Search Results

Search found 232 results on 10 pages for 'tibco gi'.

Page 10/10 | < Previous Page | 6 7 8 9 10 

• CodePlex Daily Summary for Thursday, June 20, 2013

  CodePlex Daily Summary for Thursday, June 20, 2013Popular ReleasesHyper-V Management Pack Extensions 2012: HyperVMPE2012: Hyper-V Management Pack Extensions 2012 Beta ReleasePS3 Library .NET v3: PS3 Library v3: No bug found - Current Version 3.0.0.0 Put the PS3Lib.XML file in the same directory for get all comments for each methods.Outlook 2013 Add-In: Email appointments: This new version includes the following changes: - Ability to drag emails to the calendar to create appointments. Will gather all the recipients from all the emails and create an appointment on the day you drop the emails, with the text and subject of the last selected email (if more than one selected). - Increased maximum of numbers to display appointments to 30. You will have to uninstall the previous version (add/remove programs) if you had installed it before. Before unzipping the file...Caliburn Micro: WPF, Silverlight, WP7 and WinRT/Metro made easy.: Caliburn.Micro v1.5.2: v1.5.2 - This is a service release. We've fixed a number of issues with Tasks and IoC. We've made some consistency improvements across platforms and fixed a number of minor bugs. See changes.txt for details. Packages Available on Nuget Caliburn.Micro – The full framework compiled into an assembly. Caliburn.Micro.Start - Includes Caliburn.Micro plus a starting bootstrapper, view model and view. Caliburn.Micro.Container – The Caliburn.Micro inversion of control container (IoC); source code...CODE Framework: 4.0.30618.0: See change notes in the documentation section for details on what's new. Note: If you download the class reference help file with, you have to right-click the file, pick "Properties", and then unblock the file, as many browsers flag the file as blocked during download (for security reasons) and thus hides all content.Toolbox for Dynamics CRM 2011: XrmToolBox (v1.2013.6.18): XrmToolbox improvement Use new connection controls (use of Microsoft.Xrm.Client.dll) New display capabilities for tools (size, image and colors) Added prerequisites check Added Most Used Tools feature Tools improvementNew toolSolution Transfer Tool (v1.0.0.0) developed by DamSim Updated toolView Layout Replicator (v1.2013.6.17) Double click on source view to display its layoutXml All tools list Access Checker (v1.2013.6.17) Attribute Bulk Updater (v1.2013.6.18) FetchXml Tester (v1.2013.6.1...Media Companion: Media Companion MC3.570b: New* Movie - using XBMC TMDB - now renames movies if option selected. * Movie - using Xbmc Tmdb - Actor images saved from TMDb if option selected. Fixed* Movie - Checks for poster.jpg against missing poster filter * Movie - Fixed continual scraping of vob movie file (not DVD structure) * Both - Correctly display audio channels * Both - Correctly populate audio info in nfo's if multiple audio tracks. * Both - added icons and checked for DTS ES and Dolby TrueHD audio tracks. * Both - Stream d...Document.Editor: 2013.24: What's new for Document.Editor 2013.24: Improved Video Editing support Improved Link Editing support Minor Bug Fix's, improvements and speed upsExtJS based ASP.NET Controls: FineUI v3.3.0: ??FineUI ?? ExtJS ??? ASP.NET ???。 FineUI??? ?? No JavaScript，No CSS，No UpdatePanel，No ViewState，No WebServices ???????。 ?????? IE 7.0、Firefox 3.6、Chrome 3.0、Opera 10.5、Safari 3.0+ ???? Apache License v2.0 ?：ExtJS ?? GPL v3 ?????(http://www.sencha.com/license)。 ???? ??：http://fineui.com/bbs/ ??：http://fineui.com/demo/ ??：http://fineui.com/doc/ ??：http://fineui.codeplex.com/ FineUI???? ExtJS ?????????，???? ExtJS ?。 ????? FineUI ? ExtJS ?：http://fineui.com/bbs/forum.php?mod=viewthrea...BarbaTunnel: BarbaTunnel 8.0: Check Version History for more information about this release.ExpressProfiler: ExpressProfiler v1.5: [+] added Start time, End time event columns [+] added SP:StmtStarting, SP:StmtCompleted events [*] fixed bug with Audit:Logout eventpatterns & practices: Data Access Guidance: Data Access Guidance Drop4 2013.06.17: Drop 4Microsoft Ajax Minifier: Microsoft Ajax Minifier 4.94: add dstLine and dstCol attributes to the -Analyze output in XML mode. un-combine leftover comma-separates expression statements after optimizations are complete so downstream tools don't stack-overflow on really deep comma trees. add support for using a single source map generator instance with multiple runs of MinifyJavaScript, assuming that the results are concatenated to the same output file.Kooboo CMS: Kooboo CMS 4.1.1: The stable release of Kooboo CMS 4.1.0 with fixed the following issues: https://github.com/Kooboo/CMS/issues/1 https://github.com/Kooboo/CMS/issues/11 https://github.com/Kooboo/CMS/issues/13 https://github.com/Kooboo/CMS/issues/15 https://github.com/Kooboo/CMS/issues/19 https://github.com/Kooboo/CMS/issues/20 https://github.com/Kooboo/CMS/issues/24 https://github.com/Kooboo/CMS/issues/43 https://github.com/Kooboo/CMS/issues/45 https://github.com/Kooboo/CMS/issues/46 https://github....VidCoder: 1.5.0 Beta: The betas have started up again! If you were previously on the beta track you will need to install this to get back on it. That's because you can now run both the Beta and Stable version of VidCoder side-by-side! Note that the OpenCL and Intel QuickSync changes being tested by HandBrake are not in the betas yet. They will appear when HandBrake integrates them into the main branch. Updated HandBrake core to SVN 5590. This adds a new FDK AAC encoder. The FAAC encoder has been removed and now...Wsus Package Publisher: Release v1.2.1306.16: Date/Time are displayed as Local Time. (Last Contact, Last Report and DeadLine) Wpp now remember the last used path for update publishing. (See 'Settings' Form for options) Add an option to allow users to publish an update even if the Framework has judged the certificate as invalid. (Attention : Using