Search Results

Search found 1082 results on 44 pages for 'manoj kumar'.

Page 11/44 | < Previous Page | 7 8 9 10 11 12 13 14 15 16 17 18  | Next Page >

  • Post comments on a WordPress page from Android application

    - by manoj
    I need to post some text to a remote server over HTTP, this server in turn puts these comment on a Wordpress page. I am still waiting for interface details. Is it possible to post comments directly on a Wordpress page from an Android or Java application? Links to relevant documentation, tutorials etc. is appreciated. Thanks.

    Read the article

  • memory issue iPad 4.2 crashes

    - by Manoj Kumar
    I am developing a application which receives 600-700 KB of XML data from the server. I have to do some manipulations in that data so once received the data the memory increases to 600 KB to 2 M.B. Already view occupied 4 M.B of memory in the application. So while processing the XML data i m doing some manipulation(pre-parsing) and the memory increases to 600 K.B to 2 M.B and finally decreases to 600 K.B. due to increase in memory, application gives the memory warning. While getting memory warning i m releasing all the views in the navigation controller but it releases only 1 M.B of memory. Even though I release all the views the application is crashing. Please help me out in this issue. It happens in iPad 4.2. Thanks in advance

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • how to integrate LINQ

    - by Manoj Wadhwani
    I am working on three tier application. 1.UI 2.BUZ 3.SQL I want to integrate LINQ in existing application , can any body suggest what should i have to do for integration LINQ. Could any body send code or example for that.

    Read the article

  • how to use time out in mplayer?

    - by manoj
    I am trying to save audio using mplayer from a live http stream. saving audio is successful. If there is no live stream playing it does not exit automatically. Is there any way to set timeout if there is no live stream? code : mplayer -i url -t 00:00:10 -acodec libmp3lame -ab 24 -ar 8000 audio.mp3 Thanks in advance.

    Read the article

  • Store number in Excel using Apache POI.

    - by Manoj
    Hi All, I am using Apache POI to store data in excel sheet. I can store data like "50%" in the cell. Excel also shows up, but it show error like "Number stored as String". If i click that message and click "convert number to String". It shows perfectly. How to store it without errror using POI

    Read the article

  • Printing to Power point

    - by Manoj
    Hi, Similar to a print to pdf option, where we can choose PDF to be the output format when printing something, I am searching for something which can print to a power point file from a file. Is there any such plugin or tool? Also link to a relilable print to pdf tool would be helpful. This essentially would eliminate the export to power point option that the users are asking for. Thanks...

    Read the article

  • Need help how to call c# function which return type is array in jquery

    - by Manoj Wadhwani
    $('#calendar').fullCalendar ( { editable: true, events: $.ajax ( { type: "POST", url: "Calender.aspx/GetCDCatalog", contentType: "application/json; charset=utf-8", data: "{}", dataType: "json" } ) } ) calender.aspx is page and getcddialog is function which return type is array which doest not bind calender. public CD[] GetCDCatalog() { XDocument docXML = XDocument.Load(Server.MapPath("mydata.xml")); var CDs = from cd in docXML.Descendants("Table") select new CD { title = cd.Element("title").Value, star = cd.Element("star").Value, endTime = cd.Element("endTime").Value, }; return CDs.ToArray<CD>(); }

    Read the article

  • java.lang.reflect.InvocationTargetException in Java

    - by manoj
    if(locs!=null) { System.out.println("location are not null"); Iterator ite = locs.iterator(); DefaultComboItem locObj = null; ArrayList locCode = null; String cod=null; String name=null; while(ite.hasNext()) { locCode = (ArrayList) ite.next(); Iterator iter = locCode.iterator(); while(iter.hasNext()) { cod=(String)iter.next(); System.out.println("Code="+cod); name=(String)iter.next(); System.out.println("name="+name); locObj = new DefaultComboItem(cod, name); colRet.add(locObj); } } } on executing above code i am getting "java.lang.reflect.InvocationTargetException" Please help me

    Read the article

  • I am using TINY MCE for CMS

    - by Manoj Wadhwani
    when i put value in textbox then its throught this error , I am making Content Management System. A potentially dangerous Request.Form value was detected from the client (elm1="ABC"). when page go to server then it's through error .Please assist.

