Search Results

Search found 55134 results on 2206 pages for 'argument error'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 1194/2206 | < Previous Page | 1190 1191 1192 1193 1194 1195 1196 1197 1198 1199 1200 1201  | Next Page >

  • Using the same machineKey across two web farms

    - by wwilkins
    We have two separate NLB web farms. The first farm runs an app that delivers content to the customer facing application on the second NLB. We've noticed a single Cryptographic error in our logs that occurs whenever a page loading content from the first farm is accessed. Is there any reason to not give all of the servers in both farms the same machineKey settings?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Granting read-write rights to my web application on VPS

    - by davykiash
    Am currently testing a bulk CSV import functionality web application and I came across a error The given destination is not writeable My application is zend based and uses the MVC structure application --uploads library --Zend public --index.php What Ubuntu command do I exectute to safely grant the necessary rights to my uploads folder in my web application?

    Read the article

  • resolve access violation exception (0xC0000005) crashing IIS app pool

    - by Joseph
    IIS 7.5, server 2008 r2, classic asp and asp .net 2.0, 3.5 website same server, same app pool. The past 4 weeks thousands of these errors 'C0000005' are occurring. I know from IIS debug diag tool that 'C0000005' is an access violation error. Below is the top line from my debug diag report. In w3wp__PID__6656__Date__01_08_2011__Time_01_42_46AM__281__First Chance Access Violation.dmp the assembly instruction at asp!CActiveScriptEngine::GetApplication+27 in \\?\C:\Windows\System32\inetsrv\asp.dll from Microsoft Corporation has caused an access violation exception (0xC0000005) when trying to read from memory location 0x00000000 on thread 29 Thread 29 - System ID 6736 Entry point 0x00000000 Create time 1/8/2011 12:46:26 AM Time spent in user mode 0 Days 00:00:00.140 Time spent in kernel mode 0 Days 00:00:00.078 Function Source asp!CActiveScriptEngine::GetApplication+27 vbscript!COleScript::GetDebugApplicationCoreNoRef+2b vbscript!COleScript::FDebuggerEnabled+30 vbscript!COleScript::SetScriptSite+cd asp!CActiveScriptEngine::Init+125 asp!CScriptManager::GetEngine+252 asp!AllocAndLoadEngines+28f asp!ExecuteGlobal+17a asp!Execute+b5 asp!CHitObj::ViperAsyncCallback+3fc asp!CViperAsyncRequest::OnCall+6a comsvcs!CSTAActivityWork::STAActivityWorkHelper+32 ole32!EnterForCallback+f4 ole32!SwitchForCallback+1a8 ole32!PerformCallback+a3 ole32!CObjectContext::InternalContextCallback+15b ole32!CObjectContext::DoCallback+1c comsvcs!CSTAActivityWork::DoWork+12f comsvcs!CSTAThread::DoWork+18 comsvcs!CSTAThread::ProcessQueueWork+37 comsvcs!CSTAThread::WorkerLoop+135 msvcrt!_endthreadex+44 msvcrt!_endthreadex+ce kernel32!BaseThreadInitThunk+e ntdll!__RtlUserThreadStart+70 ntdll!_RtlUserThreadStart+1b BELOW is the faulting module. ASP report Executing ASP requests 0 Request(s) ASP templates cached 0 Template(s) ASP template cache size 0.00 Bytes Loaded ASP applications 1 Application(s) ASP.DLL Version 7.5.7600.16620 ASP application report ASP application metabase key Physical Path Virtual Root Session Count 0 Session(s) Request Count 0 Request(s) Session Timeout 0 minutes(s) Path to Global.asa Server side script debugging enabled False Client side script debugging enabled False Out of process COM servers allowed False Session state turned on False Write buffering turned on False Application restart enabled False Parent paths enabled False ASP Script error messages will be sent to browser False ASP!CACTIVESCRIPTENGINE::GETAPPLICATION+27In w3wp__PID__6656__Date__01_08_2011__Time_01_42_46AM__281__First Chance Access Violation.dmp the assembly instruction at asp!CActiveScriptEngine::GetApplication+27 in \\?\C:\Windows\System32\inetsrv\asp.dll from Microsoft Corporation has caused an access violation exception (0xC0000005) when trying to read from memory location 0x00000000 on thread 29 recent events: server was being brute forced by hackers all of Dec and probably earlier, they weren't able to gain access but did get a virus on and blasted out spam. insatlled AVG and about the 17 or 22 latest patches. after that the app pool started crashing and the server has crashed a couple times since then. I am in no mans land as I am a developer and not a sys admin but I have to assume many roles. So I'm reaching out for help. Sometimes I will see hundreds of these 'C0000005' scriptengine errors in the event log in a matter of seconds and other times just a few times an hour. I googled this line 'ASP!CACTIVESCRIPTENGINE::GETAPPLICATION' and got nothing. Its like the function don't exist or something. I have spent many hours google-ing to no avail and am now turning to the experts on the forums. Thank you for your help