this option will NOT allow you to publish or revise an update if your certificate is really invalid). When publishing a new update, filter update files to ensure that there is not files wi...Employee Info Starter Kit: v6.0 - ASP.NET MVC Edition: Release Home - Getting Started - Hands on Coding Walkthrough – Technology Stack - Design & Architecture EISK v6.0 – ASP.NET MVC edition bundles most of the greatest and successful platforms, frameworks and technologies together, to enable web developers to learn and build manageable and high performance web applications with rich user experience effectively and quickly. User End SpecificationsCreating a new employee record Read existing employee records Update an existing employee reco...OLAP PivotTable Extensions: Release 0.8.1: Use the 32-bit download for... Excel 2007 Excel 2010 32-bit (even Excel 2010 32-bit on a 64-bit operating system) Excel 2013 32-bit (even Excel 2013 32-bit on a 64-bit operating system) Use the 64-bit download for... Excel 2010 64-bit Excel 2013 64-bit Just download and run the EXE. There is no need to uninstall the previous release. If you have problems getting the add-in to work, see the Troubleshooting Installation wiki page. The new features in this release are: View #VALUE! Err...DirectXTex texture processing library: June 2013: June 15, 2013 Custom filtering implementation for Resize & GenerateMipMaps(3D) - Point, Box, Linear, Cubic, and Triangle TEX_FILTER_TRIANGLE finite low-pass triangle filter TEX_FILTER_WRAP, TEX_FILTER_MIRROR texture semantics for custom filtering TEX_FILTER_BOX alias for TEX_FILTER_FANT WIC Ordered and error diffusion dithering for non-WIC conversion sRGB gamma correct custom filtering and conversion DDS_FLAGS_EXPAND_LUMINANCE - Reader conversion option for L8, L16, and A8L8 legacy ...WPF Application Framework (WAF): WPF Application Framework (WAF) 3.0.0.440: Version: 3.0.0.440 (Release Candidate): This release contains the source code of the WPF Application Framework (WAF) and the sample applications. Please build the whole solution before you start one of the sample applications. Requirements .NET Framework 4.5 (The package contains a solution file for Visual Studio 2012) Changelog Legend: [B] Breaking change; [O] Marked member as obsolete Samples: Use ValueConverters via StaticResource instead of x:Static. Other Downloads Downloads OverviewNew Projectsarduinoay: Plays 8-bit chip tunes and sends the data to an Arduino device acting as a serial device, which then sends it to an AY-3-8910/YM-2149 PSG.Aricie - Lucene Search: Aricie - Lucene Search is a powerful DotNetNuke module and Search / Indexing provider replacement based on Lucene.Net, with many extensibility pointsBalloon: coolBattaglia Navale: Battaglia Navale xml battaglia navale xml xaml data binding Broma Mod Launcher: It's a mod launcher for ArmA 2, possibly 3 in the futureC#Duino: Tento projekt Vás provede zacátky vývoje aplikací pro NetDuino Plus a Arduino Nano ve vývojovém prostredí Microsoft Visual Studio 2012 v jazyce .NET C#Customer Management Information System: Customer Management Information System (CMIS)Demo1: this is a demoFedFramework: ...FractionCPP: C++ Library for Fractional Arithmetic with Overflow Detection: This is a C++ library providing a 'Fraction' class that implements full precision arithmetic operations on rational numbers with overflow detection.InfoSys: InfoSysJQuerySamples: Gallery of jquery samples in asp.net applicationKookaburra library: Kookaburray LibraryLombiq Antispam Orchard module: An Orchard module for better spam protection.Lombiq Security Orchard module: An Orchard module to enhance security.MailWithAttachment: Outlook,Forgot to attach an Item while sending a very important mail. Use this Add-in. The Safest Risk.miaoshow: ????，????MyFramework: this project is a simple mvvmc frameworkNew Style SSO for use in BizTalk Projects: A new style of SSO config. The purpose of this project is to make it very easy to store items in SSO. Although there are several projects dedicated to SSO none of them were easy enough to use straight away. The idea is to have a base class that knows how to save/load itself from SSO. So when you need a config item stored in SSO, simply create a new class with some properties, Inherit from SSO Base functionality and Presto. You are done. Your class will have some extra methods to help you....newsandalert: project summarynoppoj: DirvingSystemprakark06192013Git01: bold* _italics_ +underline+ ! Heading 1 !! Heading 2 * Bullet List ** Bullet List 2 # Number List ## Number List 2 [another wiki page] [url:http://www.example.cprakark06192013Hg01: *bold* _italics_ +underline+ ! Heading 1 !! Heading 2 * Bullet List ** Bullet List 2 # Number List ## Number List 2 [another wiki page] [url:http://www.example.prakark06192013tfs01: *bold* _italics_ +underline+ ! Heading 1 !! Heading 2 * Bullet List ** Bullet List 2 # Number List ## Number List 2 [another wiki page] [url:http://www.example.PS3 Library .NET v3: Communicate via PS3 easily with .NET Applications !Quick Apply: This project is for anyone who is a job seeker. What it does is automates the job application process. This project is open to anyone: coders, users, ideas.Starting Windows 8 App Development with HTML/CSS/JS: This is a beginner's guide to creating Windows 8 Store Apps using HTML/CSS/JavaScript.Test Automation As A Service: Over the three years we have been developing a azure cloud based solution to provide "Test Automaton as a Service" (TaaaS) using a hybrid automation approachtestdd06192013hg01: fdgVMConnect.exe replacement using FreeRDP.exe: This is a replacemnet for VMconnect.exe that you do not get with Free Core Server 2012 to allow you to connect to your VM's from the Server console.vtccds: vtccdsWaterNet: ????Worklight Portal: Chuong trình Academic c?a IBM s? t? ch?c l?p h?c cho các giáo viên. Mobile Application Development with IBM Worklight V5 (WU503) XTool: jdk????????

