Search Results

Search found 55188 results on 2208 pages for 'text based'.

Page 114/2208 | < Previous Page | 110 111 112 113 114 115 116 117 118 119 120 121  | Next Page >

  • route to vpn based on destination

    - by inquam
    I have a VPN connection on a Windows 7 machine. It's set up to connect to a server in US. Is it possible, and if so how, to setup so that .com destinations uses the vpn interface and .se destinations uses the "normal" connection? Edit (clarification): This is for outbound connections. I.e. the machine conencts to a server on foo.com and uses the VPN and the machine connects to bar.se and uses the "normal" interface. Let's say foo.com has an IP filter that ensures users are located in USA, if I go through the VPN I get a US ip and everything is fine. But tif all traffic goes this way the bar.se server that has a IP filter ensuring users are in Sweden will complain. So I want to route the traffic depending on server location. US servers through VPN and others through the normal interface.

    Read the article

  • Text on Cisco ASA console is garbled/missing letters

    - by Some Linux Nerd
    I've actually looked up a number of solutions for this problem and none of them work. There's this Cisco ASA 5505 that I'd like to use, that outputs mildly garbled text with missing characters. I did some googling and found that the most likely problem is a bad baud rate, so I tried all the baud rates, 7N1, 8N2... basically every possibility minicom had. Then I figured (since I can type ok, just not read) that if I factory reset it that it would fix whatever is set wrong with the terminal. That didn't work either. This usb-db9 adapter and console cable work fine on the catalyst switch in our office. My serial settings are 9600 8N1 with no flow control. Anyone know how to fix this? I have an example of the text on pastebin: http://pastebin.com/MAJF0mVU - it's just lots of "Dfaut cnfiuraionfil cotais 1enty." instead of "Default configuration blah blah"

    Read the article

  • SQL Server 2008 R2 Writing To Text File

    - by zzzzzzzzzzzzzzzzzzzzzzzzzzzzzz
    I used to write to text files from SQL Server using the code listed below: DECLARE @FS INT --File System Object DECLARE @OLEResult INT --Result message/code DECLARE @FileID INT --Pointer to file --Create file system object (OLE Object) EXECUTE @OLEResult = sp_OACreate 'Scripting.FileSystemObject', @FS OUT IF @OLEResult <> 0 PRINT 'Scripting.FileSystemObject.Failed' -----OPEN FILE----- EXECUTE @OLEResult = sp_OAMethod @FS, 'OpenTextFile', @FileID OUT, @FileName, 8, 1 IF @OLEResult <> 0 PRINT 'OpenTextFile.Failed' It appears this is no longer supported in sql server 2008 r2. How should I export to text files in sql server 2008 r2? Link claiming this is no longer supported: http://social.msdn.microsoft.com/Forums/en/transactsql/thread/f8512bec-915c-44a2-ba9d-e679f98ba313

    Read the article

  • Date based sum in Excel / Google Docs spreadsheets

    - by alumb
    I have a bunch of rows with a date and a dollar amount (expenses). I want to produce a list of the days of the month and what the balance of the expenses is. So, for example the 5th entry in the list would be 8/5/2008 and the sum of all the expenses that occurred on or before 8/5/2008. Approximately this is =sumif(D4:D30-A5,">0",E4:E30) but of course that doesn't work (where the source data is dates in D4:D30 and the expenses are in E4:E30). Notes source data can't be sorted for various reasons. must work in google spreadsheets, which is a fairly complete subset of excel's functions.

    Read the article

  • Determine display or VNC session based on PID

    - by Daniel Kessler
    I frequently VNC into a server where we run many concurrent computationally intensive matlab processes. Sometimes, one of my processes misbehave, which I can see from top, but I have a hard time figuring out which VNC session it's running on, or more specifically, which display it's running on. Suppose I see that PID 8536 looks like a resource hog, and I want to investigate. Because it's a matlab session, I know there is likely an IDE open somewhere, and I want to check to see if anything important is happening before I kill it. We've solved this somewhat awkwardly in the past by identifying which PTY 8536 was launched from, then looking at a process tree to figure out things launched in that context, scrolling up, and seeing the VNC initialization. Seems like there must be a better way to go PID - X Display (or VNC Session).

