Search Results

Search found 1179 results on 48 pages for 'raj kumar'.

Page 11/48 | < Previous Page | 7 8 9 10 11 12 13 14 15 16 17 18  | Next Page >

• What are the IPv6 Public and Private and Reserved ranges

  - by vipin raj

  I just want to know what are all the public IPv6 ranges which ISPs or other users can use? Also need a list of addresses which can be used in private networks and also the list of addresses which never can be used in any network. I have been searching through different web sites. But none gives a reliable answer. Actually we are developing an application which allows user to plan their IP address(create supernets, subnets, hosts, assign host to ports etc). So my application should be able to distinguish between all kinds of address ranges, whether it is reserved, public, private, multicast etc

  Read the article

• failed to connect to internet ?

  - by raj

  New wifiadapter that is able to identify the router but connection cannot be established? OS Win 7 Another laptop with wifi is able to connect to internet through the router but not using this wifi adapter.

  Read the article

• why page is automatically redirecting to some other sites

  - by raj

  In my browser (Firefox 10.0.7) the page is automatically redirect to some other sites without clicking any link. If I enter the superuser.com url after pressing Enter button, It redirect to some other sites. sometimes while refreshing also the page is redirect to some other site. It's redirecting to this sites http://result.seenfind.com/ncp/Default.aspx?term=gatlinburg%20cabin&u=1000670913 http://search.cpvee.com/search.php?q=gatlinburg+cabin&y=&f=2168&s= http://www.insidecelebritygossip.com/ I cleared all history and all but still same problem. I am using CentOS 6.3

  Read the article

• how to check usage of a web site

  - by Raj More

  I have this community that wants me to join in. They claim to be a very active referral service community. I since referrals are private, I cannot gain access to the actual numbers. I wanted to review their site usage to see really how active they are. Where do I check up on their visitor usage?

  Read the article

• When HDD becomes full, how to create a symbolic link to the data store on another disk?

  - by Brij Raj Singh

  I have a Linux Ubuntu machine which has an X GB hard disk. There is folder, say, /opt/software/data. The disk /dev/sda1 is almost full and I have attached another disk at /dev/sda2 which is mounted at /hdd2. Is it possible for me to link the folders /opt/software/data with /hdd2/software/data so, that every file get stored in the /hdd2/software/data but may be referred from the /opt/software/data? I can't do a reinstall of the software that creates this data, to change the default location of storage.

  Read the article

• Proxmox: VMs and different public IPs

  - by Raj

  I have a server which has two NICs and both are directly connected to internet. I have five different public IP addresses available for the VMs. The host machine (Proxmox) doesn't need to use any (it'll use a private IP and that's all) but will have internet connection. I've gone through the Proxmox documentation and I'm not able to understand the big picture to set up the right network configuration for my needs. In short, what I have is: One server (Proxmox, host machine) On that server, 5 VMs are created 5 public IP addresses available (one for each VM), let's say: 80.123.21.1, 80.123.21.2, 80.123.21.3, 80.123.21.4, 80.123.21.5 What I have now for the host is the following: auto lo iface lo inet loopback auto eth0 iface eth0 inet manual auto eth1 iface eth1 inet manual auto vmbr0 iface vmbr0 inet static address 192.168.1.101 netmask 255.255.255.0 bridge_ports eth0 bridge_stp off bridge_fd 0 auto vmbr1 iface vmbr1 inet manual It can be reached from the internal network, so that's OK. It has internet connection, which is also OK. vmbr1 is going to be used by the VMs. Each VM will have its own IP on his network interfaces configuration file. For some reason, VMs will not have internet and they won't be able to have public IP address. If I use NAT, it will work correctly, but they will not use the public allocated IP addresses for them. Am I missing something?

  Read the article

• Can next hop address be same as destination address?

  - by Raj

  Like if host address is 100.0.0.1 and next hop address is 100.0.0.2 and destination ip address is also 100.0.0.2 Is this a valid use case? Any real life usage? <dest ip> <next hop> ip route 100.0.0.2 255.255.255.255 100.0.0.2 weight 1 next-hop-vrf GlobalRouter Above is the command on a router inside a VRF. 100.0.0.2 is pingable from host. 100.0.0.1 & 100.0.0.2 are an ip address assigned to a VLAN on host & destination respectively. On a linux box, Such configuration is valid. [root]# netstat -r -n Kernel IP routing table Destination Gateway Genmask Flags MSS Window irtt Iface 55.55.55.55 55.55.55.55 255.255.255.255 UGH 0 0 0 eth0 [root]# ip route show 55.55.55.55 via 55.55.55.55 dev eth0 As per my understanding, If a destination IP is reachable (i.e in the same subnet of host IP) we dont need a next hop. I came across one application for using next hop for destination IP in same subnet (i.e for VPN) See this: Will packets send to the same subnet go through routers? If next hop != destination IP but they are in same subnet as that of host, is a valid scenario for VPN, then i am wondering what are the applications of next_hop==dest_ip & subnet same as host? This is my first post in Super User. Extremely happy with the quick and warm response.

