Search Results

Search found 6462 results on 259 pages for 'tab delimited'.

Page 104/259 | < Previous Page | 100 101 102 103 104 105 106 107 108 109 110 111  | Next Page >

• Excel 2007: Exporting more than 100 columns to a .prn file but data is concatenated

  - by Don1

  I want to export an Excel worksheet to a space delimited (.prn) file. The worksheet is pretty big (187 columns) and when I set the column widths and try to export the worksheet to a .prn file, the data gets cut at the 98th column (i.e. about 200 characters wide for my data) and the rest is placed directly underneath. It's like I ripped a page in half from top to bottom and placed the right-hand side directly under the left-hand side. How would I get it to export everything without getting concatenated?

  Read the article

• Need to create street maps images with route plotted from address 1 to address 2

  - by daustin777

  I'm looking for software to create street map images that show the route from address 1 to address 2. It needs to be able to create the map images from either a database file that contains the addresses, a delimited text file that lists the addresses to route in each row, or an Excel file. I need to do this to create custom maps in bulk- 500 to 20,000 quantity from the data file. The purpose is to provide a map with a route from a location (address 1) to a retail store (address 2). The maps will be printed on a postcard. I have the data. I just need the mapping software. Is there software available that can do this?

  Read the article

• Grub error 18, gparted not showing anything

  - by Montecristo

  Some week ago I started having some problems with my pc, sometimes it just freezed not allowing me to do anything. I had to turn it off and on and sometimes do it a couple of time even at startup. Now it does not start at all, grub is giving me error 18. I have found that a solution is to create a bootable partition in the first sector of the disk. gparted does not recognize any partition, the window in which there would be my partitions is empty. sudo fdisk -l does not output anything. If I type sudo mount /dev/sda and then tab tab to autocomplete these are the devices coming out: sda sda1 sda2 sda5. If I launch sudo mount -t ext3 /dev/sda1 disk I get the following error: mount: wrong fs type, bad option, bad superblock on /dev/sda1, missing codepage or helper program, or other error In some cases useful info is found in syslog - try dmesg | tail or so dmesg outputs [ 1831.974847] EXT3-fs: unable to read superblock Do you know how to solve this issue? I'm not completely sure this is a software problem, should I try with a new hard disk?

  Read the article

• How can I remedy the always-on-top window problem?

  - by GateKiller

  Sorry for the vague title but this one is hard to explain so bear with me please. I'm using Windows Vista at work for web development and sometimes when I Click or Alt-Tab to background window, the window will get focus but it will not be brought to the front. In order to bring the window to the front, I have to click on the applications border (when the resize cursor appears) and the window will then jump to the front. I've had this problem for about a year now and it happens at least a dozen times a day, but it doesn't do this all the time - seems random. I hope I have explained the issue fully (and you've understood it) and would appreciate any constructive answers or comments to solve this problem. Example: If I Alt-Tab from Google Chrome to Notepad and this problem randomly occurs, Google Chrome will remain in front of Notepad, however, I will be able to type text into Notepad while the window is behind Google Chrome. Clicking on Notepad's content area will not bring it to the front but clicking it's window border will. Video Exampe http://vimeo.com/19388998 In this video, I clicked from Google Chome to UltraEdit and chrome stayed in font, but as you can see, I can still type in UltraEdit. I'm starting to believe that this could be a bug in Google Chrome so I'll continue to watch if this between other applications.

