Search Results

Search found 1105 results on 45 pages for 'pankaj kumar'.

Page 11/45 | < Previous Page | 7 8 9 10 11 12 13 14 15 16 17 18  | Next Page >

• Retrieve Records from paypal csv file

  - by Pankaj Khurana

  Hi, I want to retrieve all the records from paypal csv file where type='Payment Processed' and store it in a database table.It should be available in the following format: 'Heading':'Value' The format of the csv is: "Transaction ID","Reference Transaction ID","Date","Type","Subject","Item Number","Item Name","Invoice ID","Name","Email","Shipping Name","Shipping Address Line 1","Shipping Address Line 2","Shipping Address City","Shipping State/Province","Shipping Zip/Postal Code","Shipping Address Country","Shipping Method","Address Status","Contact Phone Number","Gross Amount","Receipt ID","Custom Field","Option 1 Name","Option 1 Value","Option 2 Name","Option 2 Value","Note","Auction Site","Auction User ID","Item URL","Auction Closing Date","Insurance Amount","Currency","Fees","Net Amount","Shipping & Handling Amount","Sales Tax Amount","To Email","Time","Time Zone" "1T","",5/5/2010 2:10:44 PM,"Payment Processed","CFP Self Study Kit","1","CFP Self Study Kit","","User1","[email protected]","","","","","","","","","N","","68.18","R1","","","","","","","","","",,"","USD","-2.62","65.56","0","0","[email protected]","01:40","Asia/Calcutta" "2T","",5/19/2010 4:04:08 PM,"Payment Processed","CFP Self Study Kit","1","CFP Self Study Kit","","User2","[email protected]","","","","","","","","","N","","68.18","R2","","","","","","","","","",,"","USD","-2.62","65.56","0","0","[email protected]","03:34","Asia/Calcutta" "3T","1RT",5/19/2010 5:28:45 PM,"Currency Conversion Completed","","","",""," ","","","","","","","","","","N","","17492.6","","","","","","","","","","",,"","INR","0","17492.6","0","0","","04:58","Asia/Calcutta" "4T","2RT",5/19/2010 5:28:45 PM,"Currency Conversion Completed","","","",""," ","","","","","","","","","","N","","-393.36","","","","","","","","","","",,"","USD","0","-393.36","0","0","","04:58","Asia/Calcutta" "5T","",5/19/2010 5:28:45 PM,"Transfer to Bank Initiated","P1006","","P1006",""," ","","","","","","","","","","N","","-17492.6","","","","","","","","","","",,"","INR","0","-17492.6","0","0","","04:58","Asia/Calcutta" "6T","",5/20/2010 5:38:02 PM,"Transfer to Bank Completed","P1006","","P1006",""," ","","","","","","","","","","N","","-17492.6","","","","","","","","","","",,"","INR","0","-17492.6","0","0","","05:08","Asia/Calcutta" "7T","",5/21/2010 12:32:37 PM,"Payment Processed","FP - LVC Plus","","FP - LVC Plus","","User3","[email protected]","User3","NEW DELHI","BEHIND KARNATAKA BANK LD","SOUTH","NEW DELHI","110023","IN","","N","","283.96","","","","","","","","","","",,"","USD","-9.95","274.01","0","0","[email protected]","00:02","Asia/Calcutta" "8T","",5/25/2010 4:40:48 PM,"Transfer to Bank Initiated","P1006","","P1006",""," ","","","","","","","","","","N","","-12569.85","","","","","","","","","","",,"","INR","0","-12569.85","0","0","","04:10","Asia/Calcutta" "9T","3RT",5/25/2010 4:40:48 PM,"Currency Conversion Completed","","","",""," ","","","","","","","","","","N","","-274.01","","","","","","","","","","",,"","USD","0","-274.01","0","0","","04:10","Asia/Calcutta" "10T","4RT",5/25/2010 4:40:48 PM,"Currency Conversion Completed","","","",""," ","","","","","","","","","","N","","12569.85","","","","","","","","","","",,"","INR","0","12569.85","0","0","","04:10","Asia/Calcutta" "11T","",5/26/2010 4:57:39 PM,"Transfer to Bank Completed","P1006","","P1006",""," ","","","","","","","","","","N","","-12569.85","","","","","","","","","","",,"","INR","0","-12569.85","0","0","","04:27","Asia/Calcutta" "Total","-247.05 USD","-15.19","-262.24" "Total","0.00 INR","0.00","0.00" Please help me on this Thanks

  Read the article

• how to call any method of Project from classlibrary?