  Read the article

• connections in FIN_WAIT and CLOSE_WAIT state

  - by Raj

  I would like to elaborate the setup so You guys can understand the question and answer more accurately. I have HAProxy as load-balancer, 4 webservers (apache 2.2.3) and one database server (MySQL 5). I am monitoring these servers by nagios. I have disabled the keepalive on apache as we have only 8GB of memory. Now what happens whenever I receive alerts for high memory and cpu utilization, I have observed that the connections from apache to database server hang in established mode (keepalive with timeout value of 7200) and at other side means connections between haproxy and apache shows status as FIN_WAIT on haproxy server and CLOSE_WAIT at apache side. I also see the huge memory swapping and apache taking the most of the memory. I did strace on apache process and did not find any information. strace gets attached to apache process but did not produce any output. The processlist on Mysql server show s those processes in sleep mode. The application on webserver is Magento a php application. if you need further information please let me know. Thanks.

  Read the article

• Hardware specs for web cache

  - by Raj

  I am looking for recommendations for hardware specs for a server that needs to be a web cache for a user population of about 2,000 concurrent connections. The clients are viewing segmented HTTP video in bitrates ranging from 150kbps to 2mbps. Most video is "live" meaning segments of 2-10 secs each, of which 100 or so are maintained at a time. There are also some pre-recorded fixed length videos. How would I go about doing the provisioning calculation for such a server: What kind of HDD (SSD?), how many NICs how much RAM etc? I am thinking of using Varnish on Linux, all the RAM I can get my hands on, 2 CPUs with 6-8 cores each.

  Read the article

• Apache with mod_php high memory utilization

  - by Raj

  We have Magento application deployed on Apache with mod_php and mysql. I have observed that sometime apache server starts consuming high memory which causes memory swapping and results in high load on servers. whenever there is high load on apache server, the apache processes which are causing the high load were in sleep mode at mysql end and CLOSE_WAIT state at client side. Any help is appreciated to resolve this issue.

  Read the article

• Windows 8 doesn't start up after installation

  - by Raj BD

  I have a DELL INSPIRON n5110 machine running Windows 7 Home Premium 64-bit. It has 6GB of RAM and 500 GB hard disk capable to run any Windows and Linux system. And I recently attempted to install Windows 8 in the machine. Installation goes fine and smooth until the final stage when windows is done installing and GETS DEVICES READY. When GETTNG DEVICES READY reaches about 60%, the screen goes blank with the machine running. After a while it reboots. And after the new Windows Logo with dotted circles are done showing up, the screen goes blank again (when we'd expect login screen to show up). There is not even a cursor. I can see the HARD DISK ACTIVITY LED blinking but nothing shows up in the screen. I've tried CLEAN INSTALL several times. The DVD is fine, it installed and worked well in my friends' laptop PCs. I tried installing both PRO version and ENTERPRISE version and both 32-bit and 64-bit. But the problem was same everytime. Finally, I had to reinstall Windows 7 which installed and ran without any problem. The problem, we can guess, is GRAPHICS perhaps. I have Intel SandyBridge Graphics Mobile Chipset (Intel HD Graphics 3000). But if Windows 7 and Linux distrubutions like Mint and BackTrack can run on the machine, why on earth, would Windows 8 not run?

  Read the article

• Object of type 'customObject' cannot be converted to type 'customObject'.