    Read the article

  • hosting 2 webapps under 1 apache/tomcat

    - by mkoryak
    I am trying to host multiple webapps under tomcat 6 behind apache2 via mod_jk. I am at my wits end with this. the problem i am facing that both domains seems to point to a single tomcat 'domain'. my server.xml looks like this: <Service name="Catalina"> <Connector port="8080" protocol="HTTP/1.1" connectionTimeout="20000" URIEncoding="UTF-8" redirectPort="8443" /> <Connector port="8009" protocol="AJP/1.3" redirectPort="8443" /> <Connector port="8010" protocol="AJP/1.3" redirectPort="8443" /> <Engine name="Catalina" defaultHost="dogself.com"> <Realm className="org.apache.catalina.realm.UserDatabaseRealm" resourceName="UserDatabase"/> <Host name="dogself.com" appBase="webapps-dogself" unpackWARs="true" autoDeploy="true" xmlValidation="false" xmlNamespaceAware="false"> </Host> <Host name="natashacarter.com" appBase="webapps-natashacarter.com" unpackWARs="true" autoDeploy="true" xmlValidation="false" xmlNamespaceAware="false"> </Host> </Engine> </Service> my workers.properties looks like this: worker.list=dogself,natashacarter worker.dogself.port=8009 worker.dogself.host=dogself.com worker.dogself.type=ajp13 worker.natashacarter.port=8010 worker.natashacarter.host=natashacarter.com worker.natashacarter.type=ajp13 finally my apache vhosts look like this: <VirtualHost 69.164.218.75:80> ServerName dogself.com DocumentRoot /srv/www/dogself.com/public_html/ ErrorLog /srv/www/dogself.com/logs/error.log CustomLog /srv/www/dogself.com/logs/access.log combined JkMount /* dogself </VirtualHost> and <VirtualHost 69.164.218.75:80> ServerName natashacarter.com DocumentRoot /srv/www/dogself.com/public_html/ ErrorLog /srv/www/dogself.com/logs/error.log CustomLog /srv/www/dogself.com/logs/access.log combined JkMount /* natashacarter </VirtualHost> when i log into manager webapp on both dogself.com and natashacarter.com, i can deploy to a context path on dogself, and that same contextpath will appear on natashacarter - so i know for a fact that this is the same tomcat domain. edit: just found this in my mod_jk log [Sun Feb 20 21:15:43 2011] [28546:3075521168] [warn] map_uri_to_worker_ext::jk_uri_worker_map.c (962): Uri * is invalid. Uri must start with / [Sun Feb 20 21:16:44 2011] [28548:3075521168] [info] ajp_send_request::jk_ajp_common.c (1496): (dogself) all endpoints are disconnected, detected by connect check (1), cping (0), send (0) but not sure why dogself wouldnt respond please help a brother out

    Read the article

  • Cannot Delete Application Pool

    - by redsquare
    I am trying to tidy up an IIS server. I have removed some test/uat virtual directories however I am not able to remove the application pools. I get the following error message. Any hints on how I go about resolving this?

    Read the article

  • HDD Producing high pithched beep noise

    - by POTHEN
    Recently I had an upgrade on one of my PC I added a 512Mb Nvidia Graphic card and 500GB seagate 7200Rpm HDD, Now the new HDD is producing a high pitched squeek/beep i cant really tell and on reboot my XP sector 63 gets corrupted, so I get reboot error. I gave the HDD for replacement but the replaced one too makes the noice, yet the HDD does not produce sound on my gaming rig.

    Read the article

  • Cannot move folder to a subdirectoy of itself - What's going on?