  Read the article

• Uploadify Not Working

  - by azz0r

  Hello, I'll re-edit this to tackle the uploadify issue. Its very strange, essentially the script isn't uploading and isn't triggering onAllComplete. Also if I try to upload an image that's to large, and click Upload files, it skips from 0 to 100%. But does not trigger onAllComplete. It does not upload either. Whats strange, is I have an earlier revision of this and the codes no different and it works, ive tried switched back to the same jquery/uploadify/layout and it still doesnt work. However due to the nature of uploadify not being very forthcoming about errors or whats going on, I can't figure out where its going wrong! Controller: public function manageImagesAction() { $id = $this->_getParam('id'); $object = Eurocreme_Gallery::load_by_fields(array('id' => $id), 1); $images = Eurocreme_Image::load_by_type(array('type' => 'gallery_id', 'values' => $id, 'from' => 0, 'to' => COUNT_HIGH, 'order' => 'gi.position ASC')); $this->view->object = $object; $this->view->images = $images; $this->view->headScript()->appendFile('/library/jquery/uploadify/swfobject.js'); $this->view->headScript()->appendFile('/library/jquery/uploadify/jquery.uploadify.v2.1.0.js'); $this->view->headScript()->appendFile('/library/jquery/ui.js'); } View: <div class="content-area"> <h1>Adding Images To "<?php echo $this->object->name; ?>" Gallery</h1> <p><input id="fileInput2" name="fileInput2" type="file" /></p> <p><a href="javascript:$('#fileInput2').uploadifyUpload();">Upload Files</a> | <a href="javascript:$('#fileInput2').uploadifyClearQueue();">Clear Queue</a></p> </div> <?php if (!empty($this->images)) { ?> <div class="content-area"> <h1>Order Images For <?php echo $this->object->name; ?></h1> <p id="status_update">Drop And Drag Images to re-order them, I will automatically save it for you!</p> <ul id="sort_list"> <?php foreach ($this->images as $image) { ?> <li class="removable" id="recordsArray_<?php echo $image->id; ?>"><img src="/images/Image/thumb/<?php echo $image->image_url; ?>" alt="<?php echo $image->name_url; ?>" title="<?php echo $image->name; ?>" /><p><a class="removable" id="<?php echo $image->id; ?>">Delete</a></p></li> <?php } ?> </ul> <p class="clear"></p> </div> <?php } ?> <?php $this->headScript()->captureStart(); ?> $('document').ready(function() { $("#fileInput2").uploadify({ 'uploader' : '/library/jquery/uploadify/uploadify.swf', 'script' : '/<?php echo $this->object->name_url; ?>/upload.php', 'cancelImg' : '/library/jquery/uploadify/cancel.png', 'folder' : '/images/Image/', 'multi' : true, 'onAllComplete' : function(e, queueId, file, response, data) { window.location.reload(); }, }) //sortable $(function() { $("#sort_list").sortable({ opacity: 0.6, cursor: 'move', update: function() { $("#status_update").html('Processing'); var order = $(this).sortable("serialize"); $.post("/administration/gallery/save-image-order/id/<?php echo $this->object->id; ?>", order, function(theResponse){ $("#status_update").html(theResponse); }); } }); //delete $('a.removable').click(function(){ var id = this.id; $.post("/administration/gallery/delete-image/gallery_id/<?php echo $this->object->id; ?>/image_id/"+id+"", '', function(theResponse) { $("#recordsArray_"+id+"").remove(); }); }); }); }); <?php $this->headScript()->captureEnd(); ?>

  Read the article

• Reverse engineering windows mobile live search CellID location awareness protocol (yikes)...