  - by Phani Kumar PV

  i am receiving the follwing error when i am invoking a custom object "Object of type 'customObject' cannot be converted to type 'customObject'." Following is the scenario when i am getting the error i am invoking a method in a dll dynamically. Load an assembly CreateInstance.... calling MethodInfo.Invoke() passing int, string as a parameter for my method is working fine = No exceptions are thrown. But if I try and pass a one of my own custom class objects as a parameter, then I get an ArgumentException exception, and it is not either an ArgumentOutOfRangeException or ArgumentNullException. "Object of type 'customObject' cannot be converted to type 'customObject'." I am doing this in a web application. The class file containing the method is in a different proj . also the custom object is a sepearte class in the same file. there is no such thing called a static aseembly in my code. I am trying to invoke a webmethod dynamically. this webmethod is having the customObject type as an input parameter. So when i invoke the webmethod i am dynamically creating the proxy assembly and all. From the same assembly i am trying to create an instance of the cusotm object assinging the values to its properties and then passing this object as a parameter and invoking the method. everything is dynamic and nothing is created static.. :( add reference is not used. Following is a sample code i tried to create it public static object CallWebService(string webServiceAsmxUrl, string serviceName, string methodName, object[] args) { System.Net.WebClient client = new System.Net.WebClient(); //-Connect To the web service using (System.IO.Stream stream = client.OpenRead(webServiceAsmxUrl + "?wsdl")) { //--Now read the WSDL file describing a service. ServiceDescription description = ServiceDescription.Read(stream); ///// LOAD THE DOM ///////// //--Initialize a service description importer. ServiceDescriptionImporter importer = new ServiceDescriptionImporter(); importer.ProtocolName = "Soap12"; // Use SOAP 1.2. importer.AddServiceDescription(description, null, null); //--Generate a proxy client. importer.Style = ServiceDescriptionImportStyle.Client; //--Generate properties to represent primitive values. importer.CodeGenerationOptions = System.Xml.Serialization.CodeGenerationOptions.GenerateProperties; //--Initialize a Code-DOM tree into which we will import the service. CodeNamespace nmspace = new CodeNamespace(); CodeCompileUnit unit1 = new CodeCompileUnit(); unit1.Namespaces.Add(nmspace); //--Import the service into the Code-DOM tree. This creates proxy code //--that uses the service. ServiceDescriptionImportWarnings warning = importer.Import(nmspace, unit1); if (warning == 0) //--If zero then we are good to go { //--Generate the proxy code CodeDomProvider provider1 = CodeDomProvider.CreateProvider("CSharp"); //--Compile the assembly proxy with the appropriate references string[] assemblyReferences = new string[5] { "System.dll", "System.Web.Services.dll", "System.Web.dll", "System.Xml.dll", "System.Data.dll" }; CompilerParameters parms = new CompilerParameters(assemblyReferences); CompilerResults results = provider1.CompileAssemblyFromDom(parms, unit1); //-Check For Errors if (results.Errors.Count > 0) { StringBuilder sb = new StringBuilder(); foreach (CompilerError oops in results.Errors) { sb.AppendLine("========Compiler error============"); sb.AppendLine(oops.ErrorText); } throw new System.ApplicationException("Compile Error Occured calling webservice. " + sb.ToString()); } //--Finally, Invoke the web service method Type foundType = null; Type[] types = results.CompiledAssembly.GetTypes(); foreach (Type type in types) { if (type.BaseType == typeof(System.Web.Services.Protocols.SoapHttpClientProtocol)) { Console.WriteLine(type.ToString()); foundType = type; } } object wsvcClass = results.CompiledAssembly.CreateInstance(foundType.ToString()); MethodInfo mi = wsvcClass.GetType().GetMethod(methodName); return mi.Invoke(wsvcClass, args); } else { return null; } } } I cant find anything static being done by me. any help is greatly appreciated. Regards, Phani Kumar PV

