Search Results

Search found 1111 results on 45 pages for 'mohit kumar'.

Page 11/45 | < Previous Page | 7 8 9 10 11 12 13 14 15 16 17 18  | Next Page >

  • Program execution stop at scanf???

    - by Mohit Deshpande
    main.c (with all the headers like stdio, stdlib, etc): int main() { int input; while(1) { printf("\n"); printf("\n1. Add new node"); printf("\n2. Delete existing node"); printf("\n3. Print all data"); printf("\n4. Exit"); printf("Enter your option -> "); scanf("%d", &input); string key = ""; string tempKey = ""; string tempValue = ""; Node newNode; Node temp; switch (input) { case 1: printf("\nEnter a key: "); scanf("%s", tempKey); printf("\nEnter a value: "); scanf("%s", tempValue); //execution ternimates here newNode.key = tempKey; newNode.value = tempValue; AddNode(newNode); break; case 2: printf("\nEnter the key of the node: "); scanf("%s", key); temp = GetNode(key); DeleteNode(temp); break; case 3: printf("\n"); PrintAllNodes(); break; case 4: exit(0); break; default: printf("\nWrong option chosen!\n"); break; } } return 0; } storage.h: #ifndef DATABASEIO_H_ #define DATABASEIO_H_ //typedefs typedef char *string; /* * main struct with key, value, * and pointer to next struct * Also typedefs Node and NodePtr */ typedef struct Node { string key; string value; struct Node *next; } Node, *NodePtr; //Function Prototypes void AddNode(Node node); void DeleteNode(Node node); Node GetNode(string key); void PrintAllNodes(); #endif /* DATABASEIO_H_ */ I am using Eclipse CDT, and when I enter 1, then I enter a key. Then the console says . I used gdb and got this error: Program received signal SIGSEGV, Segmentation fault. 0x00177024 in _IO_vfscanf () from /lib/tls/i686/cmov/libc.so.6 Any ideas why?

    Read the article

  • Iterate through main function in C?

    - by Mohit Deshpande
    Here is my main function: int main(int argc, char **argv) { LoadFile(); Node *temp; char *key; switch (GetUserInput()) { case 1: temp = malloc(sizeof(Node)); printf("\nEnter the key of the new node: "); scanf("%s", temp->key); printf("\nEnter the value of the new node: "); scanf("%s", temp->value); AddNode(temp); free(temp); break; case 2: key = malloc(sizeof(char *)); printf("Enter the key of the node you want to delete: "); scanf("%s", key); DeleteNode(key); free(key); break; case 3: PrintAll(); break; case 4: SaveFile(); break; case 5: return 0; break; default: printf("\nWrong choice!\n"); break; } return 0; } The only problem with it is that after any case statement breaks, the program just exits out. I understand why, but I don't know how to fix it. I want the program to repeat itself each time even after the case statements. Would I just say: main(argc, argv); before every break statement?