  - by Pankaj Mishra

  Hello I have Class Library Where a class of multithreading Of Producer and consumer based. private void WorkDeQueue() { while (true) { string Url = null; lock (locker) { if (queueList.Count > 0) { Url = queueList.Dequeue(); /* return if a null is found in the queue */ if (Url == null) return; } } if (Url != null) { /* if a job was found then process it */ GetData(Url); //This Is a Method } else { /* if a job was not found (meaning list is empty) then * wait till something is added to it*/ wh.WaitOne(); } } } this GetData method has no body on that class. How can i call any method of my project in palace of getdata. I tried with factory Pattern and also with reflection. but both didn't worked for me. So plz tell me how can i call any method of my project from here.

  Read the article

• The type or namespace name 'Oledb' does not exist in the namespace 'System.Data' error on Web Servic

  - by Pankaj Kumar

  Hi everyone... i have a webservice that i want to test by typing the url in the address bar in the web browser localhost:1981/myProject/admin/autocomplete.asmx and when i do this it gives this compilation error CS0234: The type or namespace name 'Oledb' does not exist in the namespace 'System.Data' (are you missing an assembly reference?) i know this is because we added this in our web.config <add namespace="System.Data.Oledb"/> <add namespace ="System.Data"/> in the namespaces section..... when i call this web service through ajax it works but if i try to test it it gives this error. Is there any way to prevent this?

  Read the article

• MySQL :- select by month

  - by Pankaj

  how can i get record from table using month/year? I have a table like Project Name - varchar DueDate -datetime Status -boll DueDate is project due date, i want record corresponding to month/year,not full date, i mean record for specific month. How can i do this in mysql

  Read the article

• Load data infile in a stored procedure- MySQL

  - by Pankaj

  Is there any way, i can use 'Load data infile' in a stored procedure. I am using mysql. LOAD DATA LOCAL INFILE 'C:\\MyData.txt' INTO TABLE tempprod fields terminated by ',' lines terminated by '\r\n'; SELECT * FROM product p;

  Read the article

• Retreiving dynamic post values

  - by Pankaj Khurana

  Hi I am using tiny table with some input fields for posting in a page. I want to retrieve the data which the user fills up for a particular instrument number. My code <form name="frmDeposit" action="paymentdeposited.php" method="post"> <table cellpadding="0" cellspacing="0" border="0" id="table" class="tinytable" style="width:700px;"> <thead> <tr> <th><h3>Email</h3></th> <th><h3>Amount Paid</h3></th> <th><h3>Instrument Type</h3></th> <th><h3>Instrument No.</h3></th> <th><h3>Date Paid</h3></th> <th class="nosort"><h3>Date Deposited</h3></th> <th class="nosort"><h3>Bank Name</h3></th> <th class="nosort"><h3>Slip No.</h3></th> <th class="nosort"><h3>Submit</h3></th> </tr> </thead> <tbody> <?php foreach($paymentsdeposited as $paymentdeposited) { ?> <tr> <td><?php echo $paymentdeposited[email];?></td> <td><?php echo $paymentdeposited[amount];?></td> <td><?php echo $paymentdeposited[instrument];?></td> <td><?php echo $paymentdeposited[instrumentnumber];?></td> <td><?php echo $paymentdeposited[dated];?></td> <td><input type="text" name="txtDateDeposited_<?php echo $paymentdeposited[pk_paymentinstrumentid];?>" class="field date-pick"/></td> <td><input type="text" name="txtBankName_<?php echo $paymentdeposited[pk_paymentinstrumentid];?>" class="field"/></td> <td><input type="text" name="txtSlipNo_<?php echo $paymentdeposited[pk_paymentinstrumentid];?>" class="field"/><input type="hidden" name="txtPaymentInstrumentNo_<?php echo $paymentdeposited[pk_paymentinstrumentid];?>" value="<?php echo $paymentdeposited[pk_paymentinstrumentid];?>" class="field"/></td> <td><input type="submit" name="btnSubmit1" value="Submit"/></td> </tr> <?php } ?> </tbody> </table> The print_r command outputs Array ( [txtDateDeposited_57] => 2010-05-07 [txtBankName_57] => pnb [txtSlipNo_57] => 121 [txtPaymentInstrumentNo_57] => 57 [btnSubmit1] => Submit [txtDateDeposited_51] => [txtBankName_51] => [txtSlipNo_51] => [txtPaymentInstrumentNo_51] => 51 [txtDateDeposited_52] => [txtBankName_52] => [txtSlipNo_52] => [txtPaymentInstrumentNo_52] => 52 [txtDateDeposited_45] => [txtBankName_45] => [txtSlipNo_45] => [txtPaymentInstrumentNo_45] => 45 [txtDateDeposited_47] => [txtBankName_47] => [txtSlipNo_47] => [txtPaymentInstrumentNo_47] => 47 ) I want to retrieve the values for id 57 for which he has entered values. But i am unable to construct logic for retrieving this value.I want to make it dynamic. Please help me on this. Thanks

