Search Results

Search found 1089 results on 44 pages for 'manish kumar chauhan'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 11/44 | < Previous Page | 7 8 9 10 11 12 13 14 15 16 17 18  | Next Page >

  • creating enumeration using .NET's CodeDom

    - by Manish Sinha
    Hi, I want to create an Enumeration using CodeDom API. I have searched enough on the internet and I get results which are hardly of any use. What I want to generate is public enum bug_tracker_type { [Description("Bugzilla")] Bugzilla, [Description("Debbugs")] Debbugs, [Description("PHP Project Bugtracker")] PHP_Project_Bugtracker, [Description("Google Code")] Google_Code } I used CodeTypeDeclaration and set it's IsEnum property as true, created a name, and set it's Attributes. Now the biggest problem is how to populate the body? I tried CodeTypeMember mem = new CodeTypeMember(); mem.Name = WadlSharpUtils.CreateIdentifier(discreteValue.value); mem.CustomAttributes.Add(new CodeAttributeDeclaration(discreteValue.value)); // enumCandidate is an instance of CodeTypeDeclaration enumCandidate.Members.Add(mem); Though using this solution I can generate the Description attributes, the end of line would be ; and not ,

    Read the article

  • How to validate smtp credentials before sending mail in C# ?

    - by Manish Gupta
    I need to validate the username and password set in SmtpClient object before sending mail. Here is the code sample: SmtpClient client=new SmtpClient(host); client.Credentials=new NetworkdCredentials(username,password); client.UseDefaultCredentials=false; //Here I need to verify the credentials(i.e. username and password) client.Send(mail); Thanks in advance.....

    Read the article

  • Creating DescriptionAttribute on Enumeration Field using System.Reflection.Emit

    - by Manish Sinha
    I have a list of strings which are candidates for Enumerations values. They are Don't send diffs 500 lines 1000 lines 5000 lines Send entire diff The problem is that spaces, special characters are not a part of identifiers and even cannot start with a number, so I would be sanitizing these values to only chars, numbers and _ To keep the original values I thought of putting these strings in the DescriptionAttribute, such that the final Enum should look like public enum DiffBehvaiour { [Description("Don't send diffs")] Dont_send_diffs, [Description("500 lines")] Diff_500_lines, [Description("1000 lines")] Diff_1000_lines, [Description("5000 lines")] Diff_5000_lines, [Description("Send entire diff")] Send_entire_diff } Then later using code I will retrieve the real string associated with the enumeration value, so that the correct string can be sent back the web service to get the correct resource. I want to know how to create the DescriptionAttribute using System.Reflection.Emit Basically the question is where and how to store the original string so that when the Enumeration value is chosen, the corresponding value can be retrieved. I am also interested in knowing how to access DescriptionAttribute when needed.

    Read the article

  • In cakePHP, how to retrieve joined result from multiple tables

    - by Manish Sharma
    Hi, can anyone tell me, how to retrieve joined result from multiple tables in cakePHP ( using cakePHP mvc architecture). For example, I have three tables to join (tbl_topics, tbl_items, tbl_votes. Their relationship is defined as following: a topic can have many items and an item can have many votes. Now I want to retrieve a list of topics with the count of all votes on all items for each topic. The SQL query for this is written below: SELECT Topic.*, count(Vote.id) voteCount FROM tbl_topics AS Topic LEFT OUTER JOIN tbl_items AS Item ON (Topic.id = Item.topic_id) LEFT OUTER JOIN tbl_votes AS Vote ON (Item.id = Vote.item_id); My problem is I can do it easily using $this-><Model Name>->query function, but this requires sql code to be written in the controller which I don't want. I'm trying to find out any other way to do this (like find()).

    Read the article

  • inline assembly error

    - by Manish
    I am using inline assembly for iphone, I working for device debug mode. The instruction is as follows: __asm__("smlatb %0, %1, %2 ,%3 \n\t": "=r"(Temp): "r"(treg5) : "r"(fac5) : "r"(Temp) ); And I am getting an errors: error : expected ')' before tokedn '(' error: unknown register name 'r' in 'asm' I am using X-code 3.0 and gcc 4.0. Any ideas?

    Read the article

  • Threading: problem with checkbox's visibility

    - by Manish
    In a C#.NET windows application I set the visibility of the checkbox to false: checkBoxLaunch.Visible = true; I started a thread. Thread th = new Thread(new ThreadStart(PerformAction)); th.IsBackground = true; th.Start(); The thread performs some stuff and sets the visibility to true private void PerformAction() { /* . .// some actions. */ checkBoxLaunch.Visible = true; } But after the thread finishes it's task, the check box is not visible to me.. :( What am I missing??