    Read the article

  • Apache Request IP Based Security

    - by connec
    I run an Apache server on my home system that I've made available over the internet as I'm not always at my home system. Naturally I don't want all my home server files public, so until now I've simply had: Order allow, deny Deny from all Allow from 127.0.0.1 in my core configuration and just Allow from all in the htaccess of any directories I wanted publicly viewable. However I've decided a better system would be to centralise all the access control and just require authentication (HTTP basic) for requests not to 127.0.0.1/localhost. Is this achievable with Apache/modules? If so how would I go about it? Cheers.

    Read the article

  • Network based on Netgear FVS318 extremely slow

    - by Fentible
    A network I maintain uses an FVS318 as a router, with a separate switch. Communication within the network is slow. Out to the internet is even slower. As it stands there is one patch from the FVS to the switch and no other devices directly connected to the FVS because any that are run so slowly they might as well not be connected to the network. Swapping in a bog-standard home router dramatically increases network speed, but that's not a viable solution because some of the enterprise features of the FVS are required. There are quite a few complaints about this on the Netgear forum, but Netgear support have not been forthcoming with any help - so I turn to you all: any ideas?

    Read the article

  • How to filter Varnish logs based on XID?

    - by Martijn Heemels
    I'm running into infrequent 503 errors which appear hard to pinpoint. Varnishlog is driving me mad, since I can't seem to get the information I want out of it. I'd like to see both the client- and backend-communications as seen by Varnish. I thought the XID number, which is logged on Varnish's default error page, would allow me to filter the exact request out of the logging buffer. However, no combination of varnishlog parameters gives me the output I need. The following only shows the client-side communication: varnishlog -d -c -m ReqStart:1427305652 while this only shows the resulting backend communication: varnishlog -d -b -m TxHeader:1427305652 Is there a one-liner to show the entire request?

    Read the article

  • Converting PDF portfolios to plain text (pdftotext?)

    - by Andrea
    I am trying to convert a large number of PDFs (~15000) to plain text using pdftotext. This is working pretty well except for a few of the PDFs (~600) which, I guess, are "PDF portfolios." When I run these PDFs through pdftotext, it just outputs: For the best experience, open this PDF portfolio in Acrobat 9 or Adobe Reader 9, or later. Get Adobe Reader Now! If I do open these PDFs in Adobe Reader, they look like two or more PDFs inside a single file. Has anyone encountered this issue before? Is there any tool I can use to convert these PDFs automatically? (Either directly to text or at least to regular PDFs that pdftotext can then understand.)

    Read the article

  • Configure PL2303-based USB-to-RS232 adapter to stay awake when no active device is present

    - by casualuser
    I am resurrecting some X10 devices with the aid of a USB-to-RS232 adapter. The problem is, that the adapter only works with the Firecracker device when there is another serial device on the line (the Firecracker is a pass-through device that monitors the RTS and DTR lines to do its magic). Is the PL2303 going to sleep without a real device on the line? Is there an option or command to keep it awake? Is there a cable configuration that would make it work without a real serial device present?

    Read the article

  • Excel 2010: dynamic update of drop down list based upon datasource validation worksheet changes