  Read the article

• Getting Started in SuSE as an Ubuntu User

  - by Subhamoy Sengupta

  I am not a Linux newbie, but haven't touched SuSE in a very very long time (last time I tried it, it was SuSE 7!). Finally now I felt like giving it a try, and many things seem strange or unnecessarily complex. I have a series of questions. How do I ensure that my packages are uptodate? It sounds silly, but I tried the obvious methods already. I have disabled the default repositories that show up when you do zypper lr, and added Tumbleweed and packman repositories (Essentials, Multimedia, Extra). Then I did a sudo zypper ref --force and then sudo zypper dup, and it tells me many dependencies are not met. I have already added solder.allowVendorChange=true to /etc/zypp/zypp.conf, so it should not care which repository the latest versions are in, and just upgrade to it. Even when I chose to skip the packages with unmet dependencies, and seemed like quite a bit happened in the background, I opened Firefox afterwards and the version was 7! I am guessing things did not go as expected. But of course this is not a problem with SuSE, but I am not understanding the system right. How do I do it right? When I start typing arguments of a command, for example sudo zypper install, when I type sudo zypper ins and keep hitting TAB, nothing happens! It always worked in Ubuntu and I feel very uneasy with this. Is this how SuSE is supposed to be? When I try to install something, and I start writing its name, even though the package exists and I am sure of it, hitting TAB does not autocomplete it. This is also quite inconvenient. Why is it not happening? There are many things in SuSE that are really great, and I think I will stay with it and not go back to Ubuntu once I settle these very rudimentary issues. But right now they are giving me a lot of grief! Please help!

  Read the article

• How to columnate text with tabs (in vim or on the shell)

  - by kine

  I have a frequent need to manually manipulate tab-delimited text for data entry and other purposes, and when i do this it helps if the text is aligned properly into columns. For example (assuming 4-space tabs): # original format abcdefghijklmnop field2 abcdefgh field2 abcdefghijkl field2 # ideal format abcdefghijklmnop field2 abcdefgh field2 abcdefghijkl field2 I am very familiar with using the column utility to columnate text this way, but the problem is that it uses spaces to align the columns, and i specifically need tabs. This requirement also appears to rule out the Tabularize plug-in. Is there any way that i can columnate text with tabs specifically, either within vim or at the shell? It looks like i might be able to do it with groff/tbl, but honestly i'd rather columnate it by hand than mess with that....

  Read the article

• Cannot write to directory after taking ownership

  - by jeff charles

  I had a directory on an internal hard-drive that was created in an old Windows 7 install. After re-installing my operating system, when I try to create a new directory inside that directory, I get an Access Denied message. This isn't a protected directory, just a random directory I created at the drive root (that drive was not the C drive in either install). I tried to take ownership by opening folder properties, going to the Security tab, clicking on Advanced, going to Owner tab, clicking on Edit, selecting my user account, checking Replace owner on subcontainers and objects, and clicking Apply. There were no error messages and I closed the dialogs. I rebooted, checked the owner on that folder and a couple subfolders and it appears to be set correctly. I am still getting an Access Denied message however when trying to create a directory in it. I've also tried using attrib -R . to remove any possible readonly attribute inside the directory in an admin command prompt but am still unable to create a directory using a non-admin prompt (it does work in an admin prompt). Is there anything I can do to get write access to that folder and it's subcontents in a non-elevated context without disabling UAC?

  Read the article

• Surround in Windows 7 with Soundmax

  - by Henri

  Hey guys, I have a asus m2n motherboard with a Soundmax 1988 chip on it. I want to have surround sound in windows 7, but i cant get it to work. I tried a lot of different drivers, including the latest beta for Win 7. The problem is that when I configure the speakers and i do a "Test" all speakers work. But whenever I want to play some video or mp3, only the front speakers work. In vista there was this option called "Surround Fill" that would fix this problem, however, I cant seem to find that in windows 7. (The enhancements tab is completely gone for the speakers, other output devices do have that tab). Anybody knows the fix? Edit: I got it now kind of working by using a trial version of SRS AudioSandbox. However, the quality is quite bad since the program tries to create a real 5.1 of stereo sound. I just want to have stereo over 4 speakers instead of fake 5.1 over 4 speakers.