  Read the article

• How to set BackGround color to a divider in JSplitPane

  - by Sunil Kumar Sahoo

  I have created a divider in JSplitPane. I am unable to set the color of divider. I want to set the color of divider. please help me how to set color of that divider import javax.swing.; import java.awt.; import java.awt.event.*; public class SplitPaneDemo { JFrame frame; JPanel left, right; JSplitPane pane; int lastDividerLocation = -1; public static void main(String[] args) { SplitPaneDemo demo = new SplitPaneDemo(); demo.makeFrame(); demo.frame.addWindowListener(new WindowAdapter() { public void windowClosing(WindowEvent e) { System.exit(0); } }); demo.frame.show(); } public JFrame makeFrame() { frame = new JFrame(); // Create a horizontal split pane. pane = new JSplitPane(JSplitPane.HORIZONTAL_SPLIT); left = new JPanel(); left.setBackground(Color.red); pane.setLeftComponent(left); right = new JPanel(); right.setBackground(Color.green); pane.setRightComponent(right); JButton showleft = new JButton("Left"); showleft.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { Container c = frame.getContentPane(); if (pane.isShowing()) { lastDividerLocation = pane.getDividerLocation(); } c.remove(pane); c.remove(left); c.remove(right); c.add(left, BorderLayout.CENTER); c.validate(); c.repaint(); } }); JButton showright = new JButton("Right"); showright.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { Container c = frame.getContentPane(); if (pane.isShowing()) { lastDividerLocation = pane.getDividerLocation(); } c.remove(pane); c.remove(left); c.remove(right); c.add(right, BorderLayout.CENTER); c.validate(); c.repaint(); } }); JButton showboth = new JButton("Both"); showboth.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { Container c = frame.getContentPane(); c.remove(pane); c.remove(left); c.remove(right); pane.setLeftComponent(left); pane.setRightComponent(right); c.add(pane, BorderLayout.CENTER); if (lastDividerLocation >= 0) { pane.setDividerLocation(lastDividerLocation); } c.validate(); c.repaint(); } }); JPanel buttons = new JPanel(); buttons.setLayout(new GridBagLayout()); buttons.add(showleft); buttons.add(showright); buttons.add(showboth); frame.getContentPane().add(buttons, BorderLayout.NORTH); pane.setPreferredSize(new Dimension(400, 300)); frame.getContentPane().add(pane, BorderLayout.CENTER); frame.pack(); pane.setDividerLocation(0.5); return frame; } } Thanks Sunil kumar Sahoo

  Read the article

• Daily tech links for .net and related technologies - May 10-12, 2010

  - by SanjeevAgarwal

  Daily tech links for .net and related technologies - May 10-12, 2010 Web Development jQuery Templates and Data Linking (and Microsoft contributing to jQuery) - ScottGu ASP.NET MVC and jQuery Part 4 – Advanced Model Binding - Mister James Creating an ASP.NET report using Visual Studio 2010 - Part 1 & Part 2 & Part 3 - rajbk Caching Images in ASP.NET MVC -Evan How to Localize an ASP.NET MVC Application - mikeceranski Localization in ASP.NET MVC 2 using ModelMetadata - Raj Kiamal Web Design...(read more)

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• SIM to OIM Migration: A How-to Guide to Avoid Costly Mistakes (SDG Corporation)

  - by Darin Pendergraft

  In the fall of 2012, Oracle launched a major upgrade to its IDM portfolio: the 11gR2 release.  11gR2 had four major focus areas: More simplified and customizable user experience Support for cloud, mobile, and social applications Extreme scalability Clear upgrade path For SUN migration customers, it is critical to develop and execute a clearly defined plan prior to beginning this process.  The plan should include initiation and discovery, assessment and analysis, future state architecture, review and collaboration, and gap analysis.  To help better understand your upgrade choices, SDG, an Oracle partner has developed a series of three whitepapers focused on SUN Identity Manager (SIM) to Oracle Identity Manager (OIM) migration. In the second of this series on SUN Identity Manager (SIM) to Oracle Identity Manager (OIM) migration, Santosh Kumar Singh from SDG  discusses the proper steps that should be taken during the planning-to-post implementation phases to ensure a smooth transition from SIM to OIM. Read the whitepaper for Part 2: Download Part 2 from SDGC.com In the last of this series of white papers, Santosh will talk about Identity and Access Management best practices and how these need to be considered when going through with an OIM migration. If you have not taken the opportunity, please read the first in this series which discusses the Migration Approach, Methodology, and Tools for you to consider when planning a migration from SIM to OIM. Read the white paper for part 1: Download Part 1 from SDGC.com About the Author: Santosh Kumar Singh Identity and Access Management (IAM) Practice Leader Santosh, in his capacity as SDG Identity and Access Management (IAM) Practice Leader, has direct senior management responsibility for the firm's strategy, planning, competency building, and engagement deliverance for this Practice. He brings over 12+ years of extensive IT, business, and project management and delivery experience, primarily within enterprise directory, single sign-on (SSO) application, and federated identity services, provisioning solutions, role and password management, and security audit and enterprise blueprint. Santosh possesses strong architecture and implementation expertise in all areas within these technologies and has repeatedly lead teams in successfully deploying complex technical solutions. About SDG: SDG Corporation empowers forward thinking companies to strategize their future, realize their vision, and minimize their IT risk. SDG distinguishes itself by offering flexible business models to fit their clients’ needs; faster time-to-market with its pre-built solutions and frameworks; a broad-based foundation of domain experts, and deep program management expertise. (www.sdgc.com)