  - by Jean-Charles

  I wasn't sure of how to form the question so I apologize if the title is misleading. Additionally, you may want to get some coffee and take a seat for this one ... It's long. Basically, I'm trying to reverse engineer the protocol used by the Windows Mobile Live Search application to get location based on cellID. Before I go on, I am aware of other open source services (such as OpenCellID) but this is more for the sake of education and a bit for redundancy. According to the packets I captured, a POST request is made to ... mobile.search.live.com/positionlookupservice_1/service.aspx ... with a few specific headers (agent, content-length, etc) and no body. Once this goes through, the server sends back a 100-Continue response. At this point, the application submits this data (I chopped off the packet header): 00 00 00 01 00 00 00 05 55 54 ........UT 46 2d 38 05 65 6e 2d 55 53 05 65 6e 2d 55 53 01 F-8.en-US.en-US. 06 44 65 76 69 63 65 05 64 75 6d 6d 79 01 06 02 .Device.dummy... 50 4c 08 0e 52 65 76 65 72 73 65 47 65 6f 63 6f PL..ReverseGeoco 64 65 01 07 0b 47 50 53 43 68 69 70 49 6e 66 6f de...GPSChipInfo 01 20 06 09 43 65 6c 6c 54 6f 77 65 72 06 03 43 . ..CellTower..C 47 49 08 03 4d 43 43 b6 02 07 03 4d 4e 43 03 34 GI..MCC....MNC.4 31 30 08 03 4c 41 43 cf 36 08 02 43 49 fd 01 00 10..LAC.6..CI... 00 00 00 ... And receives this in response (packet and HTTP response headers chopped): 00 00 00 01 00 00 00 00 01 06 02 50 4c ...........PL 06 08 4c 6f 63 61 6c 69 74 79 06 08 4c 6f 63 61 ..Locality..Loca 74 69 6f 6e 07 03 4c 61 74 09 34 32 2e 33 37 35 tion..Lat.42.375 36 32 31 07 04 4c 6f 6e 67 0a 2d 37 31 2e 31 35 621..Long.-71.15 38 39 33 38 00 07 06 52 61 64 69 75 73 09 32 30 8938...Radius.20 30 30 2e 30 30 30 30 00 42 07 0c 4c 6f 63 61 6c 00.0000.B..Local 69 74 79 4e 61 6d 65 09 57 61 74 65 72 74 6f 77 ityName.Watertow 6e 07 16 41 64 6d 69 6e 69 73 74 72 61 74 69 76 n..Administrativ 65 41 72 65 61 4e 61 6d 65 0d 4d 61 73 73 61 63 eAreaName.Massac 68 75 73 65 74 74 73 07 10 50 6f 73 74 61 6c 43 husetts..PostalC 6f 64 65 4e 75 6d 62 65 72 05 30 32 34 37 32 07 odeNumber.02472. 0b 43 6f 75 6e 74 72 79 4e 61 6d 65 0d 55 6e 69 .CountryName.Uni 74 65 64 20 53 74 61 74 65 73 00 00 00 ted States... Now, here is what I've determined so far: All strings are prepended with one byte that is the decimal equivalent of their length. There seem to be three different casts that are used throughout the request and response. They show up as one byte before the length byte. I've concluded that the three types map out as follows: 0x06 - parent element (subsequent values are children, closed with 0x00) 0x07 - string 0x08 - int? Based on these determinations, here is what the request and response look like in a more readable manner (values surrounded by brackets denote length and values surrounded by parenthesis denote a cast): \0x00\0x00\0x00\0x01\0x00\0x00\0x00 [5]UTF-8 [5]en-US [5]en-US \0x01 [6]Device [5]dummy \0x01 (6)[2]PL (8)[14]ReverseGeocode\0x01 (7)[11]GPSChipInfo[1]\0x20 (6)[9]CellTower (6)[3]CGI (8)[3]MCC\0xB6\0x02 //310 (7)[3]MNC[3]410 //410 (8)[3]LAC\0xCF\0x36 //6991 (8)[2]CI\0xFD\0x01 //259 \0x00 \0x00 \0x00 \0x00 and.. \0x00\0x00\0x00\0x01\0x00\0x00\0x00 \0x00\0x01 (6)[2]PL (6)[8]Locality (6)[8]Location (7)[3]Lat[9]42.375621 (7)[4]Long[10]-71.158938 \0x00 (7)[6]Radius[9]2000.0000 \0x00 \0x42 //"B" ... Has to do with GSM (7)[12]LocalityName[9]Watertown (7)[22]AdministrativeAreaName[13]Massachusetts (7)[16]PostalCodeNumber[5]02472 (7)[11]CountryName[13]United States \0x00 \0x00\0x00 My analysis seems to work out pretty well except for a few things: The 0x01s throughout confuse me ... At first I thought they were some sort of base level element terminators but I'm not certain. I'm not sure the 7-byte header is, in fact, a seven byte header. I wonder if it's maybe 4 bytes and that the three remaining 0x00s are of some other significance. The trailing 0x00s. Why is it that there is only one on the request but two on the response? The type 8 cast mentioned above ... I can't seem to figure out how those values are being encoded. I added comments to those lines with what the values should correspond to. Any advice on these four points will be greatly appreciated. And yes, these packets were captured in Watertown, MA. :)

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Form contents not showing in email

  - by fmz