    - by hornetbzz
    I have one worksheet for setting up the data sources of multiple data validation lists. in other words, I'm using this worksheet to provide drop down lists to multiple other worksheets. I need to dynamically update all worksheets upon any of a single or several changes on the data source worksheet. I may understand this should come with event macro over the entire workbook. My question is how to achieve this keeping the "OFFSET" formula across the whole workbook ? Thx To support my question, I put the piece of code that I'm trying to get it working : Provided the following informations : I'm using such a formula for a pseudo dynamic update of the drop down lists, for example : =OFFSET(MyDataSourceSheet!$O$2;0;0;COUNTA(MyDataSourceSheet!O:O)-1) I looked into the pearson book event chapter but I'm too noob for this. I understand this macro and implemented it successfully as a test with the drop down list on the same worksheet as the data source. My point is that I don't know how to deploy this over a complete workbook. Macro related to the datasource worksheet : Option Explicit Private Sub Worksheet_Change(ByVal Target As Range) ' Macro to update all worksheets with drop down list referenced upon ' this data source worksheet, base on ref names Dim cell As Range Dim isect As Range Dim vOldValue As Variant, vNewValue As Variant Dim dvLists(1 To 6) As String 'data validation area Dim OneValidationListName As Variant dvLists(1) = "mylist1" dvLists(2) = "mylist2" dvLists(3) = "mylist3" dvLists(4) = "mylist4" dvLists(5) = "mylist5" dvLists(6) = "mylist6" On Error GoTo errorHandler For Each OneValidationListName In dvLists 'Set isect = Application.Intersect(Target, ThisWorkbook.Names("STEP").RefersToRange) Set isect = Application.Intersect(Target, ThisWorkbook.Names(OneValidationListName).RefersToRange) ' If a change occured in the source data sheet If Not isect Is Nothing Then ' Prevent infinite loops Application.EnableEvents = False ' Get previous value of this cell With Target vNewValue = .Value Application.Undo vOldValue = .Value .Value = vNewValue End With ' LOCAL dropdown lists : For every cell with validation For Each cell In Me.UsedRange.SpecialCells(xlCellTypeAllValidation) With cell ' If it has list validation AND the validation formula matches AND the value is the old value If .Validation.Type = 3 And .Validation.Formula1 = "=" & OneValidationListName And .Value = vOldValue Then ' Debug ' MsgBox "Address: " & Target.Address ' Change the cell value cell.Value = vNewValue End If End With Next cell ' Call to other worksheets update macros Call Sheets(5).UpdateDropDownList(vOldValue, vNewValue) ' GoTo NowGetOut Application.EnableEvents = True End If Next OneValidationListName NowGetOut: Application.EnableEvents = True Exit Sub errorHandler: MsgBox "Err " & Err.Number & " : " & Err.Description Resume NowGetOut End Sub Macro UpdateDropDownList related to the destination worksheet : Sub UpdateDropDownList(Optional vOldValue As Variant, Optional vNewValue As Variant) ' Debug MsgBox "Received info for update : " & vNewValue ' For every cell with validation For Each cell In Me.UsedRange.SpecialCells(xlCellTypeAllValidation) With cell ' If it has list validation AND the validation formula matches AND the value is the old value ' If .Validation.Type = 3 And .Value = vOldValue Then If .Validation.Type = 3 And .Value = vOldValue Then ' Change the cell value cell.Value = vNewValue End If End With Next cell End Sub

    Read the article

  • Macvlan based interface pings from host but not from namespace

    - by jtlebi
    My setup: Private network vboxnet1 10.0.7.0/24 1 Host, ubuntu desktop 1 VM, ubuntu server (VirtualBox) Adressing layout: HOST: 10.0.7.1 VM: 10.0.7.101 VM MAC NAMESPACE: 10.0.7.102 On the VM, I ran the following commands: ip netns add mac # create a new nmespace ip link add link eth0 mac0 type macvlan # create a new macvlan interface ip link set mac0 netns mac On the mac namespace, inside the VM: ip link set lo up ip link set mac up ip addr add 10.0.7.102/24 dev mac0 So that we basically end up with: (Like Inception ?) +------------------------+ | Host: 10.0.7.1 | | | | +--------------------+ | | | VM: 10.0.7.101 | | | | | | | | +----------------+ | | | | | NS: 10.0.7.102 | | | | | | | | | | | +----------------+ | | | +--------------------+ | +------------------------+ What works: Ping between Host and VM Ping between NS and NS dhclient from NS What does not work: ping between NS and VM ping between NS and Host Where I started to go nuts: tcpdump on host (the real machine) actually shows ARP request AND replies tcpdump on NS shows ARP requests sent to the host tcpdump on VM makes the whole mess work (!) -- ping starts to get answers when tcpdump is started on the VM ?!? So, I bet you were eager for it, my question is: how to I make it work ? I suspect something's wrong with ARP on the macvlan inside the NS but can't figure out what exactly... Btw, I did the same expérimentations with the mac0 interface directly on the VM (no namespace) and it worked flawlessly.

    Read the article

  • nagios ldap-group based front end login permission issues

    - by Eleven-Two
    I want to grant users access to the nagios 3 core frontend by using an active directory group ("NagiosWebfrontend" in the code below). The login works fine like this: AuthType Basic AuthName "Nagios Access" AuthBasicProvider ldap AuthzLDAPAuthoritative on AuthLDAPURL "ldap://ip-address:389/OU=user-ou,DC=domain,DC=tld?sAMAccountName?sub?(objectClass=*)" AuthLDAPBindDN CN=LDAP-USER,OU=some-ou,DC=domain,DC=tld AuthLDAPBindPassword the_pass Require ldap-group CN=NagiosWebfrontend,OU=some-ou,DC=domain,DC=tld Unfortunately, every nagios page just shows "It appears as though you do not have permission to view information for any of the services you requested...". I got the hint, that I am missing a contact in nagios configuration which is equal to my login, but creating one with the same name as the domain user had no effect on this issue. However, it would be great to find a solution without manually editing nagios.conf for every new user, so the admins could grant access to nagios by just putting the user to "NagiosWebfrontend" group. What would be the best way to solve it?