  Read the article

• Pourquoi réinventer la roue quand il y a Runnable ? La startup ambitionne de devenir le « YouTube du Code »

  Pourquoi réinventer la roue quand il y a Runnable ? La startup ambitionne de devenir le « YouTube du Code » Runnable, qui a récemment été lancé par une startup du même nom basée à Palo Alto avec pour objectif la facilitation de la découverte et de la réutilisation de portions de code, a annoncé qu'elle a soulevé une levée de fonds de 2 millions de dollars grâce à la participation de Sierra Ventures, Resolute VC, AngelPad et 500 startups.Yash Kumar Directeur Général et co-fondateur de la start-up...

  Read the article

• Silverlight Cream for November 08, 2011 -- #1165

  - by Dave Campbell

  In this Issue: Brian Noyes, Michael Crump, WindowsPhoneGeek, Erno de Weerd, Jesse Liberty, Derik Whittaker, Sumit Dutta, Asim Sajjad, Dhananjay Kumar, Kunal Chowdhury, and Beth Massi. Above the Fold: Silverlight: "Working with Prism 4 Part 1: Getting Started" Brian Noyes WP7: "Getting Started with the Coding4Fun toolkit Tile Control" WindowsPhoneGeek LightSwitch: "How to Connect to and Diagram your SQL Express Database in Visual Studio LightSwitch" Beth Massi Shoutouts: Michael Palermo's latest Desert Mountain Developers is up Michael Washington's latest Visual Studio #LightSwitch Daily is up From SilverlightCream.com: Working with Prism 4 Part 1: Getting Started Brian Noyes has a series starting at SilverlightShow about Prism 4 ... this is the first one, so a good time to jump in and pick up on an intro and basic info about Prism plus building your first Prism app. 10 Laps around Silverlight 5 (Part 5 of 10) Michael Crump has Part 5 of his 10-part Silverlight 5 investigation up at SilverlightShow talking about all the various text features added in Silverlight 5 Beta: Text Tracking and Leading, Linked and MultiColumn, OpenType, etc. Getting Started with the Coding4Fun toolkit Tile Control WindowsPhoneGeek takes on the Tile control from the Coding4Fun toolkit... as usual, great tutorial... diagrams, code, explanation Using AppHarbor, Bitbucket and Mercurial with ASP.NET and Silverlight – Part 2 CouchDB, Cloudant and Hammock Erno de Weerd has Part 2 of his trilogy and he's trying to beat David Anson for the long title record :) ... in this episode, he's adding in cloud storage to the mix in a 35-step tutorial. Background Audio Jesse Liberty's talking about background Audio... and no not the Muzak in the elevator (do they still have that?) ... he's tlking about the WP7.1 BackgroundAudioPlayer Using the ToggleSwitch in WinRT/Metro (for C#) Derik Whittaker shows off the ToggleSwitch for WinRT/Metro... not a lot to be said about it, but he says it all :) Part 19 - Windows Phone 7 - Access Phone Contacts Sumit Dutta has Part 19! of his WP7 series up... talking today about getting a phone number from the directory using the PhoneNumberChooserTask ContextMenu using MVVM Asim Sajjad shows how to make the Context Menu ViewModel friendly in this short tutorial. Code to make call in Windows Phone 7 Dhananjay Kumar's latest WP7 post is explaining how to make a call programmatically using the PhoneCallTask launcher. Silverlight Page Navigation Framework - Basic Concept Kunal Chowdhury has a 3-part tutorial series on Silverlight Navigation up. This is the first in the series, and he hits the basics... what constitutes a Page, and how to get started with the navigation framework. How to Connect to and Diagram your SQL Express Database in Visual Studio LightSwitch Beth Massi's latest LightSwitch post is on using the Data Designer to easily crete and model database tables... during development this is in SQL Express, but can be deployed to most SQL server db you like Stay in the 'Light! Twitter SilverlightNews | Twitter WynApse | WynApse.com | Tagged Posts | SilverlightCream Join me @ SilverlightCream | Phoenix Silverlight User Group Technorati Tags: Silverlight    Silverlight 3    Silverlight 4    Windows Phone MIX10

  Read the article

• SQLAuthority News – SQL Server 2012 Upgrade Technical Guide – A Comprehensive Whitepaper – (454 pages – 9 MB)