    Read the article

  • How to set parameters of CGContextAddArcToPoint method using a slider

    - by Manish Sahni
    am making an app in which i have to control a smile of a face like graphics. For example if i slide the slider down(to a value less than middle) it should give the arc a sad face(like :-( ) effect and if i slide the slider up the arc should give the effect of smile(like :-) ).initially lips are like :-| . I need to control the lips which is an arc using a slider? smileSliderViewController.h #import <UIKit/UIKit.h> @interface smileSliderViewController : UIViewController { IBOutlet UISlider *slider; } -(IBAction)valueChange:(id)sender; @end smileSliderViewController.m #import "smileSliderViewController.h" //#import "smile.h" @implementation smileSliderViewController -(IBAction)valueChange:(id)sender { int value = (int)(slider.value); if(value>0 && value<25) { //value--; CGContextRef context = UIGraphicsGetCurrentContext(); CGContextSetLineWidth(context, 2.0); CGColorSpaceRef colorspace = CGColorSpaceCreateDeviceRGB(); CGFloat components[] = {0.0,0.0,1.0,1.0}; CGColorRef color = CGColorCreate(colorspace, components); CGContextSetStrokeColorWithColor(context, color); CGContextMoveToPoint(context, 120,180); CGContextAddArcToPoint(context, 190 , 170, 270, 200, 0 ); CGContextStrokePath(context); } } smile.h #import <UIKit/UIKit.h> #import "smile.m" @interface smile : UIView { IBOutlet UISlider *slider; } @end smile.m #import "smile.h" #import "smileSliderViewController.h" @implementation smile - (id)initWithFrame:(CGRect)frame { if (self = [super initWithFrame:frame]) { // Initialization code } return self; } - (void)drawRect:(CGRect)rect { CGContextRef context = UIGraphicsGetCurrentContext(); CGContextSetLineWidth(context, 2.0); //CGContextSetStrokeColor(context, [UIColor redColor].CGColor); CGColorSpaceRef colorspace = CGColorSpaceCreateDeviceRGB(); CGFloat components[] = {0.0,0.0,1.0,1.0}; CGColorRef color = CGColorCreate(colorspace, components); CGContextSetStrokeColorWithColor(context, color); CGRect rectangle = CGRectMake(60, 20, 200,200); CGContextAddEllipseInRect(context, rectangle); CGContextStrokePath(context); /*CGRect rectangle1 = CGRectMake(130,170,50,10); CGContextAddRect(context,rectangle1); CGContextStrokePath(context);*/ /*CGContextMoveToPoint(context,100,200); CGContextAddArcToPoint(context,120,150,400,150,70 ); CGContextStrokePath(context);*/ /*CGContextMoveToPoint(context, 100,100); CGContextAddArcToPoint(context, -100,200, -400,200, 80); CGContextStrokePath(context);*/ CGContextSetStrokeColorWithColor(context,color); CGRect rectangle2 = CGRectMake(80, 90, 50, 8); CGContextAddEllipseInRect(context, rectangle2); CGContextStrokePath(context); CGContextSetStrokeColorWithColor(context,color); CGRect rectangle3 = CGRectMake(180, 90, 50, 8); CGContextAddEllipseInRect(context, rectangle3); CGContextStrokePath(context); CGContextSetStrokeColorWithColor(context,color); CGContextMoveToPoint(context, 155,120); CGContextAddLineToPoint(context, 155,160); CGContextStrokePath(context); /*CGContextSetStrokeColorWithColor(context, color); CGRect rectangle4 = CGRectMake(130, 180, 50,8); CGContextAddEllipseInRect(context, rectangle4); CGContextStrokePath(context);*/ /*CGContextSetStrokeColorWithColor(context,color); CGContextMoveToPoint(context, 120,180); CGContextAddLineToPoint(context, 190,180); CGContextStrokePath(context);*/ int value = (int)(slider.value); if(value == 25) { CGContextMoveToPoint(context, 120,180); CGContextAddArcToPoint(context, 190 , 180, 250 , 180, 0 ); CGContextStrokePath(context); } }

    Read the article

  • .Net: Adding files and folders to SETUP Project programmatically

    - by Manish
    So, here is the scenario: I want to create a installer which would just dump few files and folders at a location specified by user. But the problem is these files are required to be picked up from a fixed source folder and then the installer is build. Also, these files may change any time and then again a new version of the installer is required to be created. So this needs to be done programmatically. Also, how can I add some coding stuff in setup projects? (New to SETUP PROJECTS) How? Any ideas/comments appreciated...