  Read the article

• Warning: Cannot modify header information - headers already sent

  - by Pankaj Khurana

  Hi, I am using code available on http://www.forosdelweb.com/f18/zip-lib-php-archivo-zip-vacio-431133/ for creating zip file. First file-zip.lib.php <?php /* $Id: zip.lib.php,v 1.1 2004/02/14 15:21:18 anoncvs_tusedb Exp $ */ // vim: expandtab sw=4 ts=4 sts=4: /** * Zip file creation class. * Makes zip files. * * Last Modification and Extension By : * * Hasin Hayder * HomePage : www.hasinme.info * Email : [email protected] * IDE : PHP Designer 2005 * * * Originally Based on : * * http://www.zend.com/codex.php?id=535&single=1 * By Eric Mueller <[email protected]> * * http://www.zend.com/codex.php?id=470&single=1 * by Denis125 <[email protected]> * * a patch from Peter Listiak <[email protected]> for last modified * date and time of the compressed file * * Official ZIP file format: http://www.pkware.com/appnote.txt * * @access public */ class zipfile { /** * Array to store compressed data * * @var array $datasec */ var $datasec = array(); /** * Central directory * * @var array $ctrl_dir */ var $ctrl_dir = array(); /** * End of central directory record * * @var string $eof_ctrl_dir */ var $eof_ctrl_dir = "\x50\x4b\x05\x06\x00\x00\x00\x00"; /** * Last offset position * * @var integer $old_offset */ var $old_offset = 0; /** * Converts an Unix timestamp to a four byte DOS date and time format (date * in high two bytes, time in low two bytes allowing magnitude comparison). * * @param integer the current Unix timestamp * * @return integer the current date in a four byte DOS format * * @access private */ function unix2DosTime($unixtime = 0) { $timearray = ($unixtime == 0) ? getdate() : getdate($unixtime); if ($timearray['year'] < 1980) { $timearray['year'] = 1980; $timearray['mon'] = 1; $timearray['mday'] = 1; $timearray['hours'] = 0; $timearray['minutes'] = 0; $timearray['seconds'] = 0; } // end if return (($timearray['year'] - 1980) << 25) | ($timearray['mon'] << 21) | ($timearray['mday'] << 16) | ($timearray['hours'] << 11) | ($timearray['minutes'] << 5) | ($timearray['seconds'] >> 1); } // end of the 'unix2DosTime()' method /** * Adds "file" to archive * * @param string file contents * @param string name of the file in the archive (may contains the path) * @param integer the current timestamp * * @access public */ function addFile($data, $name, $time = 0) { $name = str_replace('', '/', $name); $dtime = dechex($this->unix2DosTime($time)); $hexdtime = 'x' . $dtime[6] . $dtime[7] . 'x' . $dtime[4] . $dtime[5] . 'x' . $dtime[2] . $dtime[3] . 'x' . $dtime[0] . $dtime[1]; eval('$hexdtime = "' . $hexdtime . '";'); $fr = "\x50\x4b\x03\x04"; $fr .= "\x14\x00"; // ver needed to extract $fr .= "\x00\x00"; // gen purpose bit flag $fr .= "\x08\x00"; // compression method $fr .= $hexdtime; // last mod time and date // "local file header" segment $unc_len = strlen($data); $crc = crc32($data); $zdata = gzcompress($data); $zdata = substr(substr($zdata, 0, strlen($zdata) - 4), 2); // fix crc bug $c_len = strlen($zdata); $fr .= pack('V', $crc); // crc32 $fr .= pack('V', $c_len); // compressed filesize $fr .= pack('V', $unc_len); // uncompressed filesize $fr .= pack('v', strlen($name)); // length of filename $fr .