Search Results

Search found 13004 results on 521 pages for 'pretty printing'.

Page 117/521 | < Previous Page | 113 114 115 116 117 118 119 120 121 122 123 124  | Next Page >

  • sql query question

    - by bu0489
    hey guys, just having a bit of difficulty with a query, i'm trying to figure out how to show the most popular naturopath that has been visited in a centre. My tables look as follows; Patient(patientId, name, gender, DoB, address, state,postcode, homePhone, businessPhone, maritalStatus, occupation, duration,unit, race, registrationDate , GPNo, NaturopathNo) and Naturopath (NaturopathNo, name, contactNo, officeStartTime, officeEndTime, emailAddress) now to query this i've come up with SELECT count(*), naturopathno FROM dbf10.patient WHERE naturopathno != 'NULL' GROUP BY naturopathno; which results in; COUNT(*) NATUROPATH 2 NP5 1 NP6 3 NP2 1 NP1 2 NP3 1 NP7 2 NP8 My question is, how would I go about selecting the highest count from this list, and printing that value with the naturopaths name? Any suggestions are very welcome, Brad

    Read the article

  • Purpose of Trigraph sequences in C++?

    - by Kirill V. Lyadvinsky
    According to C++'03 Standard 2.3/1: Before any other processing takes place, each occurrence of one of the following sequences of three characters (“trigraph sequences”) is replaced by the single character indicated in Table 1. ---------------------------------------------------------------------------- | trigraph | replacement | trigraph | replacement | trigraph | replacement | ---------------------------------------------------------------------------- | ??= | # | ??( | [ | ??< | { | | ??/ | \ | ??) | ] | ??> | } | | ??’ | ˆ | ??! | | | ??- | ˜ | ---------------------------------------------------------------------------- In real life that means that code printf( "What??!\n" ); will result in printing What| because ??! is a trigraph sequence that is replaced with the | character. My question is what purpose of using trigraphs? Is there any practical advantage of using trigraphs? UPD: In answers was mentioned that some European keyboards don't have all the punctuation characters, so non-US programmers have to use trigraphs in everyday life? UPD2: Visual Studio 2010 has trigraph support turned off by default.

    Read the article

  • Two '==' equality operators in same 'if' condition are not working as intended.

    - by Manav MN
    I am trying to establish equality of three equal variables, but the following code is not printing the obvious true answer which it should print. Can someone explain, how the compiler is parsing the given if condition internally? #include<stdio.h> int main() { int i = 123, j = 123, k = 123; if ( i == j == k) printf("Equal\n"); else printf("NOT Equal\n"); return 0; } Output: manav@workstation:~$ gcc -Wall -pedantic calc.c calc.c: In function ‘main’: calc.c:5: warning: suggest parentheses around comparison in operand of ‘==’ manav@workstation:~$ ./a.out NOT Equal manav@workstation:~$ EDIT: Going by the answers given below, is the following statement okay to check above equality? if ( (i==j) == (j==k))

    Read the article

  • How should I change my Graph structure (very slow insertion)?