  - by pinaldave

  Microsoft has just released SQL Server 2012 Upgrade Technical Guide. This guide is very comprehensive and covers the subject of upgrade in-depth. This is indeed a helpful detailed white paper. Even writing a summary of this white paper would take over 100 pages. This further proves that SQL Server 2012 is quite an important release from Microsoft. This white paper discusses how to upgrade from SQL Server 2008/R2 to SQL Server 2012. I love how it starts with the most interesting and basic discussion of upgrade strategies: 1) In-place upgrades, 2) Side by side upgrade, 3) One-server, and 4) Two-server. This whitepaper is not just pure theory but is also an excellent source for some tips and tricks. Here is an example of a good tip from the paper: “If you want to upgrade just one database from a legacy instance of SQL Server and not upgrade the other databases on the server, use the side-by-side upgrade method instead of the in-place method.” There are so many trivia, tips and tricks that make creating the list seems humanly impossible given a short period of time. My friend Vinod Kumar, an SQL Server expert, wrote a very interesting article on SQL Server 2012 Upgrade before. In that article, Vinod addressed the most interesting and practical questions related to upgrades. He started with the fundamentals of how to start backup before upgrade and ended with fail-safe strategies after the upgrade is over. He covered end-to-end concepts in his blog posts in simple words in extremely precise statements. A successful upgrade uses a cycle of: planning, document process, testing, refine process, testing, planning upgrade window, execution, verifying of upgrade and opening for business. If you are at Vinod’s blog post, I suggest you go all the way down and collect the gold mine of most important links. I have bookmarked the blog by blogging about it and I suggest that you bookmark it as well with the way you prefer. Vinod Kumar’s blog post on SQL Server 2012 Upgrade Technical Guide SQL Server 2012 Upgrade Technical Guide is a detailed resource that’s also available online for free. Each chapter was carefully crafted and explained in detail. Here is a quick list of the chapters included in the whitepaper. Before downloading the guide, beware of its size of 9 MB and 454 pages. Here’s the list of chapters: Chapter 1: Upgrade Planning and Deployment Chapter 2: Management Tools Chapter 3: Relational Databases Chapter 4: High Availability Chapter 5: Database Security Chapter 6: Full-Text Search Chapter 7: Service Broker Chapter 8: SQL Server Express Chapter 9: SQL Server Data Tools Chapter 10: Transact-SQL Queries Chapter 11: Spatial Data Chapter 12: XML and XQuery Chapter 13: CLR Chapter 14: SQL Server Management Objects Chapter 15: Business Intelligence Tools Chapter 16: Analysis Services Chapter 17: Integration Services Chapter 18: Reporting Services Chapter 19: Data Mining Chapter 20: Other Microsoft Applications and Platforms Appendix 1: Version and Edition Upgrade Paths Appendix 2: SQL Server 2012: Upgrade Planning Checklist Download SQL Server 2012 Upgrade Technical Guide [454 pages and 9 MB] Reference: Pinal Dave (http://blog.sqlauthority.com) Filed under: Database, DBA, PostADay, SQL, SQL Authority, SQL Documentation, SQL Download, SQL Query, SQL Server, SQL Tips and Tricks, SQL White Papers, SQLAuthority News, SQLServer, T SQL, Technology

