Search Results

Search found 10698 results on 428 pages for 'inline functions'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 100/428 | < Previous Page | 96 97 98 99 100 101 102 103 104 105 106 107  | Next Page >

  • GLOBALS ARE BAAAAAAADDDD!!!!!

    - by Matt
    HOWEVER! would setting the $link to my database be one thing that I prolly should use a GLOBAL scope for? In my setting of (lots of functions)...it seems as though having only one variable that is on the global scope would be wise. I am currently using the functions to transfer it back and forth so that way I do not have it on global...but it is a bit of a hinder to my script. Please Advise, Thank you. Matt

    Read the article

  • Migrating from Maven to SBT

    - by Vasil Remeniuk
    Hi people, As you know, SBT is compatible with Maven in some way -- SBT recognizes simple Maven POMs and can use dependencies and repositories specified in them. However, SBT wiki says that, if inline dependency is specified in SBT project definition, POM will be ignored (so using both in this case is impossible): Maven and Ivy configurations (pom.xml and ivy.xml) are ignored when inline dependency declarations are present. Does anyone know, if any kind of converter from Maven POM to SBT project definition exists (translating POM's XML into project definition Scala code)? I'm considering writing such script (that will help to migrate my old Scala/Maven projects to SBT), but want to know first, if this functionality already exists. Thanks in advance.

    Read the article

  • Creating Domain Model

    - by Zai
    Hi, I have created a use case of a small application and now I have to create a Domain Model of that use cases of the application and which functions will be implemented in this application. I have no previous experience in Domain Modeling and UML, please suggest me steps to create the domain model or any suggestions, Do I have to have a very solid understanding of Object oriented concepts for creating domain model? The application is simple and creates online poll/voting system and have functions like Register Account, Confirmation Email of account, Membership, Create Poll, Send Poll etc

    Read the article

  • Call private method in Flex, Actionscript.

    - by core07
    I need it in FlexUnit to test private methods. Is there any possibility to do this via reflection by using describeType or maybe flexUnit has some build in facility? I dislike artificial limitation that i cannot test private functions, it greatly reduces flexibility. Yes it is good design for me to test private functions, so please do not advise me to refactor my code. I do not want to break the encapsulation for the sake of unit testing.

    Read the article

  • Insight into how things get printed onto the screen (cout,printf) and origin of really complex stuff

    - by sil3nt
    I've always wondered this, and still haven't found the answer. Whenever we use "cout" or "printf" how exactly is that printed on the screen?. How does the text come out as it does...(probably quite a vague question here, ill work with whatever you give me.). So basically how are those functions made?..is it assembly?, if so where does that begin?. This brings on more questions like how on earth have they made openGl/directx functions.. break it down people break it down.:)

    Read the article

  • How does PHP work - literature

    - by Ondrej Slinták
    I'm interested in literature (articles on internet, in magazines, books, podcasts - I don't really mind anything) that describes how PHP works internally, about its gotchas and perhaps some advanced functions. Is there anything like this out there? I tried to search on Google, but majority of articles were about starting with PHP and its basic functions. Any input is really welcome as I'm trying to understand the language internally - I'm tired of my mindless typing of code without understanding its essence.

    Read the article

  • How to get `gcc` to generate `bts` instruction for x86-64 from standard C?

    - by Norman Ramsey
    Inspired by a recent question, I'd like to know if anyone knows how to get gcc to generate the x86-64 bts instruction (bit test and set) on the Linux x86-64 platforms, without resorting to inline assembly or to nonstandard compiler intrinsics. Related questions: Why doesn't gcc do this for a simple |= operation were the right-hand side has exactly 1 bit set? How to get bts using compiler intrinsics or the asm directive Portability is more important to me than bts, so I won't use and asm directive, and if there's another solution, I prefer not to use compiler instrinsics. EDIT: The C source language does not support atomic operations, so I'm not particularly interested in getting atomic test-and-set (even though that's the original reason for test-and-set to exist in the first place). If I want something atomic I know I have no chance of doing it with standard C source: it has to be an intrinsic, a library function, or inline assembly. (I have implemented atomic operations in compilers that support multiple threads.)

    Read the article

  • non-latin email address validation

    - by Eric Di Bari
    Now that ICann is allowing non-latin-character domain names, should I be concerned about e-mail validation? Currently, my sites are using php functions to ensure some alpha-numeric character set in each segment of an email address. Will these other character sets, such as Cyrillic, Arabic, and Chinese, pass validation? Are there recommended php functions to utilize for this?

    Read the article

  • python programme.