    Read the article

  • Flex ItemRenderer/Editor ComboBox Issue...Puhleezz Help

    - by Mohit
    Hi EveryOne Beginner in Flex ...Even worse with item renderers... Have managed to add a Combobox to a datagrid using a itemEditor... I want to change the options in a combo box depending on the value selected by the user on a previous combo.. In the combo box i want to display a certain value (Model Name ) but for quering a table i'll pass the corresponding code of the model :(... sounds simple enough ..unfortunately not able to implement it I have found this problem on this site but the solution seems an overkill for my "small" problem..was hoping if anyone could guide me towards a more simpler solution... My xml comes as <item><mstValue>CH1</mstValue><mstRemarks>CARRIER</mstRemarks></item> <item><mstValue>CH2</mstValue><mstRemarks>TRANS</mstRemarks></item> <item><mstValue>CH3</mstValue><mstRemarks>YORK</mstRemarks></item> Now i have been able to show the values in a combo .if user selects CARRIER i want to pass CH1(dont know how to do it with itemeditors)...and then fetch values corresponding to CH1 from a table (second part of the problem)...in the sample below i used this.parentDocument.modelComboChanged(this.selectedItem) to pass the selected value ...instedd i need to pass the code for it which comes from the xml...Pls help this making me go crazy.... <mx:DataGrid id="chillerGrid" dataProvider="{chillerGridDp}" editable="true" itemRollOver="{ComponentUtil.setTooltip(event,this)}" itemRollOut="ComponentUtil.resetTooltip(event)" width="70%" height="160"> <mx:columns> <mx:DataGridColumn id="test" headerText="Model" dataField="model" editorDataField="value" editable="true" backgroundColor="#f4f2bd" width="100" > <mx:itemEditor> <mx:Component> <mx:ComboBox creationComplete="{if(text=='')selectedIndex=0;if(data &amp;&amp; data.contactType!=undefined)text=data.contactType.text();}" change="{if(text == ''){selectedIndex=0;if(data &amp;&amp; data.contactType!=undefined)text=data.contactType.text();};this.parentDocument.modelComboChanged(this.selectedItem)}" dataProvider="{this.parentDocument.arrColl1}" text="mstRemarks" labelField="mstRemarks" editable = "false" > <!--<mx:dataProvider > <mx:String></mx:String> <mx:String>Model1</mx:String> <mx:String>Model2</mx:String> <mx:String>Model3</mx:String> <mx:String>Model4</mx:String> <mx:String>Model5</mx:String> </mx:dataProvider>--> </mx:ComboBox> <!--<components:ComboBoxIn dataProvider="{this.parentDocument.arrColl1}" labelField="mstRemarks" /> --> </mx:Component> </mx:itemEditor> </mx:DataGridColumn> <mx:DataGridColumn headerText="Make" dataField="make" editorDataField="value" editable="true" backgroundColor="#f4f2bd" width="100" > <mx:itemEditor> <mx:Component> <mx:ComboBox creationComplete="{if(text=='')selectedIndex=0;if(data &amp;&amp; data.contactType!=undefined)text=data.contactType.text();}" change="{if(text == ''){selectedIndex=0;if(data &amp;&amp; data.contactType!=undefined)text=data.contactType.text();} }" labelField="@label" editable = "false" > <mx:dataProvider> <mx:String></mx:String> <mx:String>Carrier</mx:String> <mx:String>York</mx:String> <mx:String>Trane</mx:String> </mx:dataProvider> </mx:ComboBox> </mx:Component> </mx:itemEditor> </mx:DataGridColumn> <mx:DataGridColumn headerText="Chillers" dataField="chillers" width="200" editable="true"> <mx:itemEditor> <mx:Component> <mx:TextInput maxChars="49" /> </mx:Component> </mx:itemEditor> </mx:DataGridColumn> </mx:columns> </mx:DataGrid>

    Read the article

  • Arrow operator (->) usage in C

    - by Mohit Deshpande
    I am currently learning C by reading a good beginner's book called "Teach Yourself C in 21 Days" (I have already learned Java and C# so I am moving at a much faster pace). I was reading the chapter on pointers and the - (arrow) operator came up without explanation. I think that it is used to call members and functions (like the equivalent of the . (dot) operator, but for pointers instead of members). But I am not entirely sure. Could I please get an explanation and a code sample?

    Read the article

  • Imitate database in C

    - by Mohit Deshpande
    I am fairly new to C. (I have good knowledge of C# [Visual Studio] and Java [Eclipse]) I want to make a program that stores information. My first instinct was to use a database like SQL Server. But I don't think that it is compatible with C. So now I have two options: Create a struct (also typedef) containing the data types. Find a way to integrate SQLite through a C header file Which option do you think is best? Or do you have another option? I am kind of leaning toward making a struct with a typedef, but could be pursuaded to change my mind.

    Read the article

  • The concept of an Intent in Android?

    - by Mohit Deshpande
    I don't really understand the use and concept of an Intent. I DO understand that an activity are one visual interface and one endeavour that the user can partake in. I THINK an intent is used to launch and communicate between different activities. If so, then how would you accomplish that? A code sample would be helpful.

    Read the article

  • Learning MVVM for WPF

    - by Mohit Deshpande
    I am now very comfortable with WPF, but I read some articles about MVP and MVVM that find the default project solution ineffective. Then I realized how ineffective it was and how the MVVM pattern is much better. So I want to really learn this pattern. Can I be directed to some resources like maybe a tutorial or a video or something?

    Read the article

  • What version of the .NET framework is installed on Windows XP, Vista, and 7?

    - by Mohit Deshpande
    I have an application that uses the .NET framework 3.5. I am building this application for a college to help students to study. Most students usually have Windows XP SP2, Windows Vista, or Windows 7. (Sorry Mac users! The Mac version will come out in about 6 months) What version of the .NET framework is installed on Windows XP, Vista, and 7; and will my application run on all of those platforms?