    - by calumbrodie
    O.K I am trying to do the following very simple command and it is failing as follows... mv '/home/admin/Downloads/folder1' '/home/admin/MyLibrary/MyVideos/TV/folder1/' mv: cannot move `/home/admin/Downloads/folder1' to a subdirectory of itself, `/home/admin/MyLibrary/MyVideos/TV/folder1/' The destination is NOT a subfolder of the source - why is it giving me this error?? Linux version is a custom version of Red Hat on a NAS box. Thanks

    Read the article

  • How do I make netdiag work?

    - by Mohamed Abobakr
    I'm trying to run the netdiag command to troubleshoot the internet connection but when I run it in cmd I get the following message: 'netdiag' is not recognized as an internal or external command, operable program or batch file. Also, I have tried typing "net diag", which gives me a syntax error, but that NET command seems to be something completely different. Searching on google for answers gives me results that deal with Windows Server 2003; I'm on a Windows XP machine.

    Read the article

  • Unable to telnet out on port 25 on windows server 2008

    - by NickGPS
    Hi All, I just setup a Windows 2008 R2 server and am trying to get a basic mail server up and running so that I can send emails from my applications. I setup a virtual SMTP server in IIS6 and tried doing a local telnet to port 25, which seemed to work fine. There were no errors during this stage and I can see the mail message appear in the Queue folder. The problem is that mail never leaves the Queue folder. I then tried to telnet to a remote mail server on port 25 but couldn't connect:- telnet 209.85.227.27 25 Could not open connection to the host, on port 25: Connection failed) I checked my firewall and there is a default setting to allow all outgoing TCP traffic with no restriction. I even setup a specific rule for outgoing port 25 traffic but to no avail. I then ran a SmtpDiag.exe command .\SmtpDiag.exe [email protected] [email protected] and received the following output Searching for Exchange external DNS settings. Computer name is WIN-SERVERNAME. Failed to connect to the domain controller. Error: 8007054b Checking SOA for gmail.com. Checking external DNS servers. Checking internal DNS servers. SOA serial number match: Passed. Checking local domain records. Checking MX records using TCP: gmail.com. Checking MX records using UDP: gmail.com. Both TCP and UDP queries succeeded. Local DNS test passed. Checking remote domain records. Checking MX records using TCP: gmail.com. Checking MX records using UDP: gmail.com. Both TCP and UDP queries succeeded. Remote DNS test passed. Checking MX servers listed for [email protected]. Connecting to gmail-smtp-in.l.google.com [209.85.227.27] on port 25. Connecting to the server failed. Error: 10060 Failed to submit mail to gmail-smtp-in.l.google.com. Is there any other diagnostics I can do to figure out if it's my firewall or something else? I have removed antivirus to make sure that it wasn't causing the problem. Any ideas would be much appreciated.

    Read the article

  • Complications registering a punycode domain name

    - by chaz
    Not sure if any of you have experience with this, but I am trying to include the anchor (?) in my domain name (using the appropriate punycode to allow it) but upon registering it I encounter the error that the symbol is not supported by the language I have chosen. Does anyone know what language would support this if I were to continue or even how I would go about doing so or if i can even do so. Thanks

    Read the article

  • Unable to burn Windows ISO from Fedora

    - by user331947
    First of all, English is not my native tongue, so apologies for any mistakes. My computer recently started prompting that it can't launch Windows successfully. So I just choose start Windows normally. Then, I found that the startup freezes at the Windows screen (before the login prompt). I have tried rebooting several times and get the same results. So I just gave up. After few days, I tried to boot up my laptop again. This time it got to the desktop, but it's extremely slow and the icons on my Desktop don't show up. I decided to format the Windows partition and reinstall a new one. (It is usually faster that way since I kept my 400GB+ data on aother partition and programs and the rest in the same partition as Windows). The thing is I get the Windows disc at the moment (Traveling aboard). But I have a Windows 7 disc image on my hard disk. So, I downloaded Ubuntu 14.04 LTS, made a Live USB, and then try to burn the image from Ubuntu. But the program just freezes and I don't know why. I tried several times and it's still the same. So I tried using Fedora instead, just to see if it will work. The Disk Image Writer report something like this. Error unmounting /dev/dm-0: Command-line `umount "/dev/dm-0"' exited with non-zero exit status 32: umount: /: target is busy (In some cases useful info about processes that use the device is found by lsof(8) or fuser(1).) (udisks-error-quark, 14) Also, I tried installing linux on the windows partition. The installation program freezes (both Ubuntu and Fedora). So, I thought that maybe something are wrong with my hard disk. I seek the solution on the internet and found that gparted can be used to format a partition. And it also froze at "Searching /dev/sda/ partition ...". I'm using Lenovo Y570. Spec below. http://www.notebookreview.com/notebookreview/lenovo-ideapad-y570-review-a-lenovo-bestseller/3/ Can anyone suggest a next step in diagnosing and fixing this problem? Thanks in advance.