    - by Nazgulled
    Hi, This program I'm doing is about a social network, which means there are users and their profiles. The profiles structure is UserProfile. Now, there are various possible Graph implementations and I don't think I'm using the best one. I have a Graph structure and inside, there's a pointer to a linked list of type Vertex. Each Vertex element has a value, a pointer to the next Vertex and a pointer to a linked list of type Edge. Each Edge element has a value (so I can define weights and whatever it's needed), a pointer to the next Edge and a pointer to the Vertex owner. I have a 2 sample files with data to process (in CSV style) and insert into the Graph. The first one is the user data (one user per line); the second one is the user relations (for the graph). The first file is quickly inserted into the graph cause I always insert at the head and there's like ~18000 users. The second file takes ages but I still insert the edges at the head. The file has about ~520000 lines of user relations and takes between 13-15mins to insert into the Graph. I made a quick test and reading the data is pretty quickly, instantaneously really. The problem is in the insertion. This problem exists because I have a Graph implemented with linked lists for the vertices. Every time I need to insert a relation, I need to lookup for 2 vertices, so I can link them together. This is the problem... Doing this for ~520000 relations, takes a while. How should I solve this? Solution 1) Some people recommended me to implement the Graph (the vertices part) as an array instead of a linked list. This way I have direct access to every vertex and the insertion is probably going to drop considerably. But, I don't like the idea of allocating an array with [18000] elements. How practically is this? My sample data has ~18000, but what if I need much less or much more? The linked list approach has that flexibility, I can have whatever size I want as long as there's memory for it. But the array doesn't, how am I going to handle such situation? What are your suggestions? Using linked lists is good for space complexity but bad for time complexity. And using an array is good for time complexity but bad for space complexity. Any thoughts about this solution? Solution 2) This project also demands that I have some sort of data structures that allows quick lookup based on a name index and an ID index. For this I decided to use Hash Tables. My tables are implemented with separate chaining as collision resolution and when a load factor of 0.70 is reach, I normally recreate the table. I base the next table size on this http://planetmath.org/encyclopedia/GoodHashTablePrimes.html. Currently, both Hash Tables hold a pointer to the UserProfile instead of duplication the user profile itself. That would be stupid, changing data would require 3 changes and it's really dumb to do it that way. So I just save the pointer to the UserProfile. The same user profile pointer is also saved as value in each Graph Vertex. So, I have 3 data structures, one Graph and two Hash Tables and every single one of them point to the same exact UserProfile. The Graph structure will serve the purpose of finding the shortest path and stuff like that while the Hash Tables serve as quick index by name and ID. What I'm thinking to solve my Graph problem is to, instead of having the Hash Tables value point to the UserProfile, I point it to the corresponding Vertex. It's still a pointer, no more and no less space is used, I just change what I point to. Like this, I can easily and quickly lookup for each Vertex I need and link them together. This will insert the ~520000 relations pretty quickly. I thought of this solution because I already have the Hash Tables and I need to have them, then, why not take advantage of them for indexing the Graph vertices instead of the user profile? It's basically the same thing, I can still access the UserProfile pretty quickly, just go to the Vertex and then to the UserProfile. But, do you see any cons on this second solution against the first one? Or only pros that overpower the pros and cons on the first solution? Other Solution) If you have any other solution, I'm all ears. But please explain the pros and cons of that solution over the previous 2. I really don't have much time to be wasting with this right now, I need to move on with this project, so, if I'm doing to do such a change, I need to understand exactly what to change and if that's really the way to go. Hopefully no one fell asleep reading this and closed the browser, sorry for the big testament. But I really need to decide what to do about this and I really need to make a change. P.S: When answering my proposed solutions, please enumerate them as I did so I know exactly what are you talking about and don't confuse my self more than I already am.

    Read the article

  • Why am I not getting the expected results with fread() in C?

    - by mauvehead
    Here is my code: #include <stdio.h> int main(void) { FILE *fp; unsigned int i; char bytes[512]; fp = fopen("myFile","r"); for(i = 0;i <= 512;i++) { fread(&bytes, sizeof(bytes), 1, fp); printf("bytes[%d]: %x\n", i, bytes[i]); } } Here is the expected output $ hexdump myFile 0000000 aa55 aa55 0060 0000 0a17 0000 b1a5 a2ea 0000010 0000 0000 614c 7563 616e 0000 0000 0000 0000020 0000 0000 0a68 0000 1001 421e 0000 0000 0000030 f6a0 487d ffff ffff 0040 0000 002f 0000 But here is what I see from my program bytes[0]: 55 bytes[1]: 8 bytes[2]: ffffffc8 bytes[3]: ffffffdd bytes[4]: 22 bytes[5]: ffffffc8 bytes[6]: ffffff91 bytes[7]: 63 bytes[8]: ffffff82 My obvious guess is that I'm either addressing something incorrectly and receiving the wrong data back or I am printing it incorrectly and viewing it the wrong way.

    Read the article

  • Add characters to month loop?

