Search Results

Search found 1056 results on 43 pages for 'mahesh kumar'.

Page 10/43 | < Previous Page | 6 7 8 9 10 11 12 13 14 15 16 17  | Next Page >

  • jQuery ajax doesn't seem to be reading HTML data in Chromium

    - by Mahesh
    I have an HTML (App) file that reads another HTML (data) file via jQuery.ajax(). It then finds specific tags in the data HTML file and uses text within the tags to display sort-of tool tips. Here's the App HTML file: <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" lang="en-US" xml:lang="en-US"> <head> <title>Test</title> <style type="text/css"> <!--/* <![CDATA[ */ body { font-family : sans-serif; font-size : medium; margin-bottom : 5em; } a, a:hover, a:visited { text-decoration : none; color : #2222aa; } a:hover { background-color : #eeeeee; } #stat_preview { position : absolute; background : #ccc; border : thin solid #aaa; padding : 3px; font-family : monospace; height : 2.5em; } /* ]]> */--> </style> <script type="text/javascript" src="http://code.jquery.com/jquery-1.4.2.min.js"></script> <script type="text/javascript"> //<![CDATA[ $(document).ready(function() { $("#stat_preview").hide(); $(".cfg_lnk").mouseover(function () { lnk = $(this); $.ajax({ url: lnk.attr("href"), success: function (data) { console.log (data); $("#stat_preview").html("A heading<br>") .append($(".tool_tip_text", $(data)).slice(0,3).text()) .css('left', (lnk.offset().left + lnk.width() + 30)) .css('top', (lnk.offset().top + (lnk.height()/2))) .show(); } }); }).mouseout (function () { $("#stat_preview").hide(); }); }); //]]> </script> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1" /> </head> <body> <h1>Test</h1> <ul> <li><a class="cfg_lnk" href="data.html">Sample data</a></li> </ul> <div id="stat_preview"></div> </body> </html> And here is the data HTML <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" lang="en-US" xml:lang="en-US"> <head> <title>Test</title> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1" /> </head> <body> <h1>Test</h1> <table> <tr> <td class="tool_tip_text"> Some random value 1</td> <td class="tool_tip_text"> Some random value 2</td> <td class="tool_tip_text"> Some random value 3</td> <td class="tool_tip_text"> Some random value 4</td> <td class="tool_tip_text"> Some random value 5</td> </tr> <tr> <td class="tool_top_text"> Some random value 11</td> <td class="tool_top_text"> Some random value 21</td> <td class="tool_top_text"> Some random value 31</td> <td class="tool_top_text"> Some random value 41</td> <td class="tool_top_text"> Some random value 51</td> </tr> </table> </body> </html> This is working as intended in Firefox, but not in Chrome (Chromium 5.0.356.0). The console.log (data) displays empty string in Chromium's JavaScript console. Firebug in Firefox, however, displays the entire data HTML. Am I missing something? Any pointers?

    Read the article

  • mutating, trigger/function may not see it- error during execution of trigger

    - by mahesh soni
    CREATE OR REPLACE TRIGGER UPDATE_TEST_280510 AFTER insert on TEST_TRNCOMPVISIT declare V_TRNCOMPNO NUMBER(10); CURSOR C1 IS SELECT B.COMPNO FROM TEST_TRNCOMPVISIT A, TEST_TRNCOMPMST B, TEST_MEMMAST C WHERE A.COMPNO=B.COMPNO AND B.TRNMEMID=C.MEMID AND C.MEMOS=1000; begin open c1; fetch c1 into V_TRNCOMPNO; UPDATE TEST_TRNCOMPMST SET COMPSTATUS='P', remark='comp is pending due to O/S1000' WHERE COMPNO=V_TRNCOMPNO AND COMPSTATUS='C'; CLOSE C1; end; I have made this trigger and while insert the row in table- TEST_TRNCOMPVISIT it gives following error- The following error has occurred: ORA-04091: table TEST.TEST_TRNCOMPVISIT is mutating, trigger/function may not see it ORA-06512: at "TEST.UPDATE_TEST_280510", line 4 ORA-06512: at "TEST.UPDATE_TEST_280510", line 10 ORA-04088: error during execution of trigger 'TEST.UPDATE_TEST_280510' Kindly suggest over this. MaheshA.....

