Search Results

Search found 1048 results on 42 pages for 'vineel kumar reddy'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 10/42 | < Previous Page | 6 7 8 9 10 11 12 13 14 15 16 17  | Next Page >

  • Oracle 10g - JAXB unmarshalling is not working as expected

    - by Santhosh Reddy Mandadi
    We're using Oracle 10g application server and deployed the Web service and trying to deploy the web service client. Server is working fine i.e.; marshalling is working fine. We're getting the output from the service properly but the search client is not unmarshalling (parsing) the response received. We're using all the tags under same name space so there is no name space problem. Different collections would exists in the XSD. Has anyone faced similar kind of issue? Is there any solution for this? Thanks Santhosh

    Read the article

  • Rich text box in Crystal Reports

    - by Reddy
    I have created rich text box in crystal reports for displaying product description. Everything is displaying properly but it is not taking more than 65534 characters. I need to display more than 65534, so please any one can help me to use is there any other control like richtext box to display the data.

    Read the article

  • stopping android handler loop

    - by venka reddy
    Hi, i am using a class which extends Handler class to update my activity UI. The code is as follows in side main activity, /////////////////////////////// public class RefreshHandler extends Handler { public void handleMessage(Message msg) { Homeform.this.updateUI(); } public void sleep(long delayMillis) { this.removeMessages(0); sendMessageDelayed(obtainMessage(0), delayMillis); } }; private void updateUI(){ Log.v("","== I am inside Update UUI====================="); refresh(); mRedrawHandler.sleep(5000); } /////////////////////////// And i had call this method handleMessage() on the object of RefreshHandler as follows /////////////////////////////////////////// mRedrawHandler = new RefreshHandler(); mRedrawHandler.handleMessage(new Message()); //////////////////////////////////////////////// But here i am facing one problem that is it is running after closing my application also . please solve my problem to stop this handler when close this application. ThanQ.....

    Read the article

  • Any certifications for Mainframe experience? Please suggest...

    - by Raja Reddy
    I'm having experience of 3years in Mainframe and working in India, for a reputed US Telecom MNC. I have expertise on COBOL, JCL, REXX and DB2. Can somebody suggest on doing some certifications. I know there are IBM standard DB2 certification, but do we have anything else? Your help is really appreciated. And also let me know if somebody from telecom industry are around..

    Read the article

  • C++ library for generating a SOAP message using WSDL

    - by Harsha Reddy
    Hi guys, Do you know of any C++ libraries can can generate SOAP messages using the WSDL. I am writing a C++ client application and am looking for such a library. I however cannot use gSoap and wsdlpull. SOAP Client library (SQLData Systems) looks like another library which could help me (though I am not too sure) but its results page shows an error while dealing with Apache Axis and I might have to use that. Are there any other libraries? Thanks for the help. Regards, Harsha

    Read the article

  • A question on delegates and method parameters

    - by Srinivas Reddy Thatiparthy
    public class Program { delegate void Srini(string param); static void Main(string[] args) { Srini sr = new Srini(PrintHello1); sr += new Srini(PrintHello2); //case 2: sr += new Srini(delegate(string o) { Console.WriteLine(o); }); sr += new Srini(delegate(object o) { Console.WriteLine(o.ToString()); }); //case 4: sr += new Srini(delegate { Console.WriteLine(“This line is accepted,though the method signature is not Comp”); });//case 5 sr("Hello World"); Console.Read(); } static void PrintHello1(string param) { Console.WriteLine(param); } static void PrintHello2(object param) { Console.WriteLine(param); } } Compiler doesn't complain about the case 2(see the comment),well,the reason is straight forward since string inherits from object. ,along the same lines ,Why is it complaining for anonymous method types(see the comment //case 4:) that “Cannot convert anonymous method to delegate type 'DelegateTest.Program.Srini' because the parameter types do not match the delegate parameter types” where as in case of normal method it doesn't ?or am i comparing apples with oranges? Another case is why is it accepting anonymous method without parameters?

    Read the article

  • Batch INSYNC help needed...

    - by Raja Reddy
    I have a INSYNC batch to 'extract' certain conditioned data output. For instance, below insync code extracts the data if 44 pos has a value of '25'. Question here is, I wanna get the output in a sorted manner based on a particular field. Can we incorporate the SORT criteria below. Suggestions are really appreciated. FUNCTION=EXTRACT INDD=#INDD OUTDD=#OUTDD RDW=OFF LINESPERPAGE=080 CASE SEARCHDATA=(00044,002,EQ,C'25') ENDCASE PS: We can achieve the same by means of SORT utility through 'SORT FIELDS' parameter.