    Read the article

  • Twitter API problem iPhone

    - by Manoj Kumar
    I have tried to use twitter API in my application using MGTwiiterEngine, I think Ih ave configured all thing but while I am running the app by giving my username and password. The delegate of the MGTwitterEngine was called with the 0 statuses and also the numberOfConnections=0. twitterEngine = [[MGTwitterEngine alloc] initWithDelegate:self]; [twitterEngine setUsername:username password:password]; [twitterEngine getRepliesStartingAtPage:0]; Can any one please help me out. Thanks in advance

    Read the article

  • limit Google maps of countries in the autocomplete list to "INDIA, USA and UK"

    - by Manoj Thakur
    This code is not working. Please tell me the exact solution <script src="maps.googleapis.com/maps/api/…; type="text/javascript"></script> <script type="text/javascript"> function initialize() { var input = document.getElementById('searchTextField'); /* restrict to multiple cities? */ var options = { types: ['(cities)'], componentRestrictions: {country: ["usa", "uk"]} }; var autocomplete = new google.maps.places.Autocomplete(input, options); } google.maps.event.addDomListener(window, 'load', initialize); </script>

    Read the article

  • Error in C Program

    - by Manoj
    Hi, while(((long)(1000*ratio*((long)clock()-(long)t0))%100)/1000)<Data_Read_Rate); The above line is generating the following error: "Syntax Error before < token". Why is this error coming up? I use MINGW32 for development(GCC compiler). Thanks...

    Read the article

  • How to avoid keyboard hide & show when focus changes from UITextField and UIWebView?

    - by Manoj
    I have a requirement in which the view contains one native UITextField and one UIWebView. The issue is if I switch the focus from UITextView to UIWebView, the keyboard window flicker(hides and then shows). ie, I got UIKeyboardWillHideNotification and UIKeyboardDidShowNotification But, this is not happening when I switch the other way. ies, I got only UIKeyboardDidShowNotification Is there any way to avoid this flickering effect? Note: I also notices if I have multiple UITextField and UIWebView, this issue is not happening with the same type of views.

    Read the article

  • Preventing concurrent data modification in Web based app

    - by Manoj
    Hi, I am building a web app in Silverlight which allows users to view and edit a database. In order to prevent multiple users from editing the same data, I was thinking of implementing a lock and key mechanism, so that other users are made to wait when one particular user is editing the data. Is there any way in which we can have variable(flag specifying if a user is editing data) in the server which can be shared across multiple clients? Is there a better way to manage this type of conurrent data access issues?

    Read the article

  • IDE for C application development that you admire most

    - by Manoj Doubts
    I am looking for a good Integrated development environment for developing applictaions in C language for both windows and linux. IDE should have: good interface, easy file management, auto filling and any advanced options. Tell me which IDE you most admire for these tasks For general PC application development For embedded application development in C If you think it is more specific question then you may also take it as a general case. Thanks in advance.

    Read the article

  • Buy or build tool for Data Reporting ?

    - by Manoj
    We have been asked to provide a data reporting solution. The followng are the requirements: i. The client has a lot of data which is generated everyday as an outcome of the tests they run. These tests are run at several sites and they get automatically backed up into a central server. ii. They already have perl scripts which post process them and generates excel based reports. iii. They need a web based interface for comparing those reports and they need to mark and track issues which might be present in those data. I am confused if we should build our own tool for this or we should go for already exiting tool(any suggestions?). Can you please provide supportive arguments for the decision that you would suggest?

    Read the article

< Previous Page | 7 8 9 10 11 12 13 14 15 16 17 18  | Next Page >