Search Results

Search found 9894 results on 396 pages for 'outer space'.

Page 107/396 | < Previous Page | 103 104 105 106 107 108 109 110 111 112 113 114  | Next Page >

  • ack (perl?) regexp matching lines where if is the first word

    - by Gauthier
    Hey. I'm finally learning regexps, training with ack. I believe this uses perl regexp. I want to match all lines where the first non-blank characters are if (<word> !, with any number of spaces in between the elements. This is what I came up with: ^[ \t]*if *\(\w+ *! It only nearly worked. ^[ \t]* is wrong, since it matches one or none [space or tab]. What I want is to match anything that may contain only space or tab (or nothing). For example these should not match: // if (asdf != 0) else if (asdf != 1) How can I modify my regexp for that?

    Read the article

  • Allow outgoing connections using 'iptables'

    - by umanga
    Greeting all, "iptables -L" gives the following output [root@ibmd ~]# iptables -L Chain INPUT (policy ACCEPT) target prot opt source destination Chain FORWARD (policy ACCEPT) target prot opt source destination Chain OUTPUT (policy ACCEPT) target prot opt source destination Server has global IP and can be accessed from outer IPs.But I cannot ping nor telnet to any port (including TCP 80) from the server. Does this has something to do with my 'iptables' settings ? Any tips on allow access from my server? thanks in advance.

    Read the article

  • Fixed footer with 960.gs

    - by Oguz
    I want to create fixed footer but , is it possible with 960 gs , because I am having trouble with height of container div . I can no set it to %100. <div class="container_12" > <div class="grid_3" id="side-space"></div> <div class="grid_6"> <div id="content-box"></div> </div> <div class="grid_3" id="side-space"></div> </div>

    Read the article

  • JavaScript + Maths: Image zoom with CSS3 Transforms, How to set Origin? (with example)

    - by Sunday Ironfoot
    My Math skills really suck! I'm trying to implement an image zoom effect, a bit like how the Zoom works with Google Maps, but with a grid of fix position images. I've uploaded an example of what I have so far here: http://www.dominicpettifer.co.uk/Files/MosaicZoom.html (uses CSS3 transforms so only works with Firefox, Opera, Chrome or Safari) Use your mouse wheel to zoom in/out. The HTML source is basically an outer div with an inner-div, and that inner-div contains 16 images arranged using absolute position. It's going to be a Photo Mosaic basically. I've got the zoom bit working using CSS3 transforms: $(this).find('div').css('-moz-transform', 'scale(' + scale + ')'); ...however, I'm relying on the mouse X/Y position on the outer div to zoom in on where the mouse cursor is, similar to how Google Maps functions. The problem is that if you zoom right in on an image, move the cursor to the bottom/left corner and zoom again, instead of zooming to the bottom/left corner of the image, it zooms to the bottom/left of the entire mosaic. This has the effect of appearing to jump about the mosaic as you zoom in closer while moving the mouse around, even slightly. That's basically the problem, I want the zoom to work exactly like Google Maps where it zooms exactly to where your mouse cursor position is, but I can't get my head around the Maths to calculate the transform-origin: X/Y values correctly. Please help, been stuck on this for 3 days now. Here is the full code listing for the mouse wheel event: var scale = 1; $("#mosaicContainer").mousewheel(function(e, delta) { if (delta > 0) { scale += 1; } else { scale -= 1; } scale = scale < 1 ? 1 : (scale > 40 ? 40 : scale); var x = e.pageX - $(this).offset().left; var y = e.pageY - $(this).offset().top; $(this).find('div').css('-moz-transform', 'scale(' + scale + ')') .css('-moz-transform-origin', x + 'px ' + y + 'px'); return false; });

    Read the article

  • Basic join query understanding

    - by OM The Eternity
    I know this very silly, but can anybody help me in understanding what does this join query is doing in elabortive description? SELECT j1.* FROM jos_audittrail j1 LEFT OUTER JOIN jos_audittrail j2 ON (j1.trackid = j2.trackid AND j1.field = j2.field AND j1.changedone < j2.changedone) WHERE j1.operation = 'UPDATE' AND j1.trackid=$t_ids[$n] AND j2.id IS NULL I know its very silly, but i need to go ahead with my further need... Pls do help me...

