/pymodules/python2.6/django/core/handlers/base.py" in get_response 92. response = callback(request, *callback_args, **callback_kwargs) File "/home/swat/website-apps/foodfolio/app/controller.py" in __showLogin__ 238. context_instance = RequestContext(request)) File "/usr/lib/pymodules/python2.6/django/shortcuts/__init__.py" in render_to_response 20. return HttpResponse(loader.render_to_string(*args, **kwargs), **httpresponse_kwargs) File "/usr/lib/pymodules/python2.6/django/template/loader.py" in render_to_string 108. return t.render(context_instance) File "/usr/lib/pymodules/python2.6/django/template/__init__.py" in render 178. return self.nodelist.render(context) File "/usr/lib/pymodules/python2.6/django/template/__init__.py" in render 779. bits.append(self.render_node(node, context)) File "/usr/lib/pymodules/python2.6/django/template/debug.py" in render_node 71. result = node.render(context) File "/usr/lib/pymodules/python2.6/django/template/__init__.py" in render 946. autoescape=context.autoescape)) File "/usr/lib/pymodules/python2.6/django/template/__init__.py" in render 779. bits.append(self.render_node(node, context)) File "/usr/lib/pymodules/python2.6/django/template/debug.py" in render_node 81. raise wrapped Exception Type: TemplateSyntaxError at /foodfolio/login Exception Value: Caught an exception while rendering: No module named app.models

    Read the article

  • Why I am not able to update the column based on a condition which is not the primary key

    - by Gaurav Sharma
    Why I am not able to update the column based on a condition which is not the primary key. I am trying to update the constituencies table where name matches a specific criterial as shown below but the below queries shows an error Error code 1064, SQL state 42000: You have an error in your SQL syntax; check the manual that corresponds to your MySQL server version for the right syntax to use near 'table constituencies set city_id = '1' where constituencies.name = "East Delhi"' at line 1 update table constituencies set city_id = '1' where constituencies.name = "East Delhi"; update table constituencies set city_id = '1' where constituencies.name = "South Delhi"; update table constituencies set city_id = '1' where constituencies.name = "Delhi Sadar"; update table constituencies set city_id = '1' where constituencies.name = "Karol Bagh"; update table constituencies set city_id = '1' where constituencies.name = "New Delhi"; update table constituencies set city_id = '1' where constituencies.name = "Outer Delhi"; update table constituencies set city_id = '1' where constituencies.name = "North East Delhi"; update table constituencies set city_id = '1' where constituencies.name = "North West Delhi"; update table constituencies set city_id = '1' where constituencies.name = "West Delhi"; Is it necessary that the condition should be checked with a primary key only ? Please throw some light on the above.

    Read the article

  • noscript tag appears even if javascript is turned on in IE8

    - by Gaurav Sharma
    ghost noscript tag more info here I am facing exactly this issue, how shall I handle this for Internet Explorer browsers :-( ? Explanation: I have included the following noscript tag in my application's layout <noscript style="background:#ffcc00;font-size:200%;font-family:verdana;text-align:center;text-transform:uppercase;font-weight:bold;padding:0.8em;">javascript is disabled, please enable it first.</noscript> Now when I view this layout in IE8 the noscript tag CSS is displaying at the top of the page without the content in it, making the layout look faulty. Please help...

    Read the article

  • router connect configuration in cakephp 1.3

    - by Gaurav Sharma
    Hello everyone, I have defined the following rule in the router.php file of my cakephp 1.3 based application Router::connect('/tags/*',array('plugin' => 'tags', 'controller' => 'Tags', 'action' => 'index', 'admin' => false)); I have used the tags plugin. When I display the tags related to a topic then the URL on the tags appears something like this http://localhost/testapp/tags/Tags/view/{tag_key_name} I want to make this url for any action to tags plugin like this http://localhost/testapp/Tags/{action}/{tag_key_name} for (view, admin_view and admin_edit) and http://localhost/testapp/Tags/{action} for (index, admin_index and any other action that does not require an id or keyname for execution)