    Read the article

  • What causes XP to lose the clipboard?

    - by Steve
    A few times lately I've been getting the error "Cannot open clipboard" when trying to paste. Can I get it back without re-booting? I've been using Arsclip for years as a clipboard enhancement. I'm not convinced that causes the problem as it persists even when I close it.

    Read the article

  • NetBeans remote synchronization : failed to save file

    - by yoda
    Hi, I'm using NetBeans in a project, making use of remote sync to save both locally and to a FTP server. This feature works in other projects, but this time is failing when trying to save the file to the remote server. The IDE log tells me that had occurred a unknown error, as well as this : Upload failed: org.netbeans.modules.php.project.connections.TransferInfo [transfered: [], failed: {index.php=Cannot upload file index.php (unknown reason).}, partially failed: {}, ignored: {}, runtime: 61136 ms] Cannot logout from server The version of the IDE is 6.8. Cheers

    Read the article

  • Install WAS 7.0 on RHEL 6

    - by Madhur Ahuja
    I am trying to install Websphere 7 x64 on RHEL 6 x64. I am using Developer edition. When I try to execute ./install on the command prompt, it waits for few seconds and then returns to prompt without any error. I have installed all the pre-requisites as listed in this article: http://pic.dhe.ibm.com/infocenter/wasinfo/v7r0/index.jsp?topic=%2Fcom.ibm.websphere.installation.base.doc%2Finfo%2Faes%2Fae%2Ftins_linuxsetup_rhel6.html Any idea how to troubleshoot this ?

    Read the article

  • Application is crash..