  Read the article

• Exchange 2003: Accounts with only OWA access unable to change passwords when expired or forced

  - by radioactive21

  We have accounts whith only OWA access, because they are generic accounts and we do not want the accounts to be used as machine logins. We have a password policy that users must change their passwords every 6 months. The problem we are having is that since the accounts are not loging into the machines, when the password policy kicks in it is preventing users with OWA only access from changing their password. Also, when we select "User must change the password at next logon" it also causes the same issue. We have two exchange servers the main one and a front end one. what we have been doing with these generic account is in properties, under the "account" tab we restricted "log on to" to the front end server. Just to clarify, when we have no restrictions, users can change their passwords via the web without any issues. It is only when we force them to only login via OWA that they cant change passwords. I tried adding our domain controler and main exchange server to the "This user can log on to The following computers" in the account tab, but still it is not allowing them to change passwords. Currently I have to manually reset the passwords for OWA only accounts. Is there anyway to allow OWA acconts to change passwords? EDIT: Users restricted to only OWA can change their password via the web browser without any issues when there are no restrictions. In other words normally they can just log into outlook via the web and change their password, but when the password policy expires or we force them to change their password at next login, they are unable to.

  Read the article

• How to connect via SSH to a linux mint system that is connected via OpenVPN

  - by Hilyin

  Is there a way to make SSH port not get sent through VPN so when my computer is connected to a VPN, it can still be remoted in via SSH from its non-VPN IP? I am using Mint Linux 13. Thank you for your help! This is the instructions I followed to setup the VPN: Open Terminal Type: sudo apt-get install network-manager-openvpn Press Y to continue. Type: sudo restart network-manager Download BTGuard certificate (CA) by typing: sudo wget -O /etc/openvpn/btguard.ca.crt http://btguard.com/btguard.ca.crt Click on the Network Manager icon, expand VPN Connections, and choose Configure VPN A Network Connections window will appear with the VPN tab open. Click Add. 8. A Choose A VPN Connection Type window will open. Select OpenVPN in the drop-down menu and click Create.. . In the Editing VPN connection window, enter the following: Connection name: BTGuard VPN Gateway: vpn.btguard.com Optional: Manually select your server location by using ca.vpn.btguard.com for Canada or eu.vpn.btguard.com for Germany. Type: select Password User name: username Password: password CA Certificate: browse and select this file: /etc/openvpn/btguard.ca.crt Click Advanced... near the bottom of the window. Under the General tab, check the box next to Use a TCP connection Click OK, then click Apply. Setup complete! How To Connect Click on the Network Manager icon in the panel bar. Click on VPN Connections Select BTGuard VPN The Network Manager icon will begin spinning. You may be prompted to enter a password. If so, this is your system account keychain password, NOT your BTGuard password. Once connected, the Network Manager icon will have a lock next to it indicating you are browsing securely with BTGuard.

  Read the article

• Vista: window focus problem

  - by GateKiller

  Sorry for the vague title but this one is hard to explain so bear with me please. I'm using Windows Vista at work for web development and sometimes when I Click or Alt-Tab to background window, the window will get focus but it will not be brought to the front. In order to bring the window to the front, I have to click on the applications border (when the resize cursor appears) and the window will then jump to the front. I've had this problem for about a year now and it happens at least a dozen times a day, but it doesn't do this all the time - seems random. I hope I have explained the issue fully (and you've understood it) and would appreciate any constructive answers or comments to solve this problem. Example: If I Alt-Tab from Google Chrome to Notepad and this problem randomly occurs, Google Chrome will remain in front of Notepad, however, I will be able to type text into Notepad while the window is behind Google Chrome. Clicking on Notepad's content area will not bring it to the front but clicking it's window border will. Video Exampe http://vimeo.com/19388998 In this video, I clicked from Google Chome to UltraEdit and chrome stayed in font, but as you can see, I can still type in UltraEdit. I'm starting to believe that this could be a bug in Google Chrome so I'll continue to watch if this between other applications.

  Read the article

• How to always show titles on Windows 7 Taskbar thumbail preview?

  - by Cooper

  I often use the Win+n shortcuts to 'alt-tab' between windows of pinned application (i.e. Win+2 to basically 'alt-tab' multiple putty windows, where putty is pinned as app #2 on the taskbar). The Win+n always pops up the thumbnail previews of all the windows, but sometimes it shows window titles above the thumbnail, sometimes it doesn't. Is there any way to always show the titles (i.e. registry setting?)? For putty sessions this would be especially nice, as the title contains the hostname, and the thumbnail is too small to determine what host that window is for. I've noticed that the titles usually show up with there are more than ~4-6 windows of that pinned item open - but the number seems to vary - is there a threshold setting for this? Update: So I just noticed the titles show up whenever the taskbar buttons combine, which varies based on how many windows from other apps are open... So I'm now looking for a way to combine buttons (but I'd like to keep labels, so the options in the 'Taskbar and Start Menu Properties' are close, but probably finding the registry settings behind should do it.