  Read the article

• Silverlight Cream for June 21, 2011 -- #1110

  - by Dave Campbell

  In this Issue: Colin Eberhardt, Kunal Chowdhury(-2-), Peter Kuhn(-2-, -3-), Mike Gold, WindowsPhoneGeek, Nigel Sampson, Paul Sheriff, Dhananjay Kumar, and Erno de Weerd. Above the Fold: Silverlight: "Silverlight Debug Helper" Peter Kuhn3 WP7: "Metro In Motion #8 – AutoCompleteBox Reveal Animation" Colin Eberhardt Shoutouts: Check out the Top 5 from my friends at SilverlightShow from last week: SilverlightShow for June 13 - 19, 2011 From SilverlightCream.com: Metro In Motion #8 – AutoCompleteBox Reveal Animation Colin Eberhardt found yet another 'Metro In Motion' to duplicate... this one is the auto-complete effect seen in the WP7 email client... check out the video on the post! Windows Phone 7 (Mango) Tutorial - 16 - How to Create a WP7 Alarm Application? Kunal Chowdhury has a couple more of his Mango tutorials up... number 16 (!) is on creating an Alarm app using scheduled tasks. Windows Phone 7 (Mango) Tutorial - 17 - How to Create a WP7 Reminder Application? Kunal Chowdhury's latest is number 17 in the Mango series and he's discussing the Reminder class which is part of the Scheduler namespace. Silverlight Debug Helper Peter Kuhn has deployed a new version of his "Silverlight Debug Helper"... this time he's added support for FireFox and Chrome. Getting ready for the Windows Phone 7 Exam 70-599 (Part 3) Peter Kuhn also has Part 3 of his series posted at SilverlightShow on getting ready for the WP7 exam. XNA for Silverlight developers: Part 13 - Mango (2) Finally, Peter Kuhn's latest XNA for Silverlight developers tutorial is up at SilverlightShow and is the 2nd Mango post for game devs. Detecting Altitude using the WP7 Phone WindowsPhoneGeek apparently turned the reigns of his blog over to Mike Gold for this post about Altitude detection on the WP7. Windows Phone Mango: Getting Started with MVVM in 10 Minutes If you're out there and still haven't gotten your head around MVVM, or want to take another look at why you're beating yourself up doing it [ :) ]... WindowsPhoneGeek has a quick write-up on MVVM and WP7.1 apps Creating app promotional videos Nigel Sampson details how he uses Expression Encoder to produce the app videos he has on his blog for his WP7* apps. Sort Data in Windows Phone using Collection View Source Paul Sheriff's latest post is up, and is another WP7 post. This time on how to sort the data you consume by using a CollectionViewSource object in XAML and not write any code! Viewing Flickr Images on Windows 7.1 Phone or Mango Phone Dhananjay Kumar has a tutorial up for WP7.1 showing how to use the Flickr REST service to display images on your device. Windows Phone 7: Drawing graphics for your application with Inkscape – Part II: Icons Part 2 of Erno de Weerd's Trilogy on Drawing graphics for your WP7* apps in Inkscape is up... this tutorial is all about icons... good stuff! Stay in the 'Light! Twitter SilverlightNews | Twitter WynApse | WynApse.com | Tagged Posts | SilverlightCream Join me @ SilverlightCream | Phoenix Silverlight User Group Technorati Tags: Silverlight    Silverlight 3    Silverlight 4    Windows Phone MIX10

  Read the article

• Silverlight Cream for March 13, 2011 -- #1059

  - by Dave Campbell

  In this Issue: András Velvárt, WIndowsPhoneGeek(-2-), Jesse Liberty(-2-), Victor Gaudioso, Kunal Chowdhury, Jeremy Likness, Michael Crump, and Dhananjay Kumar. Above the Fold: Silverlight: "Application Library Caching in Silverlight 4" Kunal Chowdhury WP7: "Handling WP7 orientation changes via Visual States" András Velvárt Shoutouts: Joe McBride gave a MEF Head User Group presentation and has posted How to Become a MEF Head – Slides & Code From SilverlightCream.com: Handling WP7 orientation changes via Visual States András Velvárt has an Expression Blend/WP7 post up discussing WP7 orientation changes and handling them via Visual States ... see an example from his SurfCube app, and a behavior to handle the control... with source. WP7 PerformanceProgressBar in depth WIndowsPhoneGeek has a post up discussing the WP7 Performance bar from the Windows Phone Toolkit. This is an update on the Toolkit based on the Feb 2011 release. Great explanation of the PerformanceProgressBar, external links, and sample code. Getting data out of WP7 WMAppManifest is easy with Coding4Fun PhoneHelper Next WindowsPhoneGeek has a post up about the PhoneHelper in the Coding4Fun TOolkit, and using it to get data out of the WMAppManifest easily. Good discussion, Links, and code as always Silverlight Unit Test For Phone In Jesse Liberty's "Windows Phone From Scratch" number 41, he's discussing Unit Testing for WP7... he gives some good external links and some good examples. Yet Another Podcast #27–Paul Betts Jesse Liberty's next post is his "Yet Another Podcast" number 27, and an interview with Paul Betts, the creator of Reactive UI... check out the podcast and also the good links listed. New Silverlight Video Tutorial: How to use the Fluid Move Behavior Victor Gaudioso has a new video tutorial up on using the Fluid Move Behavior... making a selected item animate from a ListBox to a Master Details Grid. Application Library Caching in Silverlight 4 Kunal Chowdhury takes a break from SilverlightZone long enough to write a post about Application Library Caching... for example on-demand loading of a 3rd-party XAP. Jounce Part 13: Navigation Parameters Jeremy Likness has his 13th post of a series in understanding his Jounce MVVM framework up. This episode surrounds a new release and what it contains, the primary focus being navigation parameters... that is you can raise a navigation event with a payload. Profiling Silverlight Applications after installing Visual Studio 2010 Service Pack 1 Michael Crump digs into the performance wizard for Silverlight that we get with VS2010 SP1. He shows how to get and read a profile... great intro to a new tool. Binding XML File to Data Grid in Silverlight Dhananjay Kumar demonstrates reading an XML file using LINQ to XML and binding the result to a Silverlight DataGrid Stay in the 'Light! Twitter SilverlightNews | Twitter WynApse | WynApse.com | Tagged Posts | SilverlightCream Join me @ SilverlightCream | Phoenix Silverlight User Group Technorati Tags: Silverlight    Silverlight 3    Silverlight 4    Windows Phone MIX10