    Read the article

  • How do I set the bake command to use a different template in cakephp

    - by Gaurav Sharma
    Hi all, I wanted bake command to bake a view of my liking. So I searched bakery and found this Modify-default-HTML-produced-by-baked-templates. But after reading this I was not able to modify the template because I wanted to define some CSS in it and those files are not containing any CSS code (they contain only php code inside them). Also if I have designed my own CSS file for the new template then how do I tell bake command to pick that specified css file for new template ? I am totally confused over here. Has anybody done this similar kinda work using cakePHP. Any help would be greatly appreciable. NOTE: I am using cakePHP v 1.3 latest stable release. Thanks

    Read the article

  • How do I show information to users belonging to different groups (web) in modx

    - by Gaurav Sharma
    Hello Everyone, I have created a website using modx evolution v1.0.2. The website that I have developed has 12 different types of users (categorized in groups). Each user will be shown a different price depending on the group to which he belongs. Till now I have been able to fetch the group name of current logged in user (created a snippet for that), but how can I achieve the above mentioned functionality so that each user should be able to see only the price that I have coded according to his group. For example: If a user is associated with the 'ocassional' group then he should be shown the price as , say, 50 bucks and if a user is associated with the 'regular' group then he should be shown the price as, say, 40 bucks I can easily do this by coding a single snippet for every product's variant, but there are a lot of variants (more than 100 and growing). I have created a resource(page) for every product and it's variant. Every variant has a price. It is this price that I want to be shown according to the logged in user group membership. I hope I am able to explain my query clearly. Please help me do this functionality. Thanks

    Read the article

  • yahoo's attribute exchange -> blank data is coming

    - by Gaurav Sharma
    Hello everybody, I am trying to build openid login system for my website. To do this I used JanRain's php openid library v 2.1.3. I am also using openid selector to select the openid provider from the list. I first created the attributes array that I need to fetch from the provider as follows: $attribute[] = Auth_OpenID_AX_AttrInfo::make('http://axschema.org/contact/email',2,1, 'email'); $attribute[] = Auth_OpenID_AX_AttrInfo::make('http://axschema.org/namePerson/first',1,1, 'firstname'); $attribute[] = Auth_OpenID_AX_AttrInfo::make('http://axschema.org/namePerson/last',1,1, 'lastname'); $attribute[] = Auth_OpenID_AX_AttrInfo::make('http://axschema.org/namePerson',1,1, 'fullname'); $attribute[] = Auth_OpenID_AX_AttrInfo::make('http://axschema.org/namePerson/friendly',1,1, 'username'); $ax = new Auth_OpenID_AX_FetchRequest; foreach($attribute as $attr) { $ax-add($attr); } $auth_request-addExtension($ax); and in the finish_auth.php file I wrote this to fetch the attributes returned $ax = new Auth_OpenID_AX_FetchResponse(); $obj = $ax-fromSuccessResponse($response); Google gives me all the attributes requested but yahoo doesn't (as stated here that yahoo now supports attribute exchange). Is there any limitation set by yahoo on attribute exchange too. (they give limited websites access to sreg extension of openid). :( Please help me, I am stuck over here. Thanks

    Read the article

  • values assigned to Template variables disappear after page refresh in modx

    - by Gaurav Sharma
    Hi all, I created a template variable in modx by the name 'test_var'. Then in the home page resource edit content editor I wrote [*test_var*]. Then I published the resource. Then for checking if it works I executed the page using the preview button. The value appeared fine but when I refreshed the page, the value of the template variable disappeared ? This is very strange. Please help me what I am doing wrong. Thanks