    Read the article

  • I want to find the span tag beween the LI tag and its attributes but no luck.

    - by Mahesh
    I want to find the span tag beween the LI tag and its attributes. Trying with beautful soap but no luck. Details of my code. Is any one point me right methodlogy In this this code, my getId function should return me id = "0_False-2" Any one know right method? from BeautifulSoup import BeautifulSoup as bs import re html = '<ul>\ <li class="line">&nbsp;</li>\ <li class="folder-open-last" id="0">\ <img style="float: left;" class="trigger" src="/media/images/spacer.gif" border="0">\ <span class="text" id="0_False">NOC</span><ul style="display: block;"><li class="line">&nbsp;</li><li class="doc" id="1"><span class="active text" id="0_False-1">PNQAIPMS1</span></li><li class="line">&nbsp;</li><li class="doc-last" id="2"><span class="text" id="0_False-2">PNQAIPMS2</span></li><li class="line-last"></li></ul></li><li class="line-last"></li>\ </ul>' def getId(html, txt): soup = bs(html) soup.findAll('ul',recursive=False) head = soup.contents[0] temp = head elements = {} while True: # It temp is None that means no HTML tags are available if temp == None: break #print temp if re.search('li', str( temp)) != None: attr = str(temp.attrs).encode('ascii','ignore') attr = attr.replace(' ', '') attr = attr.replace('[', '') attr = attr.replace(']', '') attr = attr.replace(')', '') attr = attr.replace('(', '') attr = attr.replace('u\'', '') attr = attr.replace('\'', '') attr = attr.split(',') span = str(temp.text) if span == txt: return attr[3] temp = temp.next else: temp = temp.next id = getId(html,"PNQAIPMS2") print "ID = " + id

    Read the article

  • IOError: [Errno 13] Permission denied when trying to read an file in google app engine

    - by mahesh
    I want to read an XML file and parse it, for that I had used SAX parser which requires file as input to parse. For that I had stored my XML file in Entity called XMLDocs with following property XMLDocs Entity Name name : Property of string type content : property of blob type (will contain my xml file) Reason I had to store file like this as I had not yet provide my billing detail to google Now when I try to open this file in my I am getting error of permission denied.. Please help me, what I have to do... You can see that error by running my app at www.parsepython.appspot.com

    Read the article

  • How to gain Access to member variables of a class using void pointer but Not Object

    - by mahesh
    Hi, I am trying to access member variables of a class without using object. please let me know how to go about. class TestMem { int a; int b; public: TestMem(){} void TestMem1() { a = 10; b = 20; } }; void (TestMem::*pMem)(); int main(int argc, char* argv[]) { TestMem o1; pMem = &(TestMem::TestMem1); void *p = (void*)&pMem; // How to access a & b member variables using variable p getch(); return 0; }

    Read the article

  • AIR:- Desktop Application related to Window Component (Need some work around)