    - by siva
    hi, i am siva this is frist time taken the python programming language i have a small problem please help me the question is **Write two functions, called countSubStringMatch and countSubStringMatchRecursive that take two arguments, a key string and a target string. These functions iteratively and recursively count the number of instances of the key in the target string. You should complete definitions for def countSubStringMatch(target,key): and def countSubStringMatchRecursive (target, key): **

    Read the article

  • HTML list wrapping problem

    - by Daniel
    I have a HTML list with this style: font-weight: bold; padding: 0px; margin: 0px; list-style-type: none; display: block; width:700px; font-size: 14px; white-space: pre-wrap; and the cells have this style: display: inline; and I have spacer cells between each cell with this style: padding-right: 20px; display: inline; My problem is that when the list is too long for its 700 pixels, it wraps. I want this, but I dont want the objects to be on two separate lines. I have tried the CSS white-space property, but nothing seems to work. Any ideas?

    Read the article

  • CodeIgniter helper inside controllers

    - by kapitanluffy
    can i call helper functions inside controller classes? let's say i have this controller with the _open_form method class User extends Controller { function _open_form($action){ print_r(form_open($action)); } } i tried echoing out the result of form_open() but it returns null. it seems that helper functions can't be called inside controllers if your wondering why i need to use it inside the controller instead in the view because we are required to use the given template parser xD

    Read the article

  • to change the style of div

    - by ramyatk06
    hi guys, I have 2 buttons and 2 divs div1 and div2.On click button1 div1 is made visible and div2 invisible,On clicking button2 div2 is made visible and div1 is invisible. For that i used javascript. function showdiv2() { document.getElementById("div2").style.visibility="visible"; document.getElementById("div2").style.display="inline"; document.getElementById("div1").style.visibility="hidden"; document.getElementById("div1").style.display = "none"; document.getElementById("lbl_msg").innerHTML = "" } function showdiv1() { document.getElementById("div1").style.visibility="visible"; document.getElementById("div1").style.display="inline"; document.getElementById("div2").style.visibility="hidden"; document.getElementById("div2").style.display = "none"; document.getElementById("lbl_msg").innerHTML = "" } In div2 i have a gridview in which i have a linkbutton named lnkDelete.In its click control is going to div1.In click of lnkDelete,i want to make div1 invisible,but on clicking button1 div1 should be visible.Can anybody help to make div1 invisible in clickevent of lnkDelete in codebehind?

    Read the article

  • loading an asp after starting a session

    - by Noam Smadja
    the jQuery $("#loginform").submit(function(){ $.ajax({ type: "POST", url: "loginrespajax.asp", data: $("#loginform").serialize(), success: function(){ $("#loginform").hide("slow"); $("#loginform").load("userheader.asp"); $("#loginform").show("slow"); } }); }); thats userheader.asp <div class="userlinks"> <%if (session("userlevel")) then%> <% select case session("userlevel") case 1 %> <a href="managenews.asp"><%langstring("header_news")%></a> | <a href="managebooks.asp"><%langstring("header_books")%></a> | <a href="manageusers.asp"><%langstring("manage_users")%></a> | <a href="manageorders.asp"><%langstring("manage_orders")%></a> | <a href="managelanguage.asp"><%langstring("manage_language")%></a> | <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% case 2 %> <a href="managenews.asp"><%langstring("header_news")%></a> | <a href="managebooks.asp"><%langstring("header_books")%></a> | <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% case 3 %> <a href="youthregistration.asp"><%langstring("youthreg_header")%></a> | <a href="manageregistrants.asp"><%langstring("youthlist_header")%></a> | <% End select %> <a href="editprofile.asp"><%langstring("editprofile_header")%></a> | <a href="changepassword.asp"><%langstring("changepassword_header")%></a> | <a href="logout.asp"><%langstring("logout_header")%></a> <%else%> <form action="loginrespajax.asp" method="POST" name="loginform" id="loginform" class="loginform" onSubmit="return false;"> <input type="text" name="username" value="username" class="input inline" onFocus="clearText(this);"> <input type="password" name="password" value="password" class="input inline" onFocus="clearText(this);"> <input type="submit" value="Log In" class="submit inline"> </form> <%End if%> </div> i am submiting the login form using AJAX and the jQuery partially works. it does hide and show again. but it prints the ELSE part of in userheader.asp. the session does start, for sure :)

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Table Valued UDF vs Views

    - by vaibhav
    I have never used UDF in sql server. Today I got to know that we can have functions which can return a table. So I just wanted to know can I use functions in place of views. If yes, which one is the better choice and why