    - by user338322
    Below is my crash Report. 0 0x326712f8 in prepareForMethodLookup () 1 0x3266cf5c in lookUpMethod () 2 0x32668f28 in objc_msgSend_uncached () 3 0x33f70996 in NSPopAutoreleasePool () 4 0x33f82a6c in -[NSAutoreleasePool drain] () 5 0x00003d3e in -[CameraViewcontroller save:] (self=0x811400, _cmd=0x319c00d4, number=0x11e210) at /Users/hardikrathore/Desktop/LiveVideoRecording/Classes/CameraViewcontroller.m:266 6 0x33f36f8a in __NSFireDelayedPerform () 7 0x32da44c2 in CFRunLoopRunSpecific () 8 0x32da3c1e in CFRunLoopRunInMode () 9 0x31bb9374 in GSEventRunModal () 10 0x30bf3c30 in -[UIApplication _run] () 11 0x30bf2230 in UIApplicationMain () 12 0x00002650 in main (argc=1, argv=0x2ffff474) at /Users/hardikrathore/Desktop/LiveVideoRecording/main.m:14 And this is the code. lines, where I am getting the error. -(void)save:(id)number { NSAutoreleasePool *pool = [[NSAutoreleasePool alloc] init]; j =[number intValue]; while(screens[j] != NULL){ NSLog(@" image made : %d",j); UIImage * image = [UIImage imageWithCGImage:screens[j]]; image=[self imageByCropping:image toRect:CGRectMake(0, 0, 320, 240)]; NSData *imgdata = UIImageJPEGRepresentation(image,0.3); [image release]; CGImageRelease(screens[j]); screens[j] = NULL; UIImage * image1 = [UIImage imageWithCGImage:screens[j+1]]; image1=[self imageByCropping:image1 toRect:CGRectMake(0, 0, 320, 240)]; NSData *imgdata1 = UIImageJPEGRepresentation(image1,0.3); [image1 release]; CGImageRelease(screens[j+1]); screens[j+1] = NULL; NSString *urlString=@"http://www.test.itmate4.com/iPhoneToServerTwice.php"; // setting up the request object now NSMutableURLRequest *request = [[NSMutableURLRequest alloc]init]; [request setURL:[NSURL URLWithString:urlString]]; [request setHTTPMethod:@"POST"]; NSString *fileName=[VideoID stringByAppendingString:@"_"]; fileName=[fileName stringByAppendingString:[NSString stringWithFormat:@"%d",k]]; NSString *fileName2=[VideoID stringByAppendingString:@"_"]; fileName2=[fileName2 stringByAppendingString:[NSString stringWithFormat:@"%d",k+1]]; /* add some header info now we always need a boundary when we post a file also we need to set the content type You might want to generate a random boundary.. this is just the same as my output from wireshark on a valid html post */ NSString *boundary = [NSString stringWithString:@"---------------------------14737809831466499882746641449"]; NSString *contentType = [NSString stringWithFormat:@"multipart/form-data; boundary=%@",boundary]; [request addValue:contentType forHTTPHeaderField: @"Content-Type"]; /* now lets create the body of the post */ //NSString *count=[NSString stringWithFormat:@"%d",front];; NSMutableData *body = [NSMutableData data]; [body appendData:[[NSString stringWithFormat:@"\r\n--%@\r\n",boundary] dataUsingEncoding:NSUTF8StringEncoding]]; //[body appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"userfile\"; count=\"@\"";filename=\"%@.jpg\"\r\n",count,fileName] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"userfile\"; filename=\"%@.jpg\"\r\n",fileName] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[[NSString stringWithString:@"Content-Type: application/octet-stream\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[NSData dataWithData:imgdata]]; [body appendData:[[NSString stringWithFormat:@"\r\n--%@--\r\n",boundary] dataUsingEncoding:NSUTF8StringEncoding]]; //second boundary NSString *string1 = [[NSString alloc] initWithFormat:@"\r\n--%@\r\n",boundary]; NSString *string2 =[[NSString alloc] initWithFormat:@"Content-Disposition: form-data; name=\"userfile2\"; filename=\"%@.jpg\"\r\n",fileName2]; NSString *string3 =[[NSString alloc] initWithFormat:@"\r\n--%@--\r\n",boundary]; [body appendData:[string1 dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[string2 dataUsingEncoding:NSUTF8StringEncoding]]; //experiment //[body appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"userfile2\"; filename=\"%@.jpg\"\r\n",fileName2] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[[NSString stringWithString:@"Content-Type: application/octet-stream\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[NSData dataWithData:imgdata1]]; //[body appendData:[[NSString stringWithFormat:@"\r\n--%@--\r\n",boundary] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[string3 dataUsingEncoding:NSUTF8StringEncoding]]; // setting the body of the post to the reqeust [request setHTTPBody:body]; // now lets make the connection to the web NSData *returnData = [NSURLConnection sendSynchronousRequest:request returningResponse:nil error:nil]; NSString *returnString = [[NSString alloc] initWithData:returnData encoding:NSUTF8StringEncoding]; if([returnString isEqualToString:@"SUCCESS"]) { NSLog(returnString); k=k+2; j=j+2; [self performSelectorInBackground:@selector(save:) withObject:(id)[NSNumber numberWithInt:j]]; } //k=k+2; [imgdata release]; [imgdata1 release]; [NSThread sleepForTimeInterval:.01]; } [pool drain]; <-------------Line 266 } As you can see in log report. I am getting the error, Line 266. Some autorelease problem Any help !!!? coz I am not getting why its happening.

    Read the article

  • what is the location of the log file for bugzilla on windows

    - by mohang
    We are using Bugzlla on windows. We set up the SMTP server configuration in the admin parameters. But Bugzilla is unable to send emails. It always reports "Could not authenticate user". How to know the details of the error? Everything we configured are working fine when used in another system. Can you please point out the location of the log file Any points to troubleshoot the issue is greatly appreciated.

    Read the article

  • Windows 2003 registry corrupt - endless reboot

    - by Jack
    Windows 2003 will run the loading screen then it stop with "Stop c000218 registry file failure or corrupt. The registry can not load the hive \systemroot\system32\config\security" then it start a count down about dumping the physical memory to disk and reboot itself again. I found Error starting Windows SBS 2003 - STOP: c0000218 but the config is different directory than mine. Is it the same step to try for recovery console?