  Read the article

• Create custom launchers in GNOME 3

  - by hochl

  I'm using Debian testing, and I have been switched to GNOME 3 by the Debian update yesterday. I'm not very comfortable with the UI. I wanted to customize everything like I had it with GNOME 2, but I simply couldn't find any way to change preferences like I'm used to. I've digged some, but all answers I could find did not help me achieve my goals. So please, if anyone knows the solution to this I'd be thankful: 1) I want several launchers that launch terminals, with different arguments and different coloring/title. I have searched everything and there seems to be no menu, no right-click, nothing which is standard in any UI I know. How can I create several launchers in this bar on the left side that launch the same application, just with different parameters? With GNOME 2 this was a piece of cake. 2) I want to switch between different terminals using ALT-TAB. Right now, I'm always just getting to the same, already-opened terminal. When I open two terminals by simply creating the second one by issuing xterm &, I still get one Terminal entry with ALT-TAB, and I have to navigate with cursor keys or mouse wheel to select one of the two xterminals. Instead, I want to open a new terminal when I click the quick launch terminal icon from the bar on the left side of the screen and navigate through them like on KDE/GNOME 2/Windows/any reasonable UI. Can this be done? 3) Is there a trick to make bluetooth devices work like on GNOME 2? Right now, my BT keyboard won't pair anymore, which, as you can imagine, makes me pretty angry. and, if anything fails: 4) How can I switch back to GNOME 2 again? :-) Honestly, who did design this? What were they smoking? I feel like I'm not allowed to do anything except start one of any application that has an icon and just with the default parameters. That can't be true, right? I feel massively restrained by this stuff :(

  Read the article

• What user information is exposed via a browser?

  - by ipso

  Is there a function or website that can collect and display ALL of the user information that can be obtained via a browser? Background: This of course does not account for the significant cross-reference abilities of large corporations to collate multiple sources and signals from users across various properties, but it's a first step. Ghostery is just a great idea; to show people all of the surreptitious scripts that run on any given website. But what information is available – what is the total set of values stored – that those scripts can collect from? If you login to a search engine and stay logged in but leave their tab, is that company still collecting your webpage viewing and activity from other tabs? Can past or future inputs to pages be captured – say comments on another website? What types of activities are stored as variables in the browser app that can be collected? This is surely a highly complex question, given to countless user scenarios – but my whole point is to be able to cut through all that – and just show the total set of data available at any given point in time. Then you can A/B test and see what is available with in a fresh session with one tab open vs. the same webpage but with 12 tabs open, and a full day of history to boot. (Latest Firefox & Chrome – on Win7, Win8 or Mint13 – although I'd like to think that won't make too much of a difference. Make assumptions. Simple is better.)

  Read the article

• Excel - Disable AutoFormatting on Import

  - by Philip Wales

  How can I stop Microsoft Excel from auto formatting data when imported from a text file? Specifically, I want it to treat all of the values as text. I am auditing insurance data in excel before it is uploaded to the new database. The files come to me as tab delimited text files. When loaded, Excel auto-formats the data causing leading 0's on Zip Codes, Routing Numbers and other codes, to be chopped off. I don't have the patience to reformat all of the columns as text and guess how many zeros need to be replaced. Nor do I want to click through the import wizard an specify that each column is text. Ideally I just want to turn off Excel's Auto-Formatting completely, and just edit every cell as it were plain text. I don't do any formula's or charts, just grid plain text editing.