    Read the article

  • Why are hidden fields used?

    - by Pavan Reddy
    I have always seen a lot of hidden fields used in web applications. I have worked with code which is written to use a lot of hidden fields and the data values from the visible fields sent back and forth to them. Though I fail to understand why the hidden fields are used. I can almost always think of ways to resolve the same problem without the use of hidden fields. How do hidden fields help in design? Can anyone tell me what exactly is the advantage that hidden fields provide? Why are hidden fields used?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • MVC 3 Remote Validation jQuery error on submit

    - by Richard Reddy
    I seem to have a weird issue with remote validation on my project. I am doing a simple validation check on an email field to ensure that it is unique. I've noticed that unless I put the cursor into the textbox and then remove it to trigger the validation at least once before submitting my form I will get a javascript error. e[h] is not a function jquery.min.js line 3 If I try to resubmit the form after the above error is returned everything works as expected. It's almost like the form tried to submit before waiting for the validation to return or something. Am I required to silently fire off a remote validation request on submit before submitting my form? Below is a snapshot of the code I'm using: (I've also tried GET instead of POST but I get the same result). As mentioned above, the code works fine but the form returns a jquery error unless the validation is triggered at least once. Model: public class RegisterModel { [Required] [Remote("DoesUserNameExist", "Account", HttpMethod = "POST", ErrorMessage = "User name taken.")] [Display(Name = "User name")] public string UserName { get; set; } [Required] [Display(Name = "Firstname")] public string Firstname { get; set; } [Display(Name = "Surname")] public string Surname { get; set; } [Required] [Remote("DoesEmailExist", "Account", HttpMethod = "POST", ErrorMessage = "Email taken.", AdditionalFields = "UserName")] [Display(Name = "Email address")] public string Email { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Password")] public string Password { get; set; } [StringLength(100, ErrorMessage = "The {0} must be at least {2} characters long.", MinimumLength = 8)] [DataType(DataType.Password)] [Display(Name = "Confirm password")] public string ConfirmPassword { get; set; } [Display(Name = "Approved?")] public bool IsApproved { get; set; } } public class UserRoleModel { [Display(Name = "Assign Roles")] public IEnumerable<RoleViewModel> AllRoles { get; set; } public RegisterModel RegisterUser { get; set; } } Controller: // POST: /Account/DoesEmailExist // passing in username so that I can ignore the same email address for the same user on edit page [HttpPost] public JsonResult DoesEmailExist([Bind(Prefix = "RegisterUser.Email")]string Email, [Bind(Prefix = "RegisterUser.UserName")]string UserName) { var user = Membership.GetUserNameByEmail(Email); if (!String.IsNullOrEmpty(UserName)) { if (user == UserName) return Json(true); } return Json(user == null); } View: <script src="//ajax.googleapis.com/ajax/libs/jquery/1.7.1/jquery.min.js" type="text/javascript"></script> <script src="//ajax.googleapis.com/ajax/libs/jqueryui/1.8.17/jquery-ui.min.js" type="text/javascript"></script> <script type="text/javascript" src="/Content/web/js/jquery.unobtrusive-ajax.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.min.js"></script> <script type="text/javascript" src="/Content/web/js/jquery.validate.unobtrusive.min.js"></script> ...... @using (Html.BeginForm()) { @Html.AntiForgeryToken() <div class="titleh"> <h3>Edit a user account</h3> </div> <div class="body"> @Html.HiddenFor(model => model.RegisterUser.UserName) @Html.Partial("_CreateOrEdit", Model) <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(model => model.RegisterUser.IsApproved)</span> @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, true, new { @class = "uniform" }) Active @Html.RadioButtonFor(model => model.RegisterUser.IsApproved, false, new { @class = "uniform" }) Disabled <div class="clear"></div> </div> <div class="button-box"> <input type="submit" name="submit" value="Save" class="st-button"/> @Html.ActionLink("Back to List", "Index", null, new { @class = "st-clear" }) </div> </div> } CreateEdit Partial View @model Project.Domain.Entities.UserRoleModel <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Firstname)</span> @Html.TextBoxFor(m => m.RegisterUser.Firstname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Firstname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Surname)</span> @Html.TextBoxFor(m => m.RegisterUser.Surname, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Surname) <div class="clear"></div> </div> <div class="st-form-line"> <span class="st-labeltext">@Html.LabelFor(m => m.RegisterUser.Email)</span> @Html.TextBoxFor(m => m.RegisterUser.Email, new { @class = "st-forminput", @style = "width:300px" }) @Html.ValidationMessageFor(m => m.RegisterUser.Email) <div class="clear"></div> </div> Thanks, Rich