    Read the article

  • Bullets WILL NOT dissapear in firefox

    - by DunlopBurns
    Hoping you can help me with a problem. I cannot get rid of Bullets in Firefox, i don't want any anywhere, hence my list-style-type: none!important being everywhere. It only appears in Firefox as far as i can tell. the HTML.... <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" lang="en" xml:lang="en"> <head> <title>littleprints.nl</title> <meta name="description" content="----" /> <meta name="keywords" content="----" /> <meta http-equiv="Content-Type" content="text/html; charset=iso-8859-1" /> <script type="text/javascript" src="http://ajax.googleapis.com/ajax/libs/jquery/1.4/jquery.min.js"></script> <script type="text/javascript" src="js/slimbox2.js"></script> <link rel="stylesheet" href="css/slimbox2.css" type="text/css" media="screen" /> <link rel="stylesheet" href="layout.css"/> <link rel="stylesheet" href="style.css"/> </head> <body> <div id="container"> <div id="inline1"> <div id="mainpic"> <img src="myimages/circle.jpg" width="100%" alt="Circle bracelet"/> </div> <div id="intro"> <p>Hi and welcome to little prints NL. we make this and that all by hand with 100% silver. my name is Donna Burns and i work by commision, ive been studying for 4 years and am currently learning to become a goldsmith.</p> </div> </div> <div id="inline2"> <p>Click for more...</p> <div id="images"> <a href="myimages/photos/dogtag.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/chunky.gif" alt="chunky"/></a> <a href="myimages/photos/hearts.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/hearts.gif" alt="hearts"/></a> <a href="myimages/photos/close.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" ><img src="myimages/work/close.gif" alt="close"/></a> <a href="myimages/photos/pearl.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/flower.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/frontcircle.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> <a href="myimages/photos/dogtag.jpg" rel="lightbox-gal" title="Beautiful, isn't it?" >&nbsp;</a> </div> </div> </div><!--end container--> <div id="footer"> <div id="footalign"> <div id="social"> <ul> <li> <a href="http://www.facebook.com/littleprints" title="Little Prints"> <img src="myimages/facebook.png" width="50px" height="50px" alt="FB"/> </a> </li> <li> <a href="contact.html" title="contact"> <img src="myimages/at.gif" alt="@"/> </a> </li> </ul> </div> <div id="contact"> <p><br/>To enquire about a charm either phone:<br/> 0787463289<br/> or use one of the methods to the side.</p> </div> </div> </div> </body> </html> the CSS... * {margin: 0; padding: 0; border: 0;} html, body { background-color: #000000;image; text-align: center; font: 16px/1.8 Verdana, Arial, Helvetica, sans-serif; list-style-type: none!important; text-decoration: none;} #container { position: relative; width: 900px; top: 0; min-height: 100%; margin-left: auto; margin-right: auto; padding-top: 20px; background-image: URL(myimages/back2.gif); margin-bottom: 180px; } #footer { background-color: #555555; position: relative; clear: both; bottom: 0; width: 900px; height: auto; margin-left: auto; margin-right: auto; margin-bottom: 20px; padding-bottom: 22px; margin-top: -180px; } #inline1{ display: inline-block; margin-top: 250px; margin-bottom: 20px; } #inline2 { display: inline-block; margin-top: 30px; margin-bottom: 50px; } #mainpic { float: left; width: 68%; margin-left: 20px; } #intro { float: right; width: 20%; margin-left: auto; margin-right: 50px; margin-top: 20px; } #images { margin-bottom: 20px; margin-left: auto; margin-right: auto; } #footalign { display: inline; width:900px; list-style-type: none; } #contact { text-align: center; background-color:#555555; float: middle; list-style-type: none; } #social{ background-color:#555555; float: right; list-style: none; padding:0; padding-right: 5px; text-align:center; list-style-type: none!important; } #social img{ border: none; list-style-type: none!important; margin: 3px; } #social ul{ border: none; list-style-type: none!important; } #social a{ display:inline-block; -webkit-transition:all .5s ease-out; -moz-transition:all .5s ease-out; -ms-transition:all .5s ease-out; -o-transition:all .5s ease-out; transition:all .5s ease-out; list-style-type: none!important; } #social a:hover{ display:inline-block; -webkit-transform:translate(-10px,0px); -moz-transform:translate(0px,-10px); -ms-transform:translate(-10px,0px); -o-transform:translate(-10px,0px); transform:translate(-10px,0px); list-style-type: none!important; } #form { margin-top: 250px; margin-bottom: 50px; } .nav1 {font-family: sans-serif;font-size: 22px;text-shadow: 2px 2px 5px #000000;} a:link {text-decoration:none; color:#000000; padding:3px;} a:visited {text-decoration:none; color:#000000;} a:active {text-decoration:none; color:#555555;} a:hover {text-decoration:none; color:#555555;} .nav2 {font-family: sans-serif;font-size: 22px;text-shadow: 2px 2px 5px #ffffff;} a:link {text-decoration:none; color:#ffffff; padding:3px;} a:visited {text-decoration:none; color:#ffffff;} a:active {text-decoration:none; color:#555555;} a:hover {text-decoration:none; color:#555555;} .p1 { color: #ffffff; } div#images img { max-width: 500px; height: auto; }

    Read the article

  • Why would the assignment operator ever do something different than its matching constructor?