    Read the article

  • What Regex can strip e.g. "note:" and "firstName: " from the left of a string?

    - by Edward Tanguay
    I need to strip the "label" off the front of strings, e.g. note: this is a note needs to return: note and this is a note I've produced the following code example but am having trouble with the regexes. What code do I need in the two ???????? areas below so that I get the desired results shown in the comments? using System; using System.Collections.Generic; using System.Linq; using System.Text; using System.Text.RegularExpressions; namespace TestRegex8822 { class Program { static void Main(string[] args) { List<string> lines = new List<string>(); lines.Add("note: this is a note"); lines.Add("test: just a test"); lines.Add("test:\t\t\tjust a test"); lines.Add("firstName: Jim"); //"firstName" IS a label because it does NOT contain a space lines.Add("She said this to him: follow me."); //this is NOT a label since there is a space before the colon lines.Add("description: this is the first description"); lines.Add("description:this is the second description"); //no space after colon lines.Add("this is a line with no label"); foreach (var line in lines) { Console.WriteLine(StringHelpers.GetLabelFromLine(line)); Console.WriteLine(StringHelpers.StripLabelFromLine(line)); Console.WriteLine("--"); //note //this is a note //-- //test //just a test //-- //test //just a test //-- //firstName //Jim //-- // //She said this to him: follow me. //-- //description //this is the first description //-- //description //this is the first description //-- // //this is a line with no label //-- } Console.ReadLine(); } } public static class StringHelpers { public static string GetLabelFromLine(this string line) { string label = line.GetMatch(@"^?:(\s)"); //??????????????? if (!label.IsNullOrEmpty()) return label; else return ""; } public static string StripLabelFromLine(this string line) { return ...//??????????????? } public static bool IsNullOrEmpty(this string line) { return String.IsNullOrEmpty(line); } } public static class RegexHelpers { public static string GetMatch(this string text, string regex) { Match match = Regex.Match(text, regex); if (match.Success) { string theMatch = match.Groups[0].Value; return theMatch; } else { return null; } } } }

    Read the article

  • CSS Rollovers: how to maintain "hit area" size when hidden image is larger than anchor area

    - by nukefusion
    I have a small problem and I don't think what I want to do can be achieved with just pure CSS, but I figured I'd ask anyway. Basically, I have one DIV which contains a hyperlinked element that is smaller in size to it's parent DIV. So in effect I have a square within a square with the inner square being the "hit area". When I mouse over this inner square I want the background of the outer square to change. I know it's not possible to change the parent DIV's background on a:hover, but I figured I could give the illusion of it happening by nesting a hidden image inside the anchor. This works great until I want to "roll off". The problem is that I want the image to disappear when I leave the area of the anchor tag, not the larger hidden image. Is this possible? For the benefit of everyone I've provided an example to demonstrate what I mean: <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml"> <head> <meta content="text/html; charset=utf-8" http-equiv="Content-Type" /> <title>Test Rollover</title> <link href="main.css" rel="stylesheet" type="text/css" /> </head> <body> <div id="d1"> <a href="#nogo"> <b id="b1"></b> <b id="b2"></b> </a> </div> </body> And the css: #b1 { width: 200px; height: 200px; top: 100px; left: 100px; background-color:aqua; position: absolute; z-index: 100; } #b2 { width: 400px; height: 400px; background-color:lime; position: absolute; display: none; z-index: 90; } #d1 { width: 400px; height: 400px; background-color:fuchsia; position: relative; } #d1 a:hover #b2 { display: block; } In this example I want the green outer square to disappear when I leave the bounds of the hidden inner blue square.

    Read the article

  • how to create a linq query using join and max

    - by geoff swartz
    I have 2 tables in my linq dbml. One is people with a uniqueid called peopleid and the other is a vertical with a foreign key for peopleid and a uniqueid called id. I need to create a type of linq query that does a left outer join on people and gets the latest record in the vertical table based off the max(id) column. Can anyone suggest what this should look like? Thanks.