    - by Mahesh Parate
    Create custom component which contains Combobox and Datagrid. Application conations two button 1) Same Window and 2) New Window. (Label of two button) When you click on “Same Window” button your custom component should get added dynamically in your application. And when you click on “New Window” button your custom component should get open in different window (it should get shifted from application and should appear in Window component). Issue faced:- Clicking on Combobox, list is not getting open as change event doesn’t get fired in Native Window as it looses reference from main application. Issue with DataGrid in Native window (AIR). • DataGridEvent.COLUMN_STRETCH event get affected if try to open datagrid in Native Window. • DataGridEvent get fired but takes long time or even stuck while column stretch Note: Application is an Desktop Application. Only one instance is created in Application for your custom component to preserve current state on your custom component it can be Style, data, or other subcomponent state of your custom component (as above mentioned 2 component are just sample). Please find sample code below:- DataGridStretchIssue.mxml:- < ?xml version="1.0" encoding="utf-8"? < mx:WindowedApplication xmlns:mx="http://www.adobe.com/2006/mxml" layout="absolute" xmlns:local="*" width="800" height="500" < mx:Script < ![CDATA[ import mx.events.FlexEvent; import mx.core.Window; private var dgComp:DataGridComp = new DataGridComp(); private var win:Window; private function clickHandler(event:Event):void{ dgComp.percentWidth = 100; dgComp.percentHeight = 100; dgComp.x = 50; dgComp.y = 100; if(win){ win.close(); } this.addChild(dgComp); } private function openClickHandler(event:MouseEvent):void{ dgComp.x = 50; dgComp.y = 100; win = new Window();; win.width = 800; win.height = 500; win.addChild(dgComp); dgComp.percentWidth = 100; dgComp.percentHeight = 100; dgComp.x = 50; dgComp.y = 100; win.open(true) } ]]> < /mx:Script < mx:HBox <mx:Button id="btnID" click="clickHandler(event)" label="Same Window"/> <mx:Button id="btnIDOpen" click="openClickHandler(event)" label="New Window"/> < /mx:HBox < /mx:WindowedApplication DataGridComp.mxml < ?xml version="1.0" encoding="utf-8"? < mx:Canvas xmlns:mx="http://www.adobe.com/2006/mxml" width="100%" height="100%" <mx:Script> <![CDATA[ import mx.events.DataGridEvent; import mx.collections.ArrayCollection; [Bindable] public var cards:ArrayCollection = new ArrayCollection( [ {label:"Visa", data:1}, {label:"MasterCard", data:2}, {label:"American Express", data:3} ]); private function stretchFn(event:DataGridEvent):void{ trace("--- Stretched---") } ]]> </mx:Script> <mx:HBox> <mx:ComboBox dataProvider="{cards}" width="150"/> <mx:DataGrid columnStretch="stretchFn(event)" > <mx:ArrayCollection> <mx:Object> <mx:Artist>Pavement</mx:Artist> <mx:Price>11.99</mx:Price> <mx:Album>Slanted and Enchanted</mx:Album> </mx:Object> <mx:Object> <mx:Artist>Pavement</mx:Artist> <mx:Album>Brighten the Corners</mx:Album> <mx:Price>11.99</mx:Price> </mx:Object> </mx:ArrayCollection> </mx:DataGrid> </mx:HBox> < /mx:Canvas Can any one suggest me some work around to make my code workable... :)

    Read the article

  • ERD-CLASS design

    - by Mahesh
    Hello guyz,i am new to daatbase and class diagram.I just get scenarios from internet and try to develop ERD and Class Diagram for them.But the following scenario has caused me some problems, and i am not sure about my design. "Whenever an employee fills leave application form, the leave application should be appeared for approval to his/her team leader. Team Leader has the option to change the date of requested leave and to approve or reject the leave. Employee also has the option to change date of previously unapproved leaves or to cancel any of unapproved leave. In case of team leader, he can approve his own leaves. Management should be able to create categories of leaves like (Casual, Sick, Planned work, etc) and should be able to adjust the days allocated to each type of leave". I have identified these as entities for ERD 1) Employee(I think i dont need to make entity for Technical lead,since he is an employee) 2) LeaveHistory 3) LeaveCategory Plz correct me if the system need more classes or entities

    Read the article

  • Django OR Rails

    - by Mahesh
    Its not the another language debate, its a decision making discussion. I am a ASP.NET developer, but want to learn other frameworks/language (open source). I don't know from where i should start and why? Django and Rails both seems promising, but i am confused which one i should choose to start, or i should choose some other framework. I know learning the language (python or ruby) is must before start Django or Rails. Please advise.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to create mapping for a List<SomeNativeType> in FluentNhibernate ?

    - by Mahesh Velaga
    Hi all, I am trying to create a mapping file for the following Model using Fluent NHibernate. But, I am not sure of how to do the mapping for the List in the mapping file. public class MyClass { public virtual Guid Id { get; set; } public virtual string Name { get; set; } public virtual List<string> MagicStrings { get; set; } } public class EnvironmentMapping : ClassMap<Models.Environment> { public EnvironmentMapping() { Id(x => x.Id); Map(x => x.Name); //HasMany(x => string) What should this be ? } } Help in this regard is much appreciated. Thanks!