  Read the article

• Convert text to table

  - by Quattro

  I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

  Read the article

• rename multiple files with unique name

  - by psaima

  I have a tab-delimited list of hundreds of names in the following format old_name new_name apple orange yellow blue All of my files have unique names and end with *.txt extension and these are in the same directory. I want to write a script that will rename the files by reading my list. So apple.txt should be renamed as orange.txt. I have searched around but I couldn't find a quick way to do this.I can change one file at a time with 'rename' or using perl "perl -p -i -e ’s///g’ *.txt", and few files with sed, but I don't know how I can use my list as input and write a shell script to make the changes for all files in a directory. I don't want to write hundreds of rename command for all files in a shell script. Any suggestions will be most welcome!

  Read the article

• How can I do a bulk caller ID lookup (reverse phone lookup) on a list of phone numbers?

  - by rob

  I have a tab-delimited text file with all of the phone numbers I've called or received calls from in the past year. The phone numbers are all based in the US, so the format is ###-###-####. For tax purposes, I need to know which calls were personal and which ones were business-related. I could enter them all one-by-one into Google, but that will take forever because there are hundreds of numbers to check. Is there a program, MS Office plugin, or website that I can use to look up all of the numbers at once? If not, is there some way to create an Excel macro to do the lookups for me?

  Read the article

• Auto-focus xdvi after running viewdvi in Emacs with AUCTeX.

  - by D Connors

  I've been using emacs with AUCTeX mode to edit my latex documents for a few days now, but there's something that's really bugging me. As it should be, whenever I do C-c C-c RET it compiles the file, and if repeat the command it views the output in xdvi. It's also set to the mini-mode TeX-source-specials-mode, so instead of opening a new window in xdvi it only reloads the window that's already open, brings it to the front, and sends me to wherever the pointer was in emacs (forward search). Now here's the problem: Even though the xdvi window is brought to the front, it's not focused. Instead, the emacs windows stays with focus (and that's where any keyboard input goes). And I keep forgetting about that, which leads me to accidentally editing the source file while trying to navigate in xdvi. Not to mention I'm forced to alt-tab in order to focus xdvi, and alt-tab twice if I just want to get back to emacs. Is there a way around this problem? I just want xdvi to be focused whenever I run the view command from emacs.

  Read the article

• Outlook 2007 - Mailbox doesn't show my Items (like Calendar)

  - by cyntaxx

  Hi All, I have running an Exchange Server 2003 and 2 IBM Laptops (A&B)with XP SP3. On both Laptops Office 2007 is installed. Laptop "A" Outlook doesn't show me my Calendar and Notes entries in my mailbox tree on Laptop "A". I can click on the calenendar tab and the entries are there. On Laptop "B" it is working fine. I know that I can make a "rigth click" on "mailbox" and choose "create new folder". Than I select i.g. my calendar. It creates it, but I can't access it through my mailbox tree. Clicking on the Calendar tab works fine again. So, the mailbox is fine (I think). There must be failure with Outlook. I tried these commands here with no positive result. Outlook /cleanviews Outlook /resetfolders I want to avoid a repair installation of Outlook, because the whole office needs to be repaired. (And both laptops belong to my boss) :) Thanks, Toby

  Read the article

• Windows 8 Communication Sound Setting not working

  - by blackmastiff

  I've been having a problem on my new laptop recently which is familiar but baffling the usual fixes. I'm running Windows 8 with an onboard Realtek soundcard. It's similar to the one on my older computer running Windows 7. The problem is, when I'm in Skype or Mumble, Windows changes the sound output to lower everything else automatically. I've disabled the communications sound change option on the communications tab within sound devices and checked all the applications settings to insure that they are not responsible. They aren't, and I noticed something else. When I'm in the sound properties dialog, and I switch to the microphone tab, the same audio output reduction occurs. This seems to say to me that the microphone must be responsible in some way, but seeing as I uninstalled all the drivers and installed windows drivers instead, I'm confused as to why this would be occurring. Any thoughts? EDIT: I just tried disabling the built in microphone and the sound no longer get changed. More confused now? As soon as I turn it back on, the sound gets dropped again. Incidentally, the fix for this on windows 7 was this question: Windows 7 lowers applications' volume automatically I've got my computer set that way and it doesn't work.

  Read the article

• Creating MS Word 2010 Relative Links?