    Read the article

  • increasing amazon root volume size

    - by OCD
    I have a default amazon ec2 instance with 8GB root volume size. I am running out of space. I have: Detach the current EBS volume in AWS Management Console (Web). Create snapshot of this volume. Created a new Volume with 50G space with my snapshot. Attach the new volume back to the instance to /dev/sda1 However, when I reconnect to the account with: > df -h I can see from the management console that my new Filesystem 1K-blocks Used Available Use% Mounted on /dev/xvda1 8256952 8173624 0 100% / tmpfs 308508 40 308468 1% /dev/shm It's still not using my new volume's size, how to make this work?

    Read the article

  • Variable length Blob in hibernate?

    - by Seth
    I have a byte[] member in one of my persistable classes. Normally, I'd just annotate it with @Lob and @Column(name="foo", size=). In this particular case, however, the length of the byte[] can vary a lot (from ~10KB all the way up to ~100MB). If I annotate the column with a size of 128MB, I feel like I'll be wasting a lot of space for the small and mid-sized objects. Is there a variable length blob type I can use? Will hibernate take care of all of this for me behind the scenes without wasting space? What's the best way to go about this? Thanks!

    Read the article

  • jquery ui modal dialog problems in IE

    - by JohnM2
    I use jquery ui dialog widget. Everything works fine in FF, Opera etc., except IE. The problem is that when dialog is opened in Internet Explorer, some space (not covered with that "modal gray layer") is added at the bottom of the document, and page is scrolled to the bottom. So I don't even see the dialog, I have to scroll up, to see it fully. Anyone had that problems? Any solutions? EDIT: now I see, that this "bottom space" is also added in FireFox, but it doesn't scroll to it like in IE.

    Read the article

  • Way to get VS 2008 to stop forcing indentation on namespaces?

    - by Earlz
    I've never really been a big fan of the way most editors handle namespaces. They always force you to add an extra pointless level of indentation. For instance, I have a lot of code in a page that I would much rather prefer formatted as namespace mycode{ class myclass{ void function(){ foo(); } void foo(){ bar(); } void bar(){ //code.. } } } and not something like namespace mycode{ class myclass{ void function(){ foo(); } void foo(){ bar(); } void bar(){ //code.. } } } Honestly, I don't really even like the class thing being indented most of the time because I usually only have 1 class per file. And it doesn't look as bad here, but when you get a ton of code and lot of scopes, you can easily have indentation that forces you off the screen, and plus here I just used 2-space tabs and not 4-space as is used by us. Anyway, is there some way to get Visual Studio to stop trying to indent namespaces for me like that?

    Read the article

  • Portable way of finding total disk size in Java (pre java 6)

    - by Wouter Lievens
    I need to find the total size of a drive in Java 5 (or 1.5, whatever). I know that Java 6 has a new method in java.io.File, but I need it to work in Java 5. Apache Commons IO has org.apache.commons.io.FileSystemUtils to provide the free disk space, but not the total disk space. I realize this is OS dependant and will need to depend on messy command line invocation. I'm fine with it working on "most" systems, i.e. windows/linux/macosx. Preferably I'd like to use an existing library rather than write my own variants. Any thoughts? Thanks.