= pack('v', 0); // extra field length $fr .= $name; // "file data" segment $fr .= $zdata; // "data descriptor" segment (optional but necessary if archive is not // served as file) $fr .= pack('V', $crc); // crc32 $fr .= pack('V', $c_len); // compressed filesize $fr .= pack('V', $unc_len); // uncompressed filesize // add this entry to array $this -> datasec[] = $fr; // now add to central directory record $cdrec = "\x50\x4b\x01\x02"; $cdrec .= "\x00\x00"; // version made by $cdrec .= "\x14\x00"; // version needed to extract $cdrec .= "\x00\x00"; // gen purpose bit flag $cdrec .= "\x08\x00"; // compression method $cdrec .= $hexdtime; // last mod time & date $cdrec .= pack('V', $crc); // crc32 $cdrec .= pack('V', $c_len); // compressed filesize $cdrec .= pack('V', $unc_len); // uncompressed filesize $cdrec .= pack('v', strlen($name) ); // length of filename $cdrec .= pack('v', 0 ); // extra field length $cdrec .= pack('v', 0 ); // file comment length $cdrec .= pack('v', 0 ); // disk number start $cdrec .= pack('v', 0 ); // internal file attributes $cdrec .= pack('V', 32 ); // external file attributes - 'archive' bit set $cdrec .= pack('V', $this -> old_offset ); // relative offset of local header $this -> old_offset += strlen($fr); $cdrec .= $name; // optional extra field, file comment goes here // save to central directory $this -> ctrl_dir[] = $cdrec; } // end of the 'addFile()' method /** * Dumps out file * * @return string the zipped file * * @access public */ function file() { $data = implode('', $this -> datasec); $ctrldir = implode('', $this -> ctrl_dir); return $data . $ctrldir . $this -> eof_ctrl_dir . pack('v', sizeof($this -> ctrl_dir)) . // total # of entries "on this disk" pack('v', sizeof($this -> ctrl_dir)) . // total # of entries overall pack('V', strlen($ctrldir)) . // size of central dir pack('V', strlen($data)) . // offset to start of central dir "\x00\x00"; // .zip file comment length } // end of the 'file()' method /** * A Wrapper of original addFile Function * * Created By Hasin Hayder at 29th Jan, 1:29 AM * * @param array An Array of files with relative/absolute path to be added in Zip File * * @access public */ function addFiles($files /*Only Pass Array*/) { foreach($files as $file) { if (is_file($file)) //directory check { $data = implode("",file($file)); $this->addFile($data,$file); } } } /** * A Wrapper of original file Function * * Created By Hasin Hayder at 29th Jan, 1:29 AM * * @param string Output file name * * @access public */ function output($file) { $fp=fopen($file,"w"); fwrite($fp,$this->file()); fclose($fp); } } // end of the 'zipfile' class ?> My second file newzip.php <? include("zip.lib.php"); $ziper = new zipfile(); $ziper->addFiles(array("index.htm")); //array of files // the next three lines force an immediate download of the zip file: header("Content-type: application/octet-stream"); header("Content-disposition: attachment; filename=test.zip"); echo $ziper -> file(); ?> I am getting this warning while executing newzip.php Warning: Cannot modify header information - headers already sent by (output started at E:\xampp\htdocs\demo\zip.lib.php:233) in E:\xampp\htdocs\demo\newzip.php on line 6 I am unable to figure out the reason for the same. Please help me on this. Thanks