    - by JM4
    I currently have a php loop running exactly how I need it with proper validations (in both php and javascript) with one exception, if the month is less than 2 digits, (i.e. 1,2,3,4), I need for a '0' to appear before: 01 - January 02 - February ... 10 - October My code for the loop is currently: <select name="Month"> <option value="">Month</option> <?php for ($i=1; $i<=12; $i++) { echo "<option value='$i'"; if ($fields["Month"] == $i) echo " selected"; echo ">$i</option>"; } ?> </select> any ideas? Also note, this month date is being stored in session, not interested in printing to screen

    Read the article

  • PostScript versus PDF as an output format

    - by Brecht Machiels
    I'm currently writing a typesetting application and I'm using PSG as the backend for producing postscript files. I'm now wondering whether that choice makes sense. It seems the ReportLab Toolkit offers all the features PSG offers, and more. ReportLab outputs PDF however. Advantages PDF offers: transparancy better support for character encodings (Unicode, for example) ability to embed TrueType and even OpenType fonts hyperlinks and bookmarks Is there any reason to use Postscript instead of directly outputting to PDF? While Postscript is a full programming language as opposed to PDF, as a basic output format for documents, that doesn't seem to offer any advantage. I assume a PDF can be readily converted to PostScript for printing? Some useful links: Wikipedia: PDF Adobe: PostScript vs. PDF

    Read the article

  • .NET Excel Interop - Why aren't my Footers displaying in my printed output file?

    - by Ryan
    I'm working with C# and Office 2007's Excel Interop API. I'm opening an Excel file, applying some formatting and then sending it to the printer. I've got a problem, though. The Footer text doesn't appear to be printing. If I check the PageSetup.RightFooter property, I can see the expected Page Number in the Footer. That Page Number doesn't appear anywhere on the printed output sheet. When I print using Excel, though, they appear. Does anyone know why my Footer text is not appearing? Here's my code. Pastebin of my C# code

    Read the article

  • How to Ignore certain tags and replace texts in PHP

    - by Aakash Chakravarthy
    Hello, I have a variable like $content = "Lorem Ipsum is simply <b>dummy text of the printing</b> and typesetting industry. Lorem Ipsum has been the industry's <i>standard dummy text</i> ever since the 1500s <string>javascriptFunc();</script>" ; when i use str_replace('a', '', $content); all the 'a's get removed. But the 'a's within the <script> tag should not be removed. or is there any way to replace text other than this method Please help .

    Read the article

  • RDLC item width is dynamic and causing extra pages to be generated (image included)?

    - by Paul Mendoza
    I'm trying to format an RDLC report file in Visual Studio 2008 and I am having a formatting issue. I have a list at the bottom that contains a matrix that expands horizontally to the right. That pink box is just to visualize the problem I'm having. When the report is rendered the matrix expands and instead of filling the pink box with the matrix is pushes the space in the pink box to the right resulting in an extra page when printing the reports. One solution would be to shrink the pink box to be the size of the matrix which I've done. But then when the matrix grows the fields at the top of the report get pushed to the right by the same amount as the growth of the matrix. Can someone please let me know what they think the solution would be? Thank you!

    Read the article

  • Executing certain code for every method call in C++

    - by Luís Guilherme
    I have a C++ class I want to inspect. So, I would like to all methods print their parameters and the return, just before getting out. The latter looks somewhat easy. If I do return() for everything, a macro #define return(a) cout << (a) << endl; return (a) would do it (might be wrong) if I padronize all returns to parenthesized (or whatever this may be called). If I want to take this out, just comment out the define. However, printing inputs seems more difficult. Is there a way I can do it, using C++ structures or with a workaroud hack?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • QT clicked signal dosnt work on QStandardItemModel with tree view

    - by user63898
    Hello i have this code in QT and all i want to to catch the clicked event when some one clicking in one of the treeview rows without success here is my code: (parant is the qMmainwindow) m_model = new QStandardItemModel(0, 5, parent); // then later in the code i have proxyModel = new QSortFilterProxyModel; proxyModel->setDynamicSortFilter(true); setSourceModel(createMailModel(parent)); ui.treeView->setModel(proxyModel); ui.treeView->setSortingEnabled(true); ui.treeView->sortByColumn(4, Qt::DescendingOrder); // and my signal/slot looks like this but its not working //and im not getting eny clicked event fired connect(ui.treeView,SIGNAL(Clicked(const QModelIndex& ) ), this,SLOT( treeViewSelectedRow(const QModelIndex& ) ) ); also how can i debug QT signal/slots so i can see some debug massages printing when something is wrong ?