  - by leeand00

  Okay here is what I've tried so far for creating relative links in my MS Word Documents. In my document from the ribbon I select the File tab. I then select Info from the side bar. Click the properties drop down from the right hand column. (a bit difficult to find initially, since it looks like text not a drop down, but it's there). Click Advanced Properties The <document-name>.docx Properties Dialog Appears I enter .\ to specify that I want a relative path for the links in my document. I click OK. I go back into my document select some text and attempt to make a link out of it clicking the Insert tab of the ribbon, and then clicking Hyperlink. I then select a document from the current folder, and strip the full path from it, leaving just the name of the .docx file to which I wish to link. Then I click OK. The link appears, I try to click it using Ctrl+Click. I am informed that the address of the site is not valid. Check the address and try again. What could I possibly be doing wrong here? I just want a relative link. It's so easy in to do this in HTML.

  Read the article

• Automatic switching of network card when vm is moved

  - by spock

  I have two hosts in a pool and I used to be able to move the vm around and they will start without any problem. But after I played around with some network setting, which I don't remember what, I started getting "This VM needs storage that cannot be seen from that server" message. As you can tell I am a beginner with Xenserver. Here is the very simple environment: 2 host servers with their own local hard disk and network card. One is a Pool master. Problem: Power off a vm and move vm from one server to another, or clone one vm to the other server. It used to be able to start up right away. Now, I need to delete one of the network that does not belong to the server, then it will start. Otherwise, the above error msg popup. The two networks (one for each network card in each host) are in the Networking tab of the vm, as well as in the host's networking tab. I googled but all I got to empty the DVD drive, which is not the problem here. Thanks in advance!

  Read the article

• How do I disable DirectDraw and Direct3D acceleration on Windows 8? [closed]

  - by Favourite Chigozie Onwuemene

  Some old games that i would really like to play run slowly on some graphic drivers when direct3d acceleration is enabled. I have tried many suggestions but none seems to work. The only thing i have not tried is disabling direct3d acceleration. Is it possible to disable DirectDraw and Direct3D acceleration on my Windows 8 pc? There are certain bad versions of GeForce drivers that cause this problem. This is a problem in the drivers themselves and is unfortunately completely outside our control. The recommended way to fix this problem is to update your graphics card drivers (go to NVIDIA's web site for this). Alternatively, there is a workaround that alleviates or solves the slowdown problem altogether. Try this: Right-click on your desktop and select "Properties". Go to the "Settings" tab and click on "Advanced...". Click on the "Troubleshooting" tab and move the slider to the left until it says that all DirectDraw and Direct3D accelerations have been disabled (around the middle of the range). Finally, click on "OK". Note that this workaround might cause other games on your computer to slow down, so you may have to switch back and forth between settings, but it's certainly worth a try if you can't obtain an updated graphics driver. -source: interactionstudios

  Read the article

• Strange focus bug in Firefox (chrome vs content)

  - by Marius

  Here is a strange bug I'm experiencing in Firefox: I can only use either the chrome, or the content, not both at the same time! For example, I can click on tabs and the toolbar icons, focus the search bar and write in it as well as the address bar, but if I try to click on anything in the content (eg a link or a textfield to write something), then nothing happens. The mouse pointer doesn't change either, it just stays a pointer when I hover over things, and the links I hover don't react either. But if I alt-tab to another program (or click on it in the taskbar), then back to Firefox, then I can use the area that I click on. So if I click somewhere on the webpage to get focus back to Firefox, then I can click on links and write things (like this text), but I cannot click on tabs or refresh or anything else in the chrome. I can't even click on the minimize, restore and close icons! To get focus back on the chrome I have to alt-tab to another program, and then click on the chrome to get back to Firefox to be able to use the chrome again. I've tried closing and starting it again, but the bug is still there. I have experienced this before, but I don't remember what I did to fix it. This bug seems to occur sometimes when I wake up the computer from standby, but I leave by computer in standby all the time, so that is not the only factor.

  Read the article

< Previous Page | 100 101 102 103 104 105 106 107 108 109 110 111  | Next Page >