Search Results

Search found 55134 results on 2206 pages for 'argument error'.

Page 1194/2206 | < Previous Page | 1190 1191 1192 1193 1194 1195 1196 1197 1198 1199 1200 1201  | Next Page >

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Application is crash..

    - by user338322
    Below is my crash Report. 0 0x326712f8 in prepareForMethodLookup () 1 0x3266cf5c in lookUpMethod () 2 0x32668f28 in objc_msgSend_uncached () 3 0x33f70996 in NSPopAutoreleasePool () 4 0x33f82a6c in -[NSAutoreleasePool drain] () 5 0x00003d3e in -[CameraViewcontroller save:] (self=0x811400, _cmd=0x319c00d4, number=0x11e210) at /Users/hardikrathore/Desktop/LiveVideoRecording/Classes/CameraViewcontroller.m:266 6 0x33f36f8a in __NSFireDelayedPerform () 7 0x32da44c2 in CFRunLoopRunSpecific () 8 0x32da3c1e in CFRunLoopRunInMode () 9 0x31bb9374 in GSEventRunModal () 10 0x30bf3c30 in -[UIApplication _run] () 11 0x30bf2230 in UIApplicationMain () 12 0x00002650 in main (argc=1, argv=0x2ffff474) at /Users/hardikrathore/Desktop/LiveVideoRecording/main.m:14 And this is the code. lines, where I am getting the error. -(void)save:(id)number { NSAutoreleasePool *pool = [[NSAutoreleasePool alloc] init]; j =[number intValue]; while(screens[j] != NULL){ NSLog(@" image made : %d",j); UIImage * image = [UIImage imageWithCGImage:screens[j]]; image=[self imageByCropping:image toRect:CGRectMake(0, 0, 320, 240)]; NSData *imgdata = UIImageJPEGRepresentation(image,0.3); [image release]; CGImageRelease(screens[j]); screens[j] = NULL; UIImage * image1 = [UIImage imageWithCGImage:screens[j+1]]; image1