    Read the article

  • Sql Calculation And Sort By Date

    - by mahesh
    I have Confusion against utilize If,Else Statement against calculation of stock By date. And sort the same by date. There is real challenge to calculate running total between equal date: If date is equal If date is greater than If date is less than My Table Schema Is: TransID int, Auto Increment Date datetime, Inwards decimal(12,2) Outward decimal(12,2) Suppose If I have Records as Below: TransID Date(DD/MM/YYYY) Inward Outward 1 03/02/2011 100 2 12/04/2010 200 3 03/02/2011 400 Than Result Should be: TransID Date(DD/MM/YYYY) Inward Outward Balance 1 03/02/2011 100 -100 2 12/04/2010 200 -300 3 03/02/2011 400 100 I wants to calculate Inward - outwards = Balance and Balance count as running total as above. but the condition that it should be as per date order How to sort and calculate it by date and transID? What is transact SQL IN SQL_SERVER-2000**?.

    Read the article

  • Multiple winform data save problem

    - by Mahesh
    hi am using C# with VS-2005 I have a form1 and about two textBox and one Combobox on it. like below textBox1 texbox2 ComboBox I have bind combobox by sql database. first user type in textbox1 and textbox2 and then goes to comboBox in which "BuyerName" available on it. if user not found the data in the comboBox then press ALT+C for opening of Form2 where they create data and save it. My problem is when I closed the form2 by saving data of "BuyerName" the form1 is open as per my requirement but the data of textBox1 and textBox2 which user typed before opening of form2 is lost and therefore user have to re-type on it. which i don't want as it wasting of time. I want when form2 closed and form1 open the data will be available on it. and when u create fresh "BuyerName" from form2 the "BuyerName" will be automaticaly available on form1 comboBox on closing of form2. Hope u will get it. am new here in programing so kindly suggest me by proper codeing. thx in Advance.

    Read the article

  • .NET Conditional Callback on a type.

    - by Mahesh
    I have a stock price which changes by nature all the time. And, there will be many users who wants to buy that stock. Let's say that the stock price is started at 10 and let's say, 30 people bid for 10.98, 20 people bid for 7.45, 100 people bid for 8.99. During the day, the stock price can touch any of these values, and if that happens, I want to execute all the orders for users who quoted that price. Technically, I am storing in a List. Whenever the price changes, I am checking against all the values in the list and executing those that satisfy the quoted price. Class Bids { string stockname; double quote; } Is there any better alternative way to callback the satisfied items in the list rather than checking all the items whenever there is a change?? If storing in a list is not right way of doing it, let me know the best way.

    Read the article

  • Sorting Dynamically generated HTML Table

    - by Mahesh Varia
    I am generating a dynamic HTML table string and displaying inside a div. I am assigning ID and runat server in that string. eg. string s="<table id='tblAll' runat='server'></table>". This string is generated on some different page, and its passed as XmlhttpResponseText I want to apply sorting on this table, It would be great if any one can help me out. Thanks

    Read the article

  • virtual keyword in different scenarios

    - by Mahesh
    I figured out 2 different meanings for virtual based on the situation it is being used. If a baseClass has a function defined virtual, then the derivedClass is going to override the function. The baseClass::~baseClass() should be defined virtual, if there is any class derived from it. Here it means, the derived class destruction first takes place followed by base class destruction. Are there any other situations where virtual hold a different meaning ?

    Read the article

  • Save Sql Recordset into the Flat text file?

    - by mahesh kumar
    Hi, i need to dump my sql query result into the text file. i have created the following query, DECLARE @cmd VARCHAR(2048) SET @cmd = 'OSQL -localhost -CRN370 ' + ' -UCRN370 -PCRN370' + ' -Q"SELECT TOP 5 GageId FROM EwQMS370..msgages"' + ' -oc:\authors.txt' EXEC master..xp_cmdshell @cmd, NO_OUTPUT The above query created the text file authors.txt. But the content of the file shows the following error message " Error: Conflicting switches : -U and -E " Any help really appreciated

    Read the article

  • How to determine the current view bounds in split view of Ipad App?

    - by Mahesh
    Hello friends, I have tried following code to determine current view bounds in shouldAutoRotate.. fn UIViewController *temp1 = [appDelegate.splitViewController.viewControllers objectAtIndex:1]; float screenwidth = temp1.view.bounds.size.width; float screenheight = temp1.view.bounds.size.height; bt actually when u rotate from one mode to another, it provides the bound values of old one insted the fresh bound values..? Any one know that how to achieve it?

    Read the article

< Previous Page | 6 7 8 9 10 11 12 13 14 15 16 17  | Next Page >