    Read the article

  • Painting to Form then to Printer

    - by jp2code
    I often find myself needing to create custom reports that do NOT work with Crystal Reports or Report Viewer. Often, I hack a DataTable together and dumping that into a DataGridView control. It is never pretty, and printing is difficult. What I need is a class that I can call using the OnPaint event, but I've never sat down and written all of the Pen and Brush commands until now. Painting to the screen and painting to a printer both use the Graphics object, so I want to build a class that I'd pass in the Graphics object, my window bounds (a Rectangle), and some data (in the form of an instance of my class) that I'd use to paint a form or a sheet of paper. That sounds like a great concept! Surely, someone has done something like this before. Does anyone know of a book, a website tutorial, or video that goes into this? If someone wants to write all that out for me here, more power to you - but I'd think that would be too much work.

    Read the article

  • How can I change text on a win32 window?

    - by Will
    Looking for hints, tips and search terms for changing the text on a win32 window from C#. More specifically, I'm trying to change the text on the print dialog from "Print" to "OK", as I am using the dialog to create a print ticket and not do any printing. How can I find the dialog's window handle? Once I've got it, how would I go about finding the button in the child windows of the form? Once I've found that, how would I change the text on the button? And how can I do all this before the dialog is shown? There's a similar question here, but it points to a CodeProject article that is waaay more complex than needed and is taking me a bit longer to parse through than I'd like to spend on this. TIA.

    Read the article

  • Resizing page format on iReport

    - by pringlesinn
    I've been trying to print a pdf made from iReport in less than a page A4. it's like half A4 page height. I'm using a Line Matrix printer, doesn't matter which one. So, when I try to print 2 files at same file, it should print everything on the right place, but just first file is printed correctly. The second one is based on a A4 page format, and just starts printing after A4 page height is over, skipping a big blank. Where can I set the size of page in iReport? The only thing I could do was setting size of what is shown on screen while I edit the file. I tried my best to explain the situation, any doubts, ask me and I'll try even harder.

    Read the article

  • Event trigger print using VC++

    - by santhosh kumar
    I have requirement to print log data continuously whenever an event trigger (Without showing print dialog, using default printer). Event may occur twice a second or minit or hour. Also i don`t bother about printer status. example out of paper, communication problem. Printer should not leave empty page. Example event 1 have 4 lines of data to print. While printing event 2, printer should print continuously instead of fetching next paper. My development environment VC++ and MFC.

    Read the article

  • Java String Replace and null characters

    - by praspa
    Testing out someone elses code (of course it was ...) , I noticed a few JSP pages printing funky non-ascii characters. Taking a dip into the source I found this tidbit. // remove any periods from first name e.g. Mr. John --> Mr John firstName = firstName.trim().replace('.','\0'); Does replacing a character in a String with a null character even work in Java? I know that '\0' will terminate a c-string. Would this be the culprit to the funky characters? Thanks PR

    Read the article

  • T-SQL: How Do I Create A "Private" Function Inside A Stored Procedure

    - by RPM1984
    Okay so im writing a SQL Server 2008 Stored Procedure (maintenance script). In doing so, being a good boy i've done plenty of error handling, checking rowcounts, printing output messages, etc But in doing this, ive found myself writing over and over again something like this: SELECT @RowsAffected = @@ROWCOUNT IF @RowsAffected > 0 BEGIN PRINT CAST(@RowsAffected, NVARCHAR(2)) + 'rows updated.' END Or debug messages like this: PRINT 'User ' + CAST(@UserId AS NVARCHAR(5)) + ' modified successfully' Is there a way i can create a kind of 'subroutine' inside the stored procedure (like a private method) that can accept something as a parameter (doesnt have to though) and do some logic? I want to be able to do something like this: CheckRowCounts Or this: PrintUserUpatedMessage(@UserId) Which would then perform the above logic (check rowcount, print message, etc) And yes obviously i can create a UDF, but then i would need to create/drop it etc as this logic is only required for the life of the execution of this stored procedure. Getting sick and tired of writing the same code over and over again, and changing all the different areas ive used it when i get an error =) Can anyone help?

    Read the article

  • Most Rails-y way to give different views of the same resource?