  Read the article

• How to download video from server?

  - by Pankaj Mishra

  Hello I have a window application where i want to make functionality of video downloading but i am not getting correct solution for this. I tried one code project code and lot of other code that i got from google. can any buddy help me for this problem.

  Read the article

• Creating XML problem using c#

  - by Pankaj

  I am searching a batter solution for creating xml through xml serialization. What i need, i have a given format like this <product Id="1"> <name>2 1/2 X 6 PVC NIPPLE TOE SCH 80</name> <notes> <note>!--note 1---</note> <note>!--note 2--</note> ...... </notes> </product> what i am doing here, i created a 2 classes like this public class product { [XmlElement("name")] public string Name { get; set; } [XmlArray("notes")] public List<notes> ListNotes { get; set; } } public class notes { [XmlIgnore] public string Note { get; set; } } when i am serializing this then i am getting xml in this formate <product Id="1"> <name>2 1/2 X 6 PVC NIPPLE TOE SCH 80</name> <notes> <notes> <note>!--note 1---</note> <note>!--note 2--</note> </notes> </notes> </product> i don't want extra . Any batter solution to solve this problem? Thanks

  Read the article

• How does .NET compiler compare two strings?

  - by Pankaj

  string a="I am comparing 2 string"; string b="I am comparing 2 string"; if(a==b) return true; else return false; How does a .NET compiler compare two strings? Does a string work like a struct(int)? string is class so a=b means we are comparing 2 object, but i want to compare 2 values.

  Read the article

• How can I get a file's upload size using simple Javascript?

  - by Pankaj Khurana

  I have upload file functionality on one of the page. I check for the extension of the file using JavaScript. Now i want to restrict the user from uploading file greater than 1 MB. Is there any way i can check the file upload size using JavaScript. My code currently look like this: <script language="JavaScript"> function validate() { var filename = document.getElementById("txtChooseFile").value; var ext = getExt(filename); if(ext == "txt" || ext == "csv") return true; alert("Please upload Text files only."); return false; } function getExt(filename) { var dot_pos = filename.lastIndexOf("."); if(dot_pos == -1) return ""; return filename.substr(dot_pos+1).toLowerCase(); } </script>

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Print XML file and download it

  - by Pankaj

  I am create xml using serialization and trying to print them using this code string xmlDate = xml.GetXML(); string name = string.Format("{0}_HighEST", ProjectName); Response.AddHeader("Content-disposition", "attachment; filename=\"" + name + "_HighEST.xml\""); Response.ContentType = string.Format("application/.xml", name); how can assign my xmldata to Response so that data will write on downloaded xml?

  Read the article

• javascript equivalent of ASP preInit event

  - by Pankaj Kumar

  Hi guys, searching for this has yielded no resuts.. i have a middle page that has an iframe and all the pages open in that iframe...i have to implement a chat system just like in Google and so to ensure that the chat windows did not close whwn the page would postback i am opening all pages in iframe.... this is a social networking site and user can have themes which have background images per theme now when i visit a friends profile the backgrounf image of the middle page should change... i have this code to find parent of iframe and change background image $(document).ready(function(){ var theme=document.getElementById("ctl00_decideFooterH").value; var t= parent.document.getElementsByTagName("body"); if(theme=='basicTheme'){ t[0].className="basic"; } else if(theme=='Tranquility') { t[0].className="Tranquility"; } else if(theme=='AbstractPink') { t[0].className="abstractPink"; } }); and this code is the master page that all child pages that would open in iframe would access..the trouble is that there is a lag between the theme application on server side(which happens at PreInit) and the background image change which is done by this document.ready that gets executed after the iframe has loaded.. so essentially i need a javascript function that would either execute parallel to PreInit or some other logic....so guys plz help its urgent

  Read the article

• Change Project from ASP.NET MVC1 to ASP.NET MVC2

  - by Pankaj

  Hello All I am currently using ASP.NET MVC1 in my project but now i am planing to move on ASP.NET MVC2. What are the changes i need to do in my project to change MVC version? just need to change System.Web.MVC dll with MVC 2 dll or any other changes i required?

  Read the article

• Session Logout in every two minutes.

  - by Pankaj Mishra

  I have Web Application in asp.net. Where I am maintaining Session for every User. And every Time I got logout in Approx 2 min. I tried to increase this time through web Config File upto 60 min but it is not working For me and I m getting same problem. I have created A class file For maintaining session.I am Using This Code. public static void createSession(System.Web.SessionState.HttpSessionState session) { Session = session; } This is my class file code. And I am calling this function in login Page load like this. BusinessClasses.SessionHandler.createSession(Page.Session); Then After I am Checking In everyPage. But this code is not working for me. Please Give Suggest me correct solution for this problem.

  Read the article

• Deny entering special character in textbox using jquery

  - by Pankaj

  How can i deny user from entering special characters in textbox using jquery? special characters are like \ / ? * [ or ]

  Read the article

• Pubsub implementation with jaxl library

  - by Pankaj Khurana

  Hi, I am using jaxl library for bot development on my debian server with openfire. Now i want to apply pubsub functionality to it. My scenario is : user subscribes to an event & when an event occurs message is sent to all the subscribers. I am confused how to implement pubsub through im. Please help Thanks