    Read the article

  • Windows server 2008 - Access Based Enumeration (ABE) not working correctly

    - by Napster100
    I have a folder shared with permissions of only one user account, admin account and admin group having access to it, but when I open the shared area from a second user account which dose not have access to it, the folder is still visible to the second account despite ABE being enabled on it and all other parent directories/folders and even the the drive. The user can't access the shared folder (which is what I want), but I'd like the folder to also be invisible to that user, just to make it look cleaner and theirs no confusion between what they can access and what they cannot. How would I stop the folder appearing for users who don't have permissions to use it? Thanks in advanced. EDIT: I've just added the second user account to the permissions list but denied it access so that the account definitely has no permissions to access it in any way but that's still not hiding it.

    Read the article

  • Running out of space on a SAS-based workstation

    - by SteveWilkinson
    Hi - first question on serverfault - pls excuse if asked elsewhere. I have a Dell Precision 690 with one 73GB (15000RPM) SAS drive in it. Running Windows 7 (x64) with a bunch of apps means it is running out of space. I have on order a 147GB (15000RPM) SAS drive (same GB/s, same make) which I want to put into the machine. Not knowing anything about SAS, do I need to replace the 73GB with the 147GB and restore from a backup, or can I put the drive in the machine and get the controller to treat the two drives as one large one? (The original paperwork for the machine says 73GB SAS (No RAID) if that is relevant.) Thanks in advance.

    Read the article

  • Running out of space on a SAS-based workstation

    - by SteveWilkinson
    Hi - first question on serverfault - pls excuse if asked elsewhere. I have a Dell Precision 690 with one 73GB (15000RPM) SAS drive in it. Running Windows 7 (x64) with a bunch of apps means it is running out of space. I have on order a 147GB (15000RPM) SAS drive (same GB/s, same make) which I want to put into the machine. Not knowing anything about SAS, do I need to replace the 73GB with the 147GB and restore from a backup, or can I put the drive in the machine and get the controller to treat the two drives as one large one? (The original paperwork for the machine says 73GB SAS (No RAID) if that is relevant.) Thanks in advance.

    Read the article

  • Replace special text with sed?

    - by user143822
    I'm using CMD on Windows Xp to replace special text with Sed. I'm using this command for replace special characters like $ or * : sed -i "s/\*/123/g;" 1.txt But how command must i use to replace this strings with ciao! in my text files? Is possible? \\ \\\ "" sed.exe -i "s/{\*)(//123/ sed -i "s/\\/123/g;" 1.txt the previous command does not work because i have \, " and other special strings that sed use to make regex.

    Read the article

  • Mixed IP and Name Based Virtual Hosts with nginx

    - by nerkn
    I set up many domains but I dont know how to configure if only ip address is given. say foo.com I have a setup to go web/foo.com/htdocs, I want to 88.99.66.55 ip address like a domain to web/fook.com/htdocs server { listen 80; server_name 85.99.66.55; location / { root /home/web/fook.com/htdocs; } location ~ \.(php|php3|php4|php5)$ { root /home/web/fook.com/htdocs; include fastcgi_params; fastcgi_pass 127.0.0.1:9000; } } resulted [warn]: conflicting server name "85.105.65.219" on 0.0.0.0:80, ignored

    Read the article

  • Key based authentication (SFTP) failed

    - by rahularyansharma
    I created a pair or RSA keys using Putty key generator, The Public key is attached set on the server side. The private key at windows client machine and being used with pageant and FileZila and working fine. Now Problem is that when I want to connect same sftp through PSFTP commandline tool, it failes. if possible please provide steps to setup ssh key on windows client to access sftp using psftp or direct through batch file.

    Read the article

  • Any Windows based OpenID servers out there? [closed]

    - by Brian Knoblauch
    I've been looking to setup an OpenID server for a special project, but haven't found any workable OpenID server software packages. Originally was looking for a *nix solution, and found several, but they all had some kind of issue. So far I've tried JOIDS, community-id, and a couple others I unfortunately can't remember the names of. I've also come to the conclusion that even if I had managed to get one of those going that the management/upgrade cycles would have placed undue burden on the company (only a couple part time sysadmins with *nix knowledge, the day to day people are primarily Windows). So, I'm hoping that there's a Windows one out that will be functional that someone knows about and will be easy for a minimal support environment...