    Read the article

  • Stored procedure to remove FK of a given table

    - by Nicole
    I need to create a stored procedure that: Accepts a table name as a parameter Find its dependencies (FKs) Removes them Truncate the table I created the following so far based on http://www.mssqltips.com/sqlservertip/1376/disable-enable-drop-and-recreate-sql-server-foreign-keys/ . My problem is that the following script successfully does 1 and 2 and generates queries to alter tables but does not actually execute them. In another word how can execute the resulting "Alter Table ..." queries to actually remove FKs? CREATE PROCEDURE DropDependencies(@TableName VARCHAR(50)) AS BEGIN SELECT 'ALTER TABLE ' + OBJECT_SCHEMA_NAME(parent_object_id) + '.[' + OBJECT_NAME(parent_object_id) + '] DROP CONSTRAINT ' + name FROM sys.foreign_keys WHERE referenced_object_id=object_id(@TableName) END EXEC DropDependencies 'TableName' Any idea is appreciated! Update: I added the cursor to the SP but I still get and error: "Msg 203, Level 16, State 2, Procedure DropRestoreDependencies, Line 75 The name 'ALTER TABLE [dbo].[ChildTable] DROP CONSTRAINT [FK__ChileTable__ParentTable__745C7C5D]' is not a valid identifier." Here is the updated SP: CREATE PROCEDURE DropRestoreDependencies(@schemaName sysname, @tableName sysname) AS BEGIN SET NOCOUNT ON DECLARE @operation VARCHAR(10) SET @operation = 'DROP' --ENABLE, DISABLE, DROP DECLARE @cmd NVARCHAR(1000) DECLARE @FK_NAME sysname, @FK_OBJECTID INT, @FK_DISABLED INT, @FK_NOT_FOR_REPLICATION INT, @DELETE_RULE smallint, @UPDATE_RULE smallint, @FKTABLE_NAME sysname, @FKTABLE_OWNER sysname, @PKTABLE_NAME sysname, @PKTABLE_OWNER sysname, @FKCOLUMN_NAME sysname, @PKCOLUMN_NAME sysname, @CONSTRAINT_COLID INT DECLARE cursor_fkeys CURSOR FOR SELECT Fk.name, Fk.OBJECT_ID, Fk.is_disabled, Fk.is_not_for_replication, Fk.delete_referential_action, Fk.update_referential_action, OBJECT_NAME(Fk.parent_object_id) AS Fk_table_name, schema_name(Fk.schema_id) AS Fk_table_schema, TbR.name AS Pk_table_name, schema_name(TbR.schema_id) Pk_table_schema FROM sys.foreign_keys Fk LEFT OUTER JOIN sys.tables TbR ON TbR.OBJECT_ID = Fk.referenced_object_id --inner join WHERE TbR.name = @tableName AND schema_name(TbR.schema_id) = @schemaName OPEN cursor_fkeys FETCH NEXT FROM cursor_fkeys INTO @FK_NAME,@FK_OBJECTID, @FK_DISABLED, @FK_NOT_FOR_REPLICATION, @DELETE_RULE, @UPDATE_RULE, @FKTABLE_NAME, @FKTABLE_OWNER, @PKTABLE_NAME, @PKTABLE_OWNER WHILE @@FETCH_STATUS = 0 BEGIN -- create statement for dropping FK and also for recreating FK IF @operation = 'DROP' BEGIN -- drop statement SET @cmd = 'ALTER TABLE [' + @FKTABLE_OWNER + '].[' + @FKTABLE_NAME + '] DROP CONSTRAINT [' + @FK_NAME + ']' EXEC @cmd -- create process DECLARE @FKCOLUMNS VARCHAR(1000), @PKCOLUMNS VARCHAR(1000), @COUNTER INT -- create cursor to get FK columns DECLARE cursor_fkeyCols CURSOR FOR SELECT COL_NAME(Fk.parent_object_id, Fk_Cl.parent_column_id) AS Fk_col_name, COL_NAME(Fk.referenced_object_id, Fk_Cl.referenced_column_id) AS Pk_col_name FROM sys.foreign_keys Fk LEFT OUTER JOIN sys.tables TbR ON TbR.OBJECT_ID = Fk.referenced_object_id INNER JOIN sys.foreign_key_columns Fk_Cl ON Fk_Cl.constraint_object_id = Fk.OBJECT_ID WHERE TbR.name = @tableName AND schema_name(TbR.schema_id) = @schemaName AND Fk_Cl.constraint_object_id = @FK_OBJECTID -- added 6/12/2008 ORDER BY Fk_Cl.constraint_column_id OPEN cursor_fkeyCols FETCH NEXT FROM cursor_fkeyCols INTO @FKCOLUMN_NAME,@PKCOLUMN_NAME SET @COUNTER = 1 SET @FKCOLUMNS = '' SET @PKCOLUMNS = '' WHILE @@FETCH_STATUS = 0 BEGIN IF @COUNTER > 1 BEGIN SET @FKCOLUMNS = @FKCOLUMNS + ',' SET @PKCOLUMNS = @PKCOLUMNS + ',' END SET @FKCOLUMNS = @FKCOLUMNS + '[' + @FKCOLUMN_NAME + ']' SET @PKCOLUMNS = @PKCOLUMNS + '[' + @PKCOLUMN_NAME + ']' SET @COUNTER = @COUNTER + 1 FETCH NEXT FROM cursor_fkeyCols INTO @FKCOLUMN_NAME,@PKCOLUMN_NAME END CLOSE cursor_fkeyCols DEALLOCATE cursor_fkeyCols END FETCH NEXT FROM cursor_fkeys INTO @FK_NAME,@FK_OBJECTID, @FK_DISABLED, @FK_NOT_FOR_REPLICATION, @DELETE_RULE, @UPDATE_RULE, @FKTABLE_NAME, @FKTABLE_OWNER, @PKTABLE_NAME, @PKTABLE_OWNER END CLOSE cursor_fkeys DEALLOCATE cursor_fkeys END For running use: EXEC DropRestoreDependencies dbo, ParentTable