    - by Neil G
    I was reading some boost code, and came across this: inline sparse_vector &assign_temporary(sparse_vector &v) { swap(v); return *this; } template<class AE> inline sparse_vector &operator=(const sparse_vector<AE> &ae) { self_type temporary(ae); return assign_temporary(temporary); } It seems to be mapping all of the constructors to assignment operators. Great. But why did C++ ever opt to make them do different things? All I can think of is scoped_ptr?

    Read the article

  • How to achieve table like rows within container using CSS

    - by Barry
    I'm helping an artist maintain her website and have inherited some pretty outdated code. Have moved lots of redundant common code to include files and am now working on moving from inline styles to more CSS-driven styles. For the gallery pages, e.g. http://artistsatlaketahoe.com/abstract.html, a lot of inline styling is used to force the current layout. My preference would be to replace this entirely with CSS that presents the following table-like layout within the "content" div: [image] [image descriptives and purchase button] [image] [image descriptives and purchase button] [image] [image descriptives and purchase button] I'd like to middle-align the image descriptives & purchase button relative to the image if possible. And then apply some padding above and below each row to stop using tags for vertical spacing. Any ideas how to create a div that I can use to get this kind of layout? Thanks!

    Read the article

  • drupal jQuery 1.4 on specific pages

    - by Mark
    I'm looking for a way to force drupal to use 1.4 on specific pages. This is the same as this old question:http://stackoverflow.com/questions/2842792/drupal-jquery-1-4-on-specific-pages It look me a while to try the answer which I marked correct. But because I'm new to module dev overall I couldn't figure it out based on the answer. The code from that answer looked like this: /** * Implementation of hook_theme_registry_alter(). * Based on the jquery_update module. * * Make this page preprocess function runs *last*, * so that a theme can't call drupal_get_js(). */ function MYMODULE_theme_registry_alter(&$theme_registry) { if (isset($theme_registry['page'])) { // See if our preprocess function is loaded, if so remove it. if ($key = array_search('MYMODULE_preprocess_page', $theme_registry['page']['preprocess functions'])) { unset($theme_registry['page']['preprocess functions'][$key]); } // Now add it on at the end of the array so that it runs last. $theme_registry['page']['preprocess functions'][] = 'MYMODULE_preprocess_page'; } } /** * Implementation of moduleName_preprocess_hook(). * Based on the jquery_update module functions. * * Strips out JS and CSS for a path. */ function MYMODULE_preprocess_page(&$variables, $arg = 'my_page', $delta=0) { // I needed a one hit wonder. Can be altered to use function arguments // to increase it's flexibility. if(arg($delta) == $arg) { $scripts = drupal_add_js(); $css = drupal_add_css(); // Only do this for pages that have JavaScript on them. if (!empty($variables['scripts'])) { $path = drupal_get_path('module', 'admin_menu'); unset($scripts['module'][$path . '/admin_menu.js']); $variables['scripts'] = drupal_get_js('header', $scripts); } // Similar process for CSS but there are 2 Css realted variables. // $variables['css'] and $variables['styles'] are both used. if (!empty($variables['css'])) { $path = drupal_get_path('module', 'admin_menu'); unset($css['all']['module'][$path . '/admin_menu.css']); unset($css['all']['module'][$path . '/admin_menu.color.css']); $variables['styles'] = drupal_get_css($css); } } } I need the jquery_update 1.3.2 to be unset on the node-types of 'blog' and 'video'. Can someone help me out? Thank you.

    Read the article

  • What to put in a python module docstring?

    - by 007brendan
    Ok, so I've read both PEP 8 and PEP 257, and I've written lots of docstrings for functions and classes, but I'm a little unsure about what should go in a module docstring. I figured, at a minimum, it should document the functions and classes that the module exports, but I've also seen a few modules that list author names, copyright information, etc. Does anyone have an example of how a good python docstring should be structured?

    Read the article

  • Searching LPSTR string

    - by David21
    I want to find some words after i get the whole file to char*. I know how to do it using the string class functions but i don't want to copy the data again to a string variable. is there any similar functions available to use for char* strings or should i still use string class?

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 96 97 98 99 100 101 102 103 104 105 106 107  | Next Page >