  This is a followup to a question I posted yesterday. I thought everything was working fine, but today, I am not getting any results in the email from the drop down field. Here is the form code in question: <label for="purpose"><span class="required">*</span> Purpose</label> <select id="purpose" name="purpose" style="width: 300px; height:35px;"> <option value="" selected="selected">-- Select One --</option> <option value="I am interested in your services">I am interested in your services!</option> <option value="I am interested in a partnership">I am interested in a partnership!</option> <option value="I am interested in a job">I am interested in a job!</option> </select> It is then processed in PHP and should output the selected option to an email, however the Reason for Contact line always comes through with nothing in it. Here is the PHP code: <?php if(!$_POST) exit; $name = $_POST['name']; $company = $_POST['company']; $email = $_POST['email']; $phone = $_POST['phone']; $purpose = $_POST['purpose']; $comments = $_POST['comments']; $verify = $_POST['verify']; if(trim($name) == '') { echo '<div class="error_message">Attention! You must enter your name.</div>'; exit(); } else if(trim($email) == '') { echo '<div class="error_message">Attention! Please enter a valid email address.</div>'; exit(); } else if(trim($phone) == '') { echo '<div class="error_message">Attention! Please enter a valid phone number.</div>'; exit(); } else if(!isEmail($email)) { echo '<div class="error_message">Attention! You have enter an invalid e-mail address, try again.</div>'; exit(); } if(trim($comments) == '') { echo '<div class="error_message">Attention! Please enter your message.</div>'; exit(); } else if(trim($verify) == '') { echo '<div class="error_message">Attention! Please enter the verification number.</div>'; exit(); } else if(trim($verify) != '4') { echo '<div class="error_message">Attention! The verification number you entered is incorrect.</div>'; exit(); } if($error == '') { if(get_magic_quotes_gpc()) { $comments = stripslashes($comments); } // Configuration option. // Enter the email address that you want to emails to be sent to. // Example $address = "[email protected]"; $address = "[email protected]"; // Configuration option. // i.e. The standard subject will appear as, "You've been contacted by John Doe." // Example, $e_subject = '$name . ' has contacted you via Your Website.'; $e_subject = 'You\'ve been contacted by ' . $name . '.'; // Configuration option. // You can change this if you feel that you need to. // Developers, you may wish to add more fields to the form, in which case you must be sure to add them here. $e_body = "You have been contacted by $name.\r\n\n"; $e_company = "Company: $company\r\n\n"; $e_content = "Comments: \"$comments\"\r\n\n"; $e_purpose = "Reason for contact: $purpose\r\n\n"; $e_reply = "You can contact $name via email, $email or via phone $phone"; $msg = $e_body . $e_content . $e_company . $e_purpose . $e_reply; if(mail($address, $e_subject, $msg, "From: $email\r\nReply-To: $email\r\nReturn-Path: $email\r\n")) { // Email has sent successfully, echo a success page. echo "<fieldset>"; echo "<div id='success_page'>"; echo "<h1>Email Sent Successfully.</h1>"; echo "<p>Thank you <strong>$name</strong>, your message has been submitted to us.</p>"; echo "</div>"; echo "</fieldset>"; } else { echo 'ERROR!'; } } function isEmail($email) { // Email address verification, do not edit. return(preg_match("/^[-_.[:alnum:]]+@((([[:alnum:]]|[[:alnum:]][[:alnum:]-]*[[:alnum:]])\.)+(ad|ae|aero|af|ag|ai|al|am|an|ao|aq|ar|arpa|as|at|au|aw|az|ba|bb|bd|be|bf|bg|bh|bi|biz|bj|bm|bn|bo|br|bs|bt|bv|bw|by|bz|ca|cc|cd|cf|cg|ch|ci|ck|cl|cm|cn|co|com|coop|cr|cs|cu|cv|cx|cy|cz|de|dj|dk|dm|do|dz|ec|edu|ee|eg|eh|er|es|et|eu|fi|fj|fk|fm|fo|fr|ga|gb|gd|ge|gf|gh|gi|gl|gm|gn|gov|gp|gq|gr|gs|gt|gu|gw|gy|hk|hm|hn|hr|ht|hu|id|ie|il|in|info|int|io|iq|ir|is|it|jm|jo|jp|ke|kg|kh|ki|km|kn|kp|kr|kw|ky|kz|la|lb|lc|li|lk|lr|ls|lt|lu|lv|ly|ma|mc|md|mg|mh|mil|mk|ml|mm|mn|mo|mp|mq|mr|ms|mt|mu|museum|mv|mw|mx|my|mz|na|name|nc|ne|net|nf|ng|ni|nl|no|np|nr|nt|nu|nz|om|org|pa|pe|pf|pg|ph|pk|pl|pm|pn|pr|pro|ps|pt|pw|py|qa|re|ro|ru|rw|sa|sb|sc|sd|se|sg|sh|si|sj|sk|sl|sm|sn|so|sr|st|su|sv|sy|sz|tc|td|tf|tg|th|tj|tk|tm|tn|to|tp|tr|tt|tv|tw|tz|ua|ug|uk|um|us|uy|uz|va|vc|ve|vg|vi|vn|vu|wf|ws|ye|yt|yu|za|zm|zw)$|(([0-9][0-9]?|[0-1][0-9][0-9]|[2][0-4][0-9]|[2][5][0-5])\.){3}([0-9][0-9]?|[0-1][0-9][0-9]|[2][0-4][0-9]|[2][5][0-5]))$/i",$email)); } ?> Any assistance would be greatly appreciated. Thanks!