    Read the article

  • What kind of events should be created for a CRUD application?

    - by Mohit Deshpande
    I have an application that is centered around a database (ORM is LINQ-SQL) that has a table called Assignment. I am using the repository pattern to manipulate the database. My application is basically going to perform CRUD operations. I am new to delegates and events and I am asking you what events I should create (like maybe AssignmentCreating, AssignmentCreated) and what kind of delegate to use (like maybe a custom delegate or just an EventHandler)?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Declare variable as exern if initialized in header?

    - by Mohit Deshpande
    Say I declare a header file with a variable: int count; Then in the source file, I want to use count. Do I have to declare it as: extern int count Or can I just use it in my source file? All assuming that I have #include "someheader.h". Or should I just declare it in the source file? What is the difference between putting count in the header file vs the source file? Or does it not matter?

    Read the article

  • Compare Database container and class container

    - by Mohit Deshpande
    I am using a SQL Server database in my current project. I was watching the MVC Storefront videos (specifically the repository pattern) and I noticed that Rob (the creator of MVC Storefront) used a class called Category and Product, instead of a database and I have notice that using LINQ-SQL or ADO.NET, that a class is generated. Is there an advantage to using a class over a database to store information? Or is it the other way around? Or are they even comparable?

    Read the article

  • Understanding Virtualization

    - by mohit
    Hi, I wana to know about Virtualization in detail. But start from basics, like what is virtualization, with real world examples and scenarios. When ever i search, i got Virtualization technologies, but i want to learn and in fcat know what exactly is virtualization, its types n all..... Please help me in getting practical details of term "Virtualization"

    Read the article

  • Ideas for a C/C++ library

    - by Mohit Deshpande
    I thought one of the best ways to familiarise myself with C/C++, is to make a helpful library. I was maybe thinking like a geometry library, like to calculate areas, surface area, etc. It would be useful in game programming. Or maybe an algebra library, like for different formulas like the distance formula, quadratic formula, etc. Or maybe like a standard library for very simple functions, like calculating the number of items in an array.

    Read the article

  • functional test for rails controller private method

    - by mohit
    I have a private method in my controller. which is used for some database update. this method i am calling from another controller method. and it works fine. But when i am trying to write a test case for that method then It is tripping on accessing (session variable and params) in my functional all other methods are working fine the problem is only with private method? In my setup method in functional test, I am setting session also.?

    Read the article

  • difference between AJAX POST and GET

    - by Mohit Kumar
    $.ajax({ type: 'POST', url: path, data: '{AreaID: ' + parentDropdownList.val() + '}', contentType: 'application/json; charset=utf-8', dataType: 'json', success: function(response) { } }); In above code I am using type: 'POST'. My senior told me that I also can use 'GET' in type. But dint find the difference between 'POST' and 'GET' and I also want to know what is the use of type, contentType, and dataType. Could anyone one explain me why we use these type, contentType and dataType. Thanks in advance.

    Read the article

  • Shallow copying a list with downcasting

    - by Mohit
    I have the class herichary as follows CEntity----CNode---CElement I have a class Nodes : List<Cnode> and Class Elements : List<Element> Node class contain common item common across different project Element class has item specific to a project. I have to shallow copy the element list into the node list (basically down casting the elements to nodes)

    Read the article

  • apache derby database

    - by mohit
    i am building a swing application with apache derby database as back end in netbeans 6.8 with my friend.He is making the databse in derby while i am making the front end i.e. frames. now how do i use database created by him in my project in netbeans 6.8 my motive is to how we insert a already build databse(from my friend's netbeans) into the the services tab of my application.

    Read the article

  • ASP.NET Web Custom Controls

    - by Mohit Kumar
    Hello Experts, I am Beginner. I want to study and create custom controls. I have searched on Google but didn't find any good stuff. Could anybody provide me some nice link or explain me that how can I start custom controls. Thanks in advance.

    Read the article

  • R.java file not updating with UI element's id

    - by Mohit Deshpande
    I added some UI elements to the main.xml file in the res\layout folder and when I try to access them through the call, R.layout.my_uielement, the UI element that I created is not there. Even when I add a new xml file with UI elements, it still doesn't show up in the R.layout class. I have made checked the ids on them and they have the correct format (I think): android:id="@+id/my_button". What could be the problem? Do I need to compile the code first?

    Read the article

< Previous Page | 7 8 9 10 11 12 13 14 15 16 17 18  | Next Page >