    Read the article

  • Symmetric ds issue

    - by gaurav
    Hi , I am using postgresql8.3 and include symmetris ds 1.5.1 in my application.But the replication is done fine for client to server . but the replication is not done from server to client. I am newer to use the symmetric ds .Can anyone plese let me know the checklist of using symmetric ds for cheching that my symmetric ds is well configure or not. Thank You very Much

    Read the article

  • Evaluating a function at a particular value in parallel

    - by Gaurav Kalra
    Hi. The question may seem vague, but let me explain it. Suppose we have a function f(x,y,z ....) and we need to find its value at the point (x1,y1,z1 .....). The most trivial approach is to just replace (x,y,z ...) with (x1,y1,z1 .....). Now suppose that the function is taking a lot of time in evaluation and I want to parallelize the algorithm to evaluate it. Obviously it will depend on the nature of function, too. So my question is: what are the constraints that I have to look for while "thinking" to parallelize f(x,y,z...)? If possible, please share links to study.

    Read the article

  • PHP Video Editing and Streaming

    - by Gaurav Padia
    Hi, I am developing online video streaming website on PHP. I need two functionalities: Need to add title/text at bottom of the video dynamically. Need to add background music to video dynamically. Is it possible with PHP or any available open source library? Can anyone guide me or provide links to this type of library ? Thanks.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Developing a custom-validation in asp.net for specific control and criteria

    - by Gaurav
    Hello There is another relevant question asked Validation Check in asp.net In the same scenario we need a custom validator control which will alert user for any wrong entry. This will work like this : Developer will pass the control-name, input-value and format-required For instance like for textbox it can be: txtName,txtName.Text, allow-alphabets-only The accordingly format if the user input is invalid he/she will be got prompt. Please suggest the right way to do the smae. Thanks in advance.

    Read the article

  • database schema explanation of the cakedc tags plugin

    - by Gaurav Sharma
    Hello everyone, I found an awesome tags plugin on cakedc site. This plugin makes your tagging concerns very easy and is able to make anything taggable. Has anyone used it? I find it a bit difficult to understand few things listed below: difference between the name and keyname columns of the tags table. the use of columns 'identifier', 'weight' in tags table Thanks

    Read the article

  • How do I secure all the admin actions in all controllers in cakePHP

    - by Gaurav Sharma
    Hello Everyone, I am developing an application using cakePHP v 1.3 on windows (XAMPP). Most of the controllers are baked with the admin routing enabled. I want to secure the admin actions of every controller with a login page. How can I do this without repeating much ? One solution to the problem is that "I check for login information in the admin_index action of every controller" and then show the login screen accordingly. Is there any better way of doing this ? The detault URL to admin (http://localhost/app/admin) is pointing to the index_admin action of users controller (created a new route for this in routes.php file) Thanks

    Read the article

  • How to get the place name by latitude and longitude using openstreetmap in android

    - by Gaurav kumar
    In my app i am using osm rather than google map.I have latitude and longitude.So from here how i will query to get the city name from osm database..please help me. final String requestString = "http://nominatim.openstreetmap.org/reverse?format=json&lat=" + Double.toString(lat) + "&lon=" + Double.toString(lon) + "&zoom=18&addressdetails=1"; RequestBuilder builder = new RequestBuilder(RequestBuilder.GET, URL.encode(requestString)); try { @SuppressWarnings("unused") Request request = builder.sendRequest(null, new RequestCallback() { @Override public void onResponseReceived(Request request, Response response) { if (response.getStatusCode() == 200) { String city = ""; try { JSONValue json = JSONParser.parseStrict(response); JSONObject address = json.isObject().get("address").isObject(); final String quotes = "^\"|\"$"; if (address.get("city") != null) { city = address.get("city").toString().replaceAll(quotes, ""); } else if (address.get("village") != null) { city = address.get("village").toString().replaceAll(quotes, ""); } } catch (Exception e) { } } } }); } catch (Exception e1) { }

    Read the article

< Previous Page | 6 7 8 9 10 11 12 13 14 15 16 17  | Next Page >