  Read the article

• Outsource Mechanical CAD Designs and Drafting Services to Indian CAD Firms

  Mechanical engineering is the most functional disciple among all branches of engineering industry. It has a great role in the development of the man-machine relationship and the growth of industrial ... [Author: Dillip Kumar Barik - Computers and Internet - April 05, 2010]

  Read the article

• Sharing and previewing Google Docs in Socialwok: Google Data APIs

  Editor's note: Navin Kumar is CTO and co-founder of Socialwok, a feed-based group collaboration application for enterprises that integrates with Google Apps. With Socialwok, Google Apps users can...

  Read the article

• Silverlight Cream for March 07, 2011 -- #1055

  - by Dave Campbell

  In this Issue: Max Paulousky, Chris Rouw, David Anson, Jesse Liberty, Shawn Wildermuth, Simon Guindon, and Dhananjay Kumar. Above the Fold: Silverlight: "Faster Databinding in WPF and Silverlight using OptimizedObservableCollection" Simon Guindon WP7: "Phoney Tools Updated (WP7 Open Source Library)" Shawn Wildermuth From SilverlightCream.com: Problems With Sharing Windows Phone 7 Applications Within A Large Group Of Beta Testers Max Paulousky has a post up discussing the issues surrounding beta testing a WP7 app with a large group of testers... and how to pull it all off. WP7 Insights #1: Consuming REST APIs within a WP7 app Chris Rouw is beginning a WP7 series based on his recent experience of getting a client's app into the marketplace. This first in his series is on consuming REST APIs ... lots of good code and explanations. Improving Windows Phone 7 application performance is even easier with these LowProfileImageLoader and DeferredLoadListBox updates David Anson has an update to his LowProfileImageLoader and DeferredLoadListBox after issues brought up by readers... so we all win with the great feedback from alert devs. When Isolated Storage Isn’t Enough Jesse Liberty started looking at Jeremy Likness' Sterling with this post in the WP7 From Scratch series. He starts with downloading it from CodePlex ... great way to get into Sterling if you haven't already. Phoney Tools Updated (WP7 Open Source Library) Shawn Wildermuth has the latest drop of his Phoney Tools up... this is the last Alpha. I've added a tag for it as well. He's fixed some things, added others... check out the post and go grab the code. Faster Databinding in WPF and Silverlight using OptimizedObservableCollection Simon Guindon is a blogger I've not been following, but this post on an OptimizedObservableCollection caught my eye. He added an AddRange() to the ObservableCollection to get a speed enhancement when adding items... and a pretty good speed enhancement it is. Reading files asynchronously using WebClient class in Silverlight Dhananjay Kumar is another prolific blogger that I've not been following, so we'll start with his latest... a step-by-step guide to reading an XML file asynchronously. Stay in the 'Light! Twitter SilverlightNews | Twitter WynApse | WynApse.com | Tagged Posts | SilverlightCream Join me @ SilverlightCream | Phoenix Silverlight User Group Technorati Tags: Silverlight    Silverlight 3    Silverlight 4    Windows Phone MIX10

  Read the article

• Triple-DES encryption in android.

  - by Raj

  Hi, i am new to android and planning to use Triple-DES encryption to encrypt data and store it into the DataBase in my android application. the thing is if i try to use DES or Triple DES its giving Hexadecimal encrypted string. But i need some encrypted value which looks like my previous value. i have 3 kinds of variables to encrypt. those are String,numeric and Date type variables. My requirement is if i encrypt a date type, i need to get the cipher text looks like date. So can any one suggest with an example to impliment and encryption technique.

  Read the article

< Previous Page | 7 8 9 10 11 12 13 14 15 16 17 18  | Next Page >