  Read the article

• Can't connect to SSL web service with WS-Security using PHP SOAP extension - certificate, complex WSDL

  - by BillF

  Using the PHP5 SOAP extension I have been unable to connect to a web service having an https endpoint, with client certificate and using WS-Security, although I can connect using soapUI with the exact same wsdl and client certificate, and obtain the normal response to the request. There is no HTTP authentication and no proxy is involved. The message I get is 'Could not connect to host'. Have been able to verify that I am NOT hitting the host server. (Earlier I wrongly said that I was hitting the server.) The self-signed client SSL certificate is a .pem file converted by openssl from a .p12 keystore which in turn was converted by keytool from a .jks keystore having a single entry consisting of private key and client certificate. In soapUI I did not need to supply a server private certificate, the only two files I gave it were the wdsl and pem. I did have to supply the pem and its passphrase to be able to connect. I am speculating that despite the error message my problem might actually be in the formation of the XML request rather than the SSL connection itself. The wsdl I have been given has nested complex types. The php server is on my Windows XP laptop with IIS. The code, data values and WSDL extracts are shown below. (The WSSoapClient class simply extends SoapClient, adding a WS-Security Username Token header with mustUnderstand = true and including a nonce, both of which the soapUI call had required.) Would so much appreciate any help. I'm a newbie thrown in at the deep end, and how! Have done vast amounts of Googling on this over many days, following many suggestions and have read Pro PHP by Kevin McArthur. An attempt to use classmaps in place of nested arrays also fell flat. The Code class STEeService { public function invokeWebService(array $connection, $operation, array $request) { try { $localCertificateFilespec = $connection['localCertificateFilespec']; $localCertificatePassphrase = $connection['localCertificatePassphrase']; $sslOptions = array( 'ssl' => array( 'local_cert' => $localCertificateFilespec, 'passphrase' => $localCertificatePassphrase, 'allow_self-signed' => true, 'verify_peer' => false ) ); $sslContext = stream_context_create($sslOptions); $clientArguments = array( 'stream_context' => $sslContext, 'local_cert' => $localCertificateFilespec, 'passphrase' => $localCertificatePassphrase, 'trace' => true, 'exceptions' => true, 'encoding' => 'UTF-8', 'soap_version' => SOAP_1_1 ); $oClient = new WSSoapClient($connection['wsdlFilespec'], $clientArguments); $oClient->__setUsernameToken($connection['username'], $connection['password']); return $oClient->__soapCall($operation, $request); } catch (exception $e) { throw new Exception("Exception in eServices " . $operation . " ," . $e->getMessage(), "\n"); } } } $connection is as follows: array(5) { ["username"]=> string(8) "DFU00050" ["password"]=> string(10) "Fabricate1" ["wsdlFilespec"]=> string (63) "c:/inetpub/wwwroot/DMZExternalService_Concrete_WSDL_Staging.xml" ["localCertificateFilespec"]=> string(37) "c:/inetpub/wwwroot/ClientKeystore.pem" ["localCertificatePassphrase"]=> string(14) "password123456" } $clientArguments is as follows: array(7) { ["stream_context"]=> resource(8) of type (stream-context) ["local_cert"]=> string(37) "c:/inetpub/wwwroot/ClientKeystore.pem" ["passphrase"]=> string(14) "password123456" ["trace"]=> bool(true) ["exceptions"]=> bool(true) ["encoding"]=> string(5) "UTF-8" ["soap_version"]=> int(1) } $operation is as follows: 'getConsignmentDetails' $request is as follows: array(1) { [0]=> array(2) { ["header"]=> array(2) { ["source"]=> string(9) "customerA" ["accountNo"]=> string(8) "10072906" } ["consignmentId"]=> string(11) "GKQ00000085" } } Note how there is an extra level of nesting, an array wrapping the request which is itself an array. This was suggested in a post although I don't see the reason, but it seems to help avoid other exceptions. The exception thrown by ___soapCall is as follows: object(SoapFault)#6 (9) { ["message":protected]=> string(25) "Could not connect to host" ["string":"Exception":private]=> string(0) "" ["code":protected]=> int(0) ["file":protected]=> string(43) "C:\Inetpub\wwwroot\eServices\WSSecurity.php" ["line":protected]=> int(85) ["trace":"Exception":private]=> array(5) { [0]=> array(6) { ["file"]=> string(43) "C:\Inetpub\wwwroot\eServices\WSSecurity.php" ["line"]=> int(85) ["function"]=> string(11) "__doRequest" ["class"]=> string(10) "SoapClient" ["type"]=> string(2) "->" ["args"]=> array(4) { [0]=> string(1240) " DFU00050 Fabricate1 E0ByMUA= 2010-10-28T13:13:52Z customerA10072906GKQ00000085 " [1]=> string(127) "https://services.startrackexpress.com.au:7560/DMZExternalService/InterfaceServices/ExternalOps.serviceagent/OperationsEndpoint1" [2]=> string(104) "/DMZExternalService/InterfaceServices/ExternalOps.serviceagent/OperationsEndpoint1/getConsignmentDetails" [3]=> int(1) } } [1]=> array(4) { ["function"]=> string(11) "__doRequest" ["class"]=> string(39) "startrackexpress\eservices\WSSoapClient" ["type"]=> string(2) "->" ["args"]=> array(5) { [0]=> string(1240) " DFU00050 Fabricate1 E0ByMUA= 2010-10-28T13:13:52Z customerA10072906GKQ00000085 " [1]=> string(127) "https://services.startrackexpress.com.au:7560/DMZExternalService/InterfaceServices/ExternalOps.serviceagent/OperationsEndpoint1" [2]=> string(104) "/DMZExternalService/InterfaceServices/ExternalOps.serviceagent/OperationsEndpoint1/getConsignmentDetails" [3]=> int(1) [4]=> int(0) } } [2]=> array(6) { ["file"]=> string(43) "C:\Inetpub\wwwroot\eServices\WSSecurity.php" ["line"]=> int(70) ["function"]=> string(10) "__soapCall" ["class"]=> string(10) "SoapClient" ["type"]=> string(2) "->" ["args"]=> array(4) { [0]=> string(21) "getConsignmentDetails" [1]=> array(1) { [0]=> array(2) { ["header"]=> array(2) { ["source"]=> string(9) "customerA" ["accountNo"]=> string(8) "10072906" } ["consignmentId"]=> string(11) "GKQ00000085" } } [2]=> NULL [3]=> object(SoapHeader)#5 (4) { ["namespace"]=> string(81) "http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-secext-1.0.xsd" ["name"]=> string(8) "Security" ["data"]=> object(SoapVar)#4 (2) { ["enc_type"]=> int(147) ["enc_value"]=> string(594) " DFU00050 Fabricate1 E0ByMUA= 2010-10-28T13:13:52Z " } ["mustUnderstand"]=> bool(true) } } } [3]=> array(6) { ["file"]=> string(42) "C:\Inetpub\wwwroot\eServices\eServices.php" ["line"]=> int(87) ["function"]=> string(10) "__soapCall" ["class"]=> string(39) "startrackexpress\eservices\WSSoapClient" ["type"]=> string(2) "->" ["args"]=> array(2) { [0]=> string(21) "getConsignmentDetails" [1]=> array(1) { [0]=> array(2) { ["header"]=> array(2) { ["source"]=> string(9) "customerA" ["accountNo"]=> string(8) "10072906" } ["consignmentId"]=> string(11) "GKQ00000085" } } } } [4]=> array(6) { ["file"]=> string(58) "C:\Inetpub\wwwroot\eServices\EnquireConsignmentDetails.php" ["line"]=> int(44) ["function"]=> string(16) "invokeWebService" ["class"]=> string(38) "startrackexpress\eservices\STEeService" ["type"]=> string(2) "->" ["args"]=> array(3) { [0]=> array(5) { ["username"]=> string(10) "DFU00050 " ["password"]=> string(12) "Fabricate1 " ["wsdlFilespec"]=> string(63) "c:/inetpub/wwwroot/DMZExternalService_Concrete_WSDL_Staging.xml" ["localCertificateFilespec"]=> string(37) "c:/inetpub/wwwroot/ClientKeystore.pem" ["localCertificatePassphrase"]=> string(14) "password123456" } [1]=> string(21) "getConsignmentDetails" [2]=> array(1) { [0]=> array(2) { ["header"]=> array(2) { ["source"]=> string(9) "customerA" ["accountNo"]=> string(8) "10072906" } ["consignmentId"]=> string(11) "GKQ00000085" } } } } } ["previous":"Exception":private]=> NULL ["faultstring"]=> string(25) "Could not connect to host" ["faultcode"]=> string(4) "HTTP" } Here are some WSDL extracts (TIBCO BusinessWorks): <xsd:complexType name="TransactionHeaderType"> <xsd:sequence> <xsd:element name="source" type="xsd:string"/> <xsd:element name="accountNo" type="xsd:integer"/> <xsd:element name="userId" type="xsd:string" minOccurs="0"/> <xsd:element name="transactionId" type="xsd:string" minOccurs="0"/> <xsd:element name="transactionDatetime" type="xsd:dateTime" minOccurs="0"/> </xsd:sequence> </xsd:complexType> <xsd:element name="getConsignmentDetailRequest"> <xsd:complexType> <xsd:sequence> <xsd:element name="header" type="prim:TransactionHeaderType"/> <xsd:element name="consignmentId" type="prim:ID" maxOccurs="unbounded"/> </xsd:sequence> </xsd:complexType> </xsd:element> <xsd:element name="getConsignmentDetailResponse"> <xsd:complexType> <xsd:sequence> <xsd:element name="consignment" type="freight:consignmentType" minOccurs="0" maxOccurs="unbounded"/> </xsd:sequence> </xsd:complexType> </xsd:element> <xsd:element name="getConsignmentDetailRequest"> <xsd:complexType> <xsd:sequence> <xsd:element name="header" type="prim:TransactionHeaderType"/> <xsd:element name="consignmentId" type="prim:ID" maxOccurs="unbounded"/> </xsd:sequence> </xsd:complexType> </xsd:element> <xsd:element name="getConsignmentDetailResponse"> <xsd:complexType> <xsd:sequence> <xsd:element name="consignment" type="freight:consignmentType" minOccurs="0" maxOccurs="unbounded"/> </xsd:sequence> </xsd:complexType> </xsd:element> <wsdl:operation name="getConsignmentDetails"> <wsdl:input message="tns:getConsignmentDetailsRequest"/> <wsdl:output message="tns:getConsignmentDetailsResponse"/> <wsdl:fault name="fault1" message="tns:fault"/> </wsdl:operation> <wsdl:service name="ExternalOps"> <wsdl:port name="OperationsEndpoint1" binding="tns:OperationsEndpoint1Binding"> <soap:address location="https://services.startrackexpress.com.au:7560/DMZExternalService/InterfaceServices/ExternalOps.serviceagent/OperationsEndpoint1"/> </wsdl:port> </wsdl:service> And here in case it's relevant is the WSSoapClient class: <?PHP namespace startrackexpress\eservices; use SoapClient, SoapVar, SoapHeader; class WSSoapClient extends SoapClient { private $username; private $password; /*Generates a WS-Security header*/ private function wssecurity_header() { $timestamp = gmdate('Y-m-d\TH:i:s\Z'); $nonce = mt_rand(); $passdigest = base64_encode(pack('H*', sha1(pack('H*', $nonce).pack('a*', $timestamp).pack('a*', $this->password)))); $auth = ' <wsse:Security SOAP-ENV:mustUnderstand="1" xmlns:wsse="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-secext-1.0.xsd"> <wsse:UsernameToken> <wsse:Username>' . $this->username . '</wsse:Username> <wsse:Password Type="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-username-token-profile-1.0#PasswordText">' . $this->password . '</wsse:Password> <wsse:Nonce>' . base64_encode(pack('H*', $nonce)).'</wsse:Nonce> <wsu:Created xmlns:wsu="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-utility-1.0.xsd">' . $timestamp . '</wsu:Created> </wsse:UsernameToken> </wsse:Security> '; $authvalues = new SoapVar($auth, XSD_ANYXML); $header = new SoapHeader("http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-secext-1.0.xsd", "Security",$authvalues, true); return $header; } // Sets a username and passphrase public function __setUsernameToken($username,$password) { $this->username=$username; $this->password=$password; } // Overwrites the original method, adding the security header public function __soapCall($function_name, $arguments, $options=null, $input_headers=null, $output_headers=null) { try { $result = parent::__soapCall($function_name, $arguments, $options, $this->wssecurity_header()); return $result; } catch (exception $e) { throw new Exception("Exception in __soapCall, " . $e->getMessage(), "\n"); } } } ?> Update: The request XML would have been as follows: <?xml version="1.0" encoding="UTF-8"?> <SOAP-ENV:Envelope xmlns:SOAP-ENV="http://schemas.xmlsoap.org/soap/envelope/" xmlns:ns1="http://startrackexpress/Common/Primitives/v1" xmlns:ns2="http://startrackexpress/Common/actions/externals/Consignment/v1" xmlns:ns3="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-secext-1.0.xsd"> <SOAP-ENV:Header> <wsse:Security SOAP-ENV:mustUnderstand="1" xmlns:wsse="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-secext-1.0.xsd"> <wsse:UsernameToken> <wsse:Username>DFU00050</wsse:Username> <wsse:Password Type="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-username-token-profile-1.0#PasswordText">Fabricate1</wsse:Password> <wsse:Nonce>M4FIeGA=</wsse:Nonce> <wsu:Created xmlns:wsu="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-utility-1.0.xsd">2010-10-29T14:05:27Z</wsu:Created> </wsse:UsernameToken> </wsse:Security> </SOAP-ENV:Header> <SOAP-ENV:Body><ns2:getConsignmentDetailRequest> <ns2:header><ns1:source>customerA</ns1:source><ns1:accountNo>10072906</ns1:accountNo></ns2:header> <ns2:consignmentId>GKQ00000085</ns2:consignmentId> </ns2:getConsignmentDetailRequest></SOAP-ENV:Body> </SOAP-ENV:Envelope> This was obtained with the following code in WSSoapClient: public function __doRequest($request, $location, $action, $version) { echo "<p> " . htmlspecialchars($request) . " </p>" ; return parent::__doRequest($request, $location, $action, $version); }