    Read the article

  • Saving Types generated via Reflection.Emit as code file (.cs) instead of saving it in .dll files

    - by Manish Sinha
    Before start let me tell my experience: I am experienced with C#.NET, web services, XML part and few more. Reflection is something new to me, though I have read extensively on it and tried out some experimental code, but haven't made anything great using reflection I checked out many examples of how we can create Type at runtime and then which can be saved in an assembly (.dll) files. Of all the examples I have seen is about saving the created types in the .dll files instead of code file. Isn't there any way to create the code file out of reflection? I need to create code file since I want to distribute code instead of compiled assemblies. What I want to do is something like xsd.exe does, either spit out a .dll or the code file(in any language). Isn't there any way to create a code file, since most of the place I can find is AssemblyBuilder ab = System.AppDomain.CurrentDomain.DefineDynamicAssembly(an, AssemblyBuilderAccess.Save); and then lastly ab.Save("QuoteOfTheDay.dll");

    Read the article

  • video API iphone

    - by Manish
    Hi, I want to play H.264 video streamed from network. To play video iphone provides the media player API. Does anyone one aware of any documented or undocumented API for decoding and playing single video frame?

    Read the article

  • Writing a .wmv file using WMA sf filter

    - by Manish
    Hi I am trying to create an output .wmv file using WM Asf writer filter.Here is my code . IBaseFilter* pASFWriter; CoCreateInstance(CLSID_WMAsfWriter,NULL,CLSCTX_INPROC_SERVER,IID_IBaseFilter,(void**) (&pASFWriter)); pGraphBuilder-AddFilter(pASFWriter,L"FileWriter"); IFileSinkFilter *pSink2=NULL; pASFWriter-QueryInterface(IID_IFileSinkFilter,(void**)&pSink2); pSink2-SetFileName(OUTFILENAME,NULL); All of the above return S_OK however there is no file created .I am not able to understand why this is so?

    Read the article

  • cookies handling on webrequest and response

    - by manish patel
    I have created a application that has a function mainpost. It is created to post data on a https sites. Here I want to handle cookies in this function. How can I do this task? public string Mainpost(string website, string content) { // this is what we are sending string post_data = content; // this is where we will send it string uri = website; // create a request HttpWebRequest request = (HttpWebRequest) WebRequest.Create(uri); request.KeepAlive = false; request.ProtocolVersion = HttpVersion.Version10; request.Method = "POST"; // turn our request string into a byte stream byte[] postBytes = Encoding.ASCII.GetBytes(post_data); // this is important - make sure you specify type this way request.ContentType = "application/x-www-form-urlencoded"; request.ContentLength = postBytes.Length; Stream requestStream = request.GetRequestStream(); // now send it requestStream.Write(postBytes, 0, postBytes.Length); requestStream.Close(); // grab te response and print it out to the console along with the status // code HttpWebResponse response = (HttpWebResponse)request.GetResponse(); string str = (new StreamReader(response.GetResponseStream()).ReadToEnd()); Console.WriteLine(response.StatusCode); return str; }

    Read the article

  • Master page property access from Content page.

    - by Manish
    FROM BOOK: To reference public properties in a master page, we add the @MasterType declaration to the content page and reference the property using Master.<PropertyName>. QUESTION: But what happens internally? Does all of the master's and content page's properties, function gets complied into one class? Or something else?

    Read the article

  • A code using SharePoint classes doesn't run on systems not having SharePoint installed

    - by Manish
    I have a window application which uses SP classes to create a site. I works fine on a system having Windows Server 2003 R2 with sharepoint installed. But it doesn't work on a system having XP installed and SharePoint not installed. The fact is that both of these systems are on a intranet. So I assumed that the NON-SP system would be able to run the code and create a site on the system having SP installed if all the required parameters (like serverLocation, domain, username, password) are provided. I did copied the DLLs to these NON-SP system and referenced them to build the project: Microsoft.SharePoint.dll microsoft.sharepoint.portal.dll Microsoft.SharePoint.Publishing.dll But this too didn't worked. What am I missing? Is my assumption wrong?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • need to open an image open in web browser

    - by manish
    byte.eml file is having image base64 encoded value ..and i am tring to open it in browser ...but this is not populating image file....plz help me out.. this is code... Dim oFile As System.IO.File Dim orEAD As System.IO.StreamReader orEAD = oFile.OpenText("E:\mailbox\P3_hemantd.mbx\byte.eml") Dim content As String content = "" ''Dim intsinglechr As Integer ''Dim csinglechr As String While orEAD.Peek <> -1 content = content & Chr(orEAD.Read) content = Replace(content, vbCrLf, "") content = Replace(content, vbTab, "") content = Replace(content, " ", "") End While Response.ContentType = "image/jpeg" Response.BinaryWrite(Convert.FromBase64String(content))

    Read the article

  • loading data from a flat file to table using informatica, having both english and foreign language c

    - by Manish
    I am loading data from a flat file to table using informatica, the file has both english and foreign language characters like chinese, and others. The foreign language characters are not getting displayed properly after loading. How can this problem be solved ? I could solve it by using code page UTF - 16 Encoding of Unicode Platform Endian, earlier i was using different code page UTF-8.

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 7 8 9 10 11 12 13 14 15 16 17 18  | Next Page >