    Read the article

  • CSS RGBA border / background alpha double

    - by stockli
    I'm working on a website that has a lot of transparency involved, and I thought I would try to build it entirely in RGBA and then do fallbacks for IE. I need a "facebox" style border effect, where the outer border is rounded and is less opaque than the background of the box it surrounds. The last example from http://24ways.org/2009/working-with-rgba-colour seems to suggest that it's possible, but I can't seem to get it to work. When I try the following: <!DOCTYPE html PUBLIC "-//W3C//DTD XHTML 1.0 Transitional//EN" "http://www.w3.org/TR/xhtml1/DTD/xhtml1-transitional.dtd"> <html xmlns="http://www.w3.org/1999/xhtml" xml:lang="en" lang="en"> <head> <meta http-equiv="Content-Type" content="text/html; charset=utf-8"/> <title>RGBA Test</title> <style type='text/css'> body { background: #000; color: #fff; } #container { width: 700px; margin: 0 auto; background: rgba(255, 255, 255, 0.2); border: 10px solid rgba(255, 255, 255, 0.1); padding: 20px; } </style> </head> <body> <div id='container'> This should look like a facebox. </div> </body></html> It seems like the background "extends" underneath the border of the element, which causes the pixel values to get added together. Thus, when both the background and the border are semi-transparent, the border will ALWAYS be more opaque than the background of the element. This is exactly the opposite of what I am trying to achieve, but it seems like it should be possible based on the examples I've seen. I should also add that I can't use another element inside the container, because I'm also going to use a border-radius on the container to get rounded corners, and webkit squares the corners of the child elements if they have a background assigned, which would essentially mean a rounded outer border with square contents. Sorry I can't post an image of this... Apparently I don't have enough rep to post an image.

    Read the article

  • SQL Code Smells

    - by Lijo
    Hi Team, Could you please list some of the bad practices in SQL, that novice people do? I have found the use of "WHILE loop" in scenarios which could be resolved using set operations. Another example is inserting data only if it does not exist. This can be achieved using LEFT OUTER JOIN. Some people go for "IF" Any other thoughts? Thanks Lijo

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • how Can we get the output format to CSV instead of HTML in Alfresco using webscripts?