  Read the article

• Getting Selected Dropdown content to show in a form-generated email

  - by fmz

  I have a small contact form: <form method="post" action="contact.php" name="contactform" id="contactform"> <fieldset> <legend>Please fill in the following form to contact us</legend> <label for="name"><span class="required">*</span> Your Name</label> <input name="name" type="text" id="name" size="30" value="" /> <br /> <label for="company"><span class="required">*</span> Company</label> <input name="company" type="text" id="name" size="30" value="" /> <br /> <label for="email"><span class="required">*</span> Email</label> <input name="email" type="text" id="email" size="30" value="" /> <br /> <label for="phone"><span class="required">*</span> Phone</label> <input name="phone" type="text" id="phone" size="30" value="" /> <br /> <label for="purpose"><span class="required">*</span> Purpose</label> <select id="purpose" style="width: 300px; height:35px;"> <option value="I am interested in your services">I am interested in your services!</option> <option value="I am interested in a partnership">I am interested in a partnership!</option> <option value="I am interested in a job">I am interested in a job!</option> </select> <br /> <label for=comments><span class="required">*</span> Comments</label> <textarea name="comments" cols="40" rows="3" id="comments" style="width: 350px;"></textarea> <p><span class="required">*</span> Please help us control spam.</p> <label for=verify accesskey=V>&nbsp;&nbsp;&nbsp;3 + 1 =</label> <input name="verify" type="text" id="verify" size="4" value="" style="width: 30px;" /><br /><br /> <input type="submit" class="submit" id="submit" value="Submit" /> </fieldset> </form> I want to send the results of the form in a php generated email. Everything is coming through except the selected contents of the "purpose" drop down. Here is the PHP: <?php if(!$_POST) exit; $name = $_POST['name']; $company = $_POST['company']; $email = $_POST['email']; $phone = $_POST['phone']; $purpose = $_POST['purpose']; $comments = $_POST['comments']; $verify = $_POST['verify']; if(trim($name) == '') { echo '<div class="error_message">Attention! You must enter your name.</div>'; exit(); } else if(trim($company) == '') { echo '<div class="error_message">Attention! Please enter your company name.</div>'; exit(); } else if(trim($email) == '') { echo '<div class="error_message">Attention! Please enter a valid email address.</div>'; exit(); } else if(trim($phone) == '') { echo '<div class="error_message">Attention! Please enter a valid phone number.</div>'; exit(); } else if(!isEmail($email)) { echo '<div class="error_message">Attention! You have enter an invalid e-mail address, try again.</div>'; exit(); } if(trim($comments) == '') { echo '<div class="error_message">Attention! Please enter your message.</div>'; exit(); } else if(trim($verify) == '') { echo '<div class="error_message">Attention! Please enter the verification number.</div>'; exit(); } else if(trim($verify) != '4') { echo '<div class="error_message">Attention! The verification number you entered is incorrect.</div>'; exit(); } if($error == '') { if(get_magic_quotes_gpc()) { $comments = stripslashes($comments); } // Configuration option. // Enter the email address that you want to emails to be sent to. // Example $address = "[email protected]"; $address = "[email protected]"; // Configuration option. // i.e. The standard subject will appear as, "You've been contacted by John Doe." // Example, $e_subject = '$name . ' has contacted you via Your Website.'; $e_subject = 'You\'ve been contacted by ' . $name . '.'; // Configuration option. // You can change this if you feel that you need to. // Developers, you may wish to add more fields to the form, in which case you must be sure to add them here. $e_body = "You have been contacted by $name.\r\n\n"; $e_content = "Comments: \"$comments\"\r\n\n"; $e_company = "Company: $company\r\n\n"; $e_purpose = "Reason for contact: $purpose\r\n"; $e_reply = "You can contact $name via email, $email or via phone $phone"; $msg = $e_body . $e_content . $e_company . $e_purpose . $e_reply; if(mail($address, $e_subject, $msg, "From: $email\r\nReply-To: $email\r\nReturn-Path: $email\r\n")) { // Email has sent successfully, echo a success page. echo "<fieldset>"; echo "<div id='success_page'>"; echo "<h1>Email Sent Successfully.</h1>"; echo "<p>Thank you <strong>$name</strong>, your message has been submitted to us.</p>"; echo "</div>"; echo "</fieldset>"; } else { echo 'ERROR!'; } } function isEmail($email) { // Email address verification, do not edit. return(preg_match("/^[-_.[:alnum:]]+@((([[:alnum:]]|[[:alnum:]][[:alnum:]-]*[[:alnum:]])\.)+(ad|ae|aero|af|ag|ai|al|am|an|ao|aq|ar|arpa|as|at|au|aw|az|ba|bb|bd|be|bf|bg|bh|bi|biz|bj|bm|bn|bo|br|bs|bt|bv|bw|by|bz|ca|cc|cd|cf|cg|ch|ci|ck|cl|cm|cn|co|com|coop|cr|cs|cu|cv|cx|cy|cz|de|dj|dk|dm|do|dz|ec|edu|ee|eg|eh|er|es|et|eu|fi|fj|fk|fm|fo|fr|ga|gb|gd|ge|gf|gh|gi|gl|gm|gn|gov|gp|gq|gr|gs|gt|gu|gw|gy|hk|hm|hn|hr|ht|hu|id|ie|il|in|info|int|io|iq|ir|is|it|jm|jo|jp|ke|kg|kh|ki|km|kn|kp|kr|kw|ky|kz|la|lb|lc|li|lk|lr|ls|lt|lu|lv|ly|ma|mc|md|mg|mh|mil|mk|ml|mm|mn|mo|mp|mq|mr|ms|mt|mu|museum|mv|mw|mx|my|mz|na|name|nc|ne|net|nf|ng|ni|nl|no|np|nr|nt|nu|nz|om|org|pa|pe|pf|pg|ph|pk|pl|pm|pn|pr|pro|ps|pt|pw|py|qa|re|ro|ru|rw|sa|sb|sc|sd|se|sg|sh|si|sj|sk|sl|sm|sn|so|sr|st|su|sv|sy|sz|tc|td|tf|tg|th|tj|tk|tm|tn|to|tp|tr|tt|tv|tw|tz|ua|ug|uk|um|us|uy|uz|va|vc|ve|vg|vi|vn|vu|wf|ws|ye|yt|yu|za|zm|zw)$|(([0-9][0-9]?|[0-1][0-9][0-9]|[2][0-4][0-9]|[2][5][0-5])\.){3}([0-9][0-9]?|[0-1][0-9][0-9]|[2][0-4][0-9]|[2][5][0-5]))$/i",$email)); } ?> What am I missing? Thanks.

  Read the article

< Previous Page | 6 7 8 9 10