  Read the article

• hiding buttons in master page

  - by pankaj

  Hi, I am working on an app where i am having some linkbuttons in master page. I want to display them depending upon the authorization given to them once they logs in. I have initially made all of them visible false and then i am checking the authorisation in the aspx.cs class of master page. I make the link button visible depending upon the right granted to the user. But it is making all the link buttons visible. Instead it should only make two of them visible and rest should be hidden. Following is my code from MasterPage.aspx.cs: ArrayList arrlstUserRoles = new ArrayList(); arrlstUserRoles = (ArrayList)Session["Roles"]; for (int j = 0; j < arrlstUserRoles.Count; j++) { if (int.Parse(arrlstUserRoles[j].ToString()) == 1) { lbtnRetailer.Visible = true; } else if (int.Parse(arrlstUserRoles[j].ToString()) == 2) { lbtnCategory.Visible = true; } else if (int.Parse(arrlstUserRoles[j].ToString()) == 3) { lbtnCouponTemplate.Visible = true; } else if (int.Parse(arrlstUserRoles[j].ToString()) == 4) { //lbtnStoreManagement.Visible = true; } else if (int.Parse(arrlstUserRoles[j].ToString()) == 5) { lbtnStoreManagement.Visible = true; } else if (int.Parse(arrlstUserRoles[j].ToString()) == 6) { lbtnContentManagement.Visible = true; } else if (int.Parse(arrlstUserRoles[j].ToString()) == 7) { //lbtnStoreManagement.Visible = true; } }

  Read the article

• Like query ing LINQ to Object

  - by Pankaj

  Hello All i have a US states list List<string> state // contain all 51 US states Now i have a string which contain some text like okl (it means Oklahoma for me). what i want i want 'like' query in List state and get Oklahoma state.

  Read the article

• import a text file into a temporary table using 'Load data infile' inside a stored procedure- MySQL

  - by Pankaj

  I need to import a text file into a temporary table and from that select portions of it to insert in different tables. I wanted to use 'LOAD DATA INFILE'. Is there any way, i can use 'Load data infile' in a stored procedure. I am using mysql. LOAD DATA LOCAL INFILE 'C:\\MyData.txt' INTO TABLE tempprod fields terminated by ',' lines terminated by '\r\n'; SELECT * FROM product p;

  Read the article

• login through twitter not working in osqa

  - by Pankaj Khurana

  Hi, I have installed osqa on a site hosted on hostgator. The login functionality is working for google,yahoo,facebook. But when i click on twitter icon its generating an exception. I have already added the twitter consumer key and the twitter consumer secret through admin interface. The exception i am getting is: HTTPError at /account/twitter/signin/ HTTP Error 401: Unauthorized Request Method: GET Request URL: http://mydomain/account/twitter/signin/?validate_email=yes Exception Type: HTTPError Exception Value: HTTP Error 401: Unauthorized Exception Location: /usr/lib/python2.4/urllib2.py in http_error_default, line 480 Python Executable: /usr/bin/python Python Version: 2.4.3 I am unable to trace out the reason for the same. Please help me on this. Thanks

  Read the article

• Retreive list of students registered for a particular course

  - by Pankaj Khurana

  Hi, I have moodle1.9 installed on my system and writing some custom reports. I want to retrieve list of students registered for a particular course. I have user profile field usercategoryid through which i figure out for which category he has enrolled. Course belongs to a particular category. Through mdl_user_info_data table i retrieve the category for a particular user. I have written a query to retrieve the users who have registered for a particular category for e.g. Financial Planning 2010. But the issue is that i now want users who have registered for a particular course for e.g. Insurance Planning. There is a relation between course and course category but i am unable to find out the table where course and user information is linked. Please help me on this Thanks

  Read the article

• SQL query problem

  - by Pankaj

  Hello All I have 2 tables Project and ProjectList like this Project ProjectID Name ProjectListID - allow null In ProjectList ProjectListID ProjName Now what i need here, i want only those recoed from ProjectList table which ProjectListID not in Project table. I made a query but it is taking lot of time to execute. select * FROM projectslist pl where pl.ProjectsListID not in (SELECT p.ProjectsListID FROM project p where (p.ProjectsListID is not null and p.ProjectsListID <>0)) Please help me to create optimize query. I am using My SQL.

  Read the article

• testing wcf service in browser

  - by pankaj

  How can i test a wcf service in a browser? I mean if i only enter the url in the browser it should give me only relevent xml

  Read the article

< Previous Page | 7 8 9 10 11 12 13 14 15 16 17 18  | Next Page >