    - by pavan123
    how Can we change the output format to CSV instead of HTML in Alfresco using webscripts? below are the my corresponding FTL and Webscript files recursive.get.html.ftl <#macro recurse_macro node depth> <#if node.isContainer> <tr> <td> ${node.properties.name} </td> <td></td> </tr> <#list node.children as child> <#if child.isContainer> <@recurse_macro node=child depth=depth+1/> <#list child.children as child2> <#if child2.isDocument> <tr><td></td><td>${child2.properties.name}</td></tr> </#if> </#list> </#if> </#list> </#if> </#macro> Recursive Listing of Spaces & Documents: Space Document recursive.get.desc.xml <webscript> <shortname>recurcive</shortname> <description>Recursive</description> <url>/sample/recursive/{recursive}</url> <format default="html">extension</format> <authentication>guest</authentication> </webscript> and html output is Recursive Listing of Spaces & Documents: Space Document Company Home Data Dictionary Space Templates Software Engineering Project Documentation Drafts Pending Approval Published Samples system-overview.html Discussions UI Design Presentations Quality Assurance Presentation Templates doc_info.ftl localizable.ftl my_docs.ftl my_spaces.ftl my_summary.ftl translatable.ftl recent_docs.ftl general_example.ftl my_docs_inline.ftl show_audit.ftl readme.ftl Email Templates notify_user_email.ftl invite_user_email.ftl RSS Templates RSS_2.0_recent_docs.ftl Saved Searches admin Scripts backup.js example test script.js backup and log.js append copyright.js alfresco docs.js test return value.js Web Scripts org alfresco sample blogsearch.get.js blogsearch.get.atom.ftl blogsearch.get.desc.xml blogsearch.get.html.ftl blogsearch.get.html.400.ftl blogsearch.get.atom.400.ftl categorysearch.get.js categorysearch.get.atom.ftl categorysearch.get.desc.xml categorysearch.get.html.ftl categorysearch.get.html.404.ftl categorysearch.get.atom.404.ftl folder.get.js folder.get.atom.ftl folder.get.desc.xml folder.get.html.ftl avmstores.get.desc.xml avmstores.get.html.ftl avmbrowse.get.js avmbrowse.get.desc.xml avmbrowse.get.html.ftl recursive.get.desc.xml recursive.get.html.ftl sgs.get.desc.xml sgs.get.csv.ftl sample1.get.desc.xml sample1.get.csv.ftl first.get.desc.xml first.get.text.ftl rag.get.html.ftl rag.get.desc.xml new1.get.desc.xml new1.get.html.ftl excel.get.html.ftl excel.get.desc.xml sgs1.get.desc.xml one.get.html.ftl one.get.desc.xml one.get.js readme.html Web Scripts Extensions readme.html Guest Home Alfresco-Tutorial.pdf User Homes isabel Users Home

    Read the article

  • Shrink database after removing extra data

    - by Sergey Osypchuk
    We have a need to fit database in 4G in order to use ms sql express edition. I started from 7G database, and found a lot of not needed records, and deleted them. After Shrink database size is 4.6G, and 748MB is free (according to database properties). However, when i execute exec sp_spaceused i am having interesting results: DatabaseName Database_size unallocation space xxxxxx 4726.50 MB 765.42 MB Reserved Data index_size unused 3899472 KB 1608776 KB 1448400 KB 842296 KB Any ideas, how can i bite at least some of this unused space? Also I know table, which occupied it. update: is it worth to try to rebuild table indexes? ALTER INDEX ALL ON Production.Product REBUILD

    Read the article

  • Set inner table border in HTML

    - by ripper234
    How do I set the "inner border" - the border between different cells. By setting style attributes I manage to control the outer border, but the inner border just stays the same gray color and the same width. What attributes should I tweak to control the inner border?

    Read the article

  • Using Distinct or Not

    - by RPS
    In the below SQL Statement, should I be using DISTINCT as I have a Group By in my Where Clause? Thoughts? SELECT [OrderUser].OrderUserId, ISNULL(SUM(total.FileSize), 0), ISNULL(SUM(total.CompressedFileSize), 0) FROM ( SELECT DISTINCT ProductSize.OrderUserId, ProductSize.FileInfoId, CAST(ProductSize.FileSize AS BIGINT) AS FileSize, CAST(ProductSize.CompressedFileSize AS BIGINT) AS CompressedFileSize FROM ProductSize WITH (NOLOCK) INNER JOIN [Version] ON ProductSize.VersionId = [Version].VersionId ) AS total RIGHT OUTER JOIN [OrderUser] WITH (NOLOCK) ON total.OrderUserId = [OrderUser].OrderUserId WHERE NOT ([OrderUser].isCustomer = 1 AND [OrderUser].isEndOrderUser = 0 OR [OrderUser].isLocation = 1) AND [OrderUser].OrderUserId = 1 GROUP BY [OrderUser].OrderUserId