    Read the article

  • Extract specific files in a tar archive using a wildcard

    - by AdrieanKhisbe
    I'm tring for a script to extract only jpeg pictures from an archive containing maky kind of files. To do so I tried first to use: tar -xf MyTar.tar *.jpg but it failed (*.jpg not found) and suggest me to use "--wildcard". So I tried tar -xf MyTar.tar --wildcard *.jpg I did that, but then the same error and a different warning saying yo me that the option "--wildcard" is ambigious. I've been over the manuel pages for tar, but didn't find a clue about the problem thanks

    Read the article

  • could not connect to server: Operation timed out

    - by JohnMerlino
    I am able to ssh into my ubuntu server with a user name and password from the terminal. However, when I try to connect to the server using the same name and password via pgadmin, I am getting the following error: could not connect to server: Operation timed out Is the server running on host "xx.xxx.xx.xxx" and accepting TCP/IP connections on port 5432? Why am I able to connect through terminal but not pgadmin?

    Read the article

  • Assembly - Read next sector of a virtual disk

    - by ali
    As any programmer in the world at least once in his/her life, I am trying to create my "revolutionary", the new and only one operating system. :D Well, I am using a virtual emulator (Oracle VM Virtual Box), for which I create a new unknwon operating system, with a vmdk disk. I like vmdk because they are just plain files, so I can paste my boot-loader over the first 512 bytes of the virtual hard disk. Now, I am trying to read the next sector of this virtual disk, on which I would paste a simple kernel that would display a message. I have two questions: Am I reading the second segment (the first -512 bytes- is occupied by the bootloader) correctly? CODE: CitesteDisc: mov bx, 0x8000 ; segment mov es, bx mov bx, 0x0000 ; offset mov ah, 0x02 ; read function mov al, 0x01 ; sectors - this might be wrong, trying to read from hd mov ch, 0x00 ; cylinder mov cl, 0x02 ; sector mov dh, 0x00 ; head mov dl, 0x80 ; drive - trying to read from hd int 0x13 ; disk int mov si, ErrorMessage ; - This will display an error message jc ShowMessage jmp [es:bx] ; buffer Here, I get the error message, after checking CF. However, if I use INT 13, 1 to get last status message, AL is 0 - so no error is saved. Am I pasting my simple kernel in the correct place inside the vmdk? What I do is pasting it after the 512th byte of the file, the first 512 bytes, as I said, are the boot-loader. The file would look like this: BE 45 7C E8 16 00 EB FE B4 0E B7 00 B3 07 CD 10 <- First sector C3 AC 08 C0 74 05 E8 EF FF EB F6 C3 B4 00 B2 80 CD 13 BE 5D 7C 72 F5 BB 00 80 8E C3 BB 00 00 B4 02 B0 06 B5 00 B1 01 B6 00 B2 07 CD 13 BE 4E 7C 72 CF 26 FF 27 57 65 6C 63 6F 6D 65 21 00 52 65 61 64 69 6E 67 20 65 72 72 6F 72 21 00 52 65 73 65 74 74 69 6E 67 20 65 72 72 6F 72 21 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 55 AA <- Boot-loader signature B4 0E B0 2E CD 10 EB FE 00 00 00 00 00 00 00 00 <- Start of the second sector 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 So, this is the way I am trying to add the kernel to the second sector. What do you think is wrong with this? Thanks!

    Read the article

  • undeliverable email troubleshooting

    - by Funky Si
    I am using IIS6 smtp to send emails out, some of these emails are coming back with the following error. Could not deliver the message in the time limit specified. Please retry or contact your administrator. What steps do I need to take to track done where the problem is? I currently believe the problem is either with my configuration or with the configuration of the mail server I am trying to send to. Thanks

    Read the article

  • Why does cifs asks for su rights to write any data into it?

    - by Denys S.
    I'm mounting a windows share as follows: sudo mount -t cifs //192.168.178.49/public -o users,username=name,dom=domain,password=pword /mnt/nas Then I'm trying to create a simple file with some basic text: touch /mnt/nas/me.txt And get an error, however, the file is created (contains 0B of data though): touch: cannot touch ‘me.txt’: Permission denied With sudo it works flawless. How can I allow my current user to write data to the share? Is there a mount option?

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 1190 1191 1192 1193 1194 1195 1196 1197 1198 1199 1200 1201  | Next Page >