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • Record Matching Software to Compare two tables and match on % Based

    - by Crazyd
    So I have some table with Name, Address, and Zip with no record data attached; and I have a table which has all the same, but has more information and I need a way to merge the tables when they don't match 100%. How do I match them up if they aren't Identical? I'm a newb @ SQL, but I know they won't match up for the most part and I can't be the only one with this issue. However software which will do this has proven to be difficult. Writing software to do this would even be worse than having to do it in the first place. I know I can do this in excel; kinda, but with the amount of records I have its proving to be difficult over a million.

    Read the article

  • Create text file named after a cell containing other cell data

    - by user143041
    I tried using the code below for the Excel program on my `Mac Mini using the OS X Version 10.7.2 and it keeps saying Error due to file name / path: (The Excel file I am creating is going to be a template with my formulas and macros installed which will be used over and over). Sub CreateFile() Do While Not IsEmpty(ActiveCell.Offset(0, 1)) MyFile = ActiveCell.Value & ".txt" fnum = FreeFile() Open MyFile For Output As fnum Print #fnum, ActiveCell.Offset(0, 1) & " " & ActiveCell.Offset(0, 2) Close #fnum ActiveCell.Offset(1, 0).Select Loop End Sub What Im trying to do: 1st Objective I would like to have the following data to be used to create a text file. A:A is what I need the name of the file to be. B:2 is the content I need in the text file. So, A2 - "repair-video-game-Glassboro-NJ-08028.txt" is the file name and B2 to be the content in the file. Next, A3 is the file name and B3 is the content for the file, etc. ONCE the content reads what is in cell A16 and B16 (length will vary), the file creation should stop, if not then I can delete the additional files created. This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? 2nd Objective I would like to have the following data to be used to create a text file. A:1 is what I need the name of the file to be. B:B is the content I want in the file. So, A2 - is the file name "geo-sitemap.xml" and B:B to be the content in the file (ignore the .xml file extension in the photo). ONCE the content cell reads what is in cell "B16" (length will vary), the file creation should stop, if not then I can adjust the cells that have need content (formulated content you see in the image is preset for 500 rows). This sheet will never change. Is there a way to establish the excel macro to always go to this sheet instead of have to select it with the mouse to identify the starting point? I can Provide the content in the cells that are filled in by excel formulas that are not not to be included in the .txt files. It is ok if it is not possible. I can delete the extra cells that are not populated (based on the data sheet). Please let me know if you need any more additional information or clarity and I will be happy to provide it.

    Read the article

  • re-direct SSL pages using header statement based on port

    - by bob's your brother
    I found this in the header.php file of a e-commerce site. Is this better done in a .htaccess file. Also what would happen to any post parameters that get caught in the header statement. // flip between secure and non-secure pages $uri = $_SERVER['REQUEST_URI']; // move to secure SSL pages if required if (substr($uri,1,12) == "registration") { if($_SERVER['SERVER_PORT'] != 443) { header("HTTP/1.1 301 Moved Permanently"); header("Location: https://".$_SERVER['HTTP_HOST'].$_SERVER['REQUEST_URI']); exit(); } } // otherwise us regular non-SSL pages else { if($_SERVER['SERVER_PORT'] == 443) { header("HTTP/1.1 301 Moved Permanently"); header("Location: http://".$_SERVER['HTTP_HOST'].$_SERVER['REQUEST_URI']); exit(); } }

    Read the article

  • Lighttpd based server issues crop up when port forwarding

    - by michael
    I have four host computers running lighttpd webservers. they are sitting behind a hspa modem, which each occupying a http port between [81 - 84]. 80 is taken by the modem itself. The port forwarding is setup correctly, however, only a portion of any webpage I request from any of the hosts comes through (they all fails after %20 of the page). If I put the host on port 81 into the dmz, it serves pages fine. The others do not respond to the dmz treatment. Is it possible the web content on the hosts somehow require ports aside from their respective http port? Or is it possible that even though the server.port in the lighttpd_ssl.conf file is set, the individual hosts are still expecting to serve on port 80? I am not familiar with lighttpd, nor did i set them up. they are running on video encoders i purchased. I can grab any files from them required for further information on the problem.

    Read the article

< Previous Page | 110 111 112 113 114 115 116 117 118 119 120 121  | Next Page >