    - by Nathan Long
    In Rails, is there a canonical way of giving different views of the same resource? For example, a directory of people, where each person can have multiple photos, phone numbers, email addresses, etc. The people, photos and phone numbers are actually different resources with their own RESTful actions. But when viewing people, one page might shows everyone's name and associated photos; another page is names and associated contact information, formatted for printing. Would it be more "Rails-y" to: Create additional actions on the People controller besides the RESTful ones, like "index_with_contact_info"? Create a different controller and a different group of views? Neither seems quite right to me, but the first seems more likely. Any thoughts?

    Read the article

  • Trying to generate a pdf using Snappy (wkhtmltopdf wrapper)

    - by tirengarfio
    I'm trying to generate a pdf using snappy through this code: $snappy = new SnappyPdf; $snappy->setExecutable('/usr/bin/wkhtmltopdf'); $snappy->save('http://www.google.com', '/tmp/jander.pdf'); In the apache log i find this: Done Loading pages (1/6) [ ] 0% [====== ] 10% [========== ] 18% [============ ] 20% [============= ] 22% [=============== ] 25% [================ ] 28% [================== ] 30% [=================== ] 33% [===================== ] 35% [====================== ] 37% [========================= ] 43% [=========================== ] 46% [============================================================] 100% Counting pages (2/6) [============================================================] Object 1 of 1 Resolving links (4/6) [============================================================] Object 1 of 1 Loading headers and footers (5/6) Printing pages (6/6) [ ] Preparing [============================================================] Page 1 of 1 Done but the pdf is not generated. Any idea? Javier

    Read the article

  • Java NullPointerException when traversing a non-null recordset

    - by Tim
    Hello again - I am running a query on Sybase ASE that produces a ResultSet that I then traverse and write the contents out to a file. Sometimes, this will throw a NullPointerException, stating that the ResultSet is null. However, it will do this after printing out one or two records. Other times, with the same exact input, I will receive no errors. I have been unable to consistently produce this error. The error message is pointing to a line: output.print(rs.getString(1)); It appears to happen when the query takes a little longer to run, for some reason. The recordset returns thus far have been very small (4 to 7 records). Sometimes I'll have to run the app 3 or 4 times, then the errors will just stop, as though the query was getting "warmed up". I've run the query manually and there doesn't appear to be any performance problems. Thanks again!

    Read the article

  • F# Extention Methods on Lists, IEnumberable, etc

    - by flevine100
    I have searched StackOverflow (and other sources) for this answer, but can't seem to find anything. In C#, if I had a widget definition, say: class widget { public string PrettyName() { ... do stuff here } } and I wanted to allow for easy printing of a list of Widgets, I might do this: namespace ExtensionMethods { public static PrintAll( this IEnumerable<Widget> widgets, TextWriter writer ) { foreach(var w in widgets) { writer.WriteLine( w.PrettyName() ) } } } How would I accomplish something similar with a record type and a collection (List or Seq preferrably in F#). I'd love to have a list of Widgest and be able to call a function right on the collection that did something like this. Assume (since it's F#) that the function would not be changing the state of the collection that it's attached to, but returning some new value.

    Read the article

  • Code/Approach Golf: Find row in text file with too many columns

    - by awshepard
    Given a text file that is supposed to contain 10 tab-delimited columns (i.e. 9 tabs), I'd like to find all rows that have more than 10 columns (more than 9 tabs). Each row ends with CR-LF. Assume nothing about the data, field widths, etc, other than the above. Comments regarding approach, and/or working code would be extremely appreciated. Bonus for printing line numbers of offending lines as well. Thanks in advance!

    Read the article

  • Opening Large (24 GB) File In C

    - by zacaj
    I'm trying to read in a 24 GB XML file in C, but it won't work. I'm printing out the current position using ftell() as I read it in, but once it gets to a big enough number, it goes back to a small number and starts over, never even getting 20% through the file. I assume this is a problem with the range of the variable that's used to store the position (long), which can go up to about 4,000,000,000 according to http://msdn.microsoft.com/en-us/library/s3f49ktz%28VS.80%29.aspx, while my file is 25,000,000,000 bytes in size. A long long should work, but how would I change what my compiler(Cygwin/mingw32) uses or get it to have fopen64?

    Read the article

< Previous Page | 113 114 115 116 117 118 119 120 121 122 123 124  | Next Page >