    Read the article

  • SQL: ATER COLUMN to shorter CHAR(n) type

    - by Rising Star
    I'm working with MS SQL SERVER 2003. I want to change a column in one of my tables to have fewer characters in the entries. This is identical to this question: http://stackoverflow.com/questions/2281336/altering-a-table-column-to-accept-more-characters except for the fact that I want fewer characters instead of more. I have a column in one of my tables that holds nine-digit entries. A developer previously working on the table mistakenly set the column to hold ten-digit entries. I need to change the type from CHAR(10) to CHAR(9). Following the instructions from the discussion linked above, I wrote the statement ALTER TABLE [MY_TABLE] ALTER COLUMN [MY_COLUMN] CHAR(9); This returns the error message "String or binary data would be truncated". I see that my nine-digit strings have a space appended to make them ten digits. How do I tell SQL Server to discard the extra space and convert my column to a CHAR(9) type?

    Read the article

  • File sizing issue in DOS/FAT

    - by Heather
    I've been tasked with writing a data collection program for a Unitech HT630, which runs a proprietary DOS operating system that can run executables compiled for 16-bit MS DOS with some restrictions. I'm using the Digital Mars C/C++ compiler, which is working well thus far. One of the application requirements is that the data file must be human-readable plain text, meaning the file can be imported into Excel or opened by Notepad. I'm using a variable length record format much like CSV that I've successfully implemented using the C standard library file I/O functions. When saving a record, I have to calculate whether the updated record is larger or smaller than the version of the record currently in the data file. If larger, I first shift all records immediately after the current record forward by the size difference calculated before saving the updated record. EOF is extended automatically by the OS to accommodate the extra data. If smaller, I shift all records backwards by my calculated offset. This is working well, however I have found no way to modify the EOF marker or file size to ignore the data after the end of the last record. Most of the time records will grow in size because the data collection program will be filling some of the empty fields with data when saving a record. Records will only shrink in size when a correction is made on an existing entry, or on a normal record save if the descriptive data in the record is longer than what the program reads in memory. In the situation of a shrinking record, after the last record in the file I'm left with whatever data was sitting there before the shift. I have been writing an EOF delimiter into the file after a "shrinking record save" to signal where the end of my records are and space-filling the remaining data, but then I no longer have a clean file until a "growing record save" extends the size of the file over the space-filled area. The truncate() function in unistd.h does not work (I'm now thinking this is for *nix flavors only?). One proposed solution I've seen involves creating a second file and writing all the data you wish to save into that file, and then deleting the original. Since I only have 4MB worth of disk space to use, this works if the file size is less than 2MB minus the size of my program executable and configuration files, but would fail otherwise. It is very likely that when this goes into production, users would end up with a file exceeding 2MB in size. I've looked at Ralph Brown's Interrupt List and the interrupt reference in IBM PC Assembly Language and Programming and I can't seem to find anything to update the file size or similar. Is reducing a file's size without creating a second file even possible in DOS?

    Read the article

  • HTML list wrapping problem

    - by Daniel
    I have a HTML list with this style: font-weight: bold; padding: 0px; margin: 0px; list-style-type: none; display: block; width:700px; font-size: 14px; white-space: pre-wrap; and the cells have this style: display: inline; and I have spacer cells between each cell with this style: padding-right: 20px; display: inline; My problem is that when the list is too long for its 700 pixels, it wraps. I want this, but I dont want the objects to be on two separate lines. I have tried the CSS white-space property, but nothing seems to work. Any ideas?

    Read the article

< Previous Page | 103 104 105 106 107 108 109 110 111 112 113 114  | Next Page >