    Read the article

  • How to change the default text of Cancel BUtton which appears in the UISearchBar +Iphone

    - by Pradeep Reddy Kypa
    HI I am developing an Application where i wanted to change the text of Search String in the SearchBar. I wanted to change the text of Cancel Button Also which appears next to the SearchBar. Before entering any string in the search bar we wil get the Search String as the default string. i wanted to change the text of that string and when we click on that searchbar we get a cancel button next to searchbar and i wanted to change the text of that cancel button. PLease help me.

    Read the article

  • How to disable all hardware keys programatically in android?

    - by Raghu Rami Reddy
    I am developing android application with lock functionality. please suggest me how to disable all the hard keys programatically. here i am using beleow code to disable back button. i want like this functionality for all hard keys like home,search,camera, shortcut keys here is my code: @Override public boolean onKey(View v, int keyCode, KeyEvent event) { if (keyCode == KeyEvent.KEYCODE_SEARCH) { Log.d("KeyPress", "search"); return true; } return false; } Thanks in advance.

    Read the article

  • Can somebody suggest good learning source of IMS?

    - by Raja Reddy
    I would like to learn working with IMS, can somebody suggest me a good source? I'm not sure if it matters to say that I have quite good exposure and experience with INSYNC DB2 and QMF. So anything that can depict and explain the advantages and disadvantages over IMS would be really helpful. Thanks for your help beforehand..

    Read the article

  • facebook iframe app problem.... opens on server not in facebook frame

    - by sai teja reddy
    Hi guys, I'm very new to facebook platform. I developed an iframe app. which after allowing permsiions, opens the application on my server and not in facebook iframe. I hope i'm clear. I'm using $user = $facebook-require_login(). I read somewhere that adding $facebook-require_frame() would help but it didn't help. The page reloads with new access token on each reload. Someoe please help me. Thanks in advance

    Read the article

  • How to specify pessimistic lock with Criteria API?

    - by Reddy
    I am retrieving a list of objects in hibernate using Criteria API. However I need lock on those objects as another thread executing at the same time will get the exact objects and only one of the thread will succeed in absence of a pessimistic lock. I tried like below, but it is not working. List esns=session.createCriteria(Reddy_Pool.class) .add(Restrictions.eq("status", "AVAILABLE")) .add(Restrictions.eq("name", "REDDY2")) .addOrder(Order.asc("id")) .setMaxResults(n) .setLockMode(LockMode.PESSIMISTIC_WRITE) //not working at all .list();

    Read the article

  • hibernate not throwing stale state exception nor it is overwriting data

    - by Reddy
    Our application do the following. 1. Start the transaction. 2. Execute a query using prepared statement 3. Check a condition to see the number of rows updated are equal to the required number. 4. It commits on success of above condition otherwise it will roll back However the problem is that when two threads are simultaneously enter this code. Thread-1 is updating a row in step 2. It checked the condition and committed successfully since the condition is successful. Thread-2 started execution somewhere between steps 1 & 4, and it is failing on at condition checking at step 3 (as it is getting number of updated rows as 0). I expected second thread to throw an exception but it is not. What could be the problem?

    Read the article

  • How to insert arabic characters into sql database?

    - by Pavan Reddy
    How can I insert arabic characters into sql database? I tried to insert arabic data into a table and the arabic characters in the insert script were inserted as '??????' in the table. I tried to directly paste the data into the table through sql management studio and the arabic characters was successfully and accurately inserted. I looked around for resolutions for this problems and some threads suggested changing the datatype to nvarchar instead of varchar. I tried this as well but without any luck. How can we insert arabic characters into sql database?

    Read the article

  • Can somebody suggest good source for IMS?

    - by Raja Reddy
    I would like to learn working with IMS, can somebody suggest me a good source? I'm not sure if it matters to say that I have quite good exposure and experience with INSYNC DB2 and QMF. So anything that can depict and explain the advantages and disadvantages over IMS would be really helpful. Thanks for your help beforehand..

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 6 7 8 9 10 11 12 13 14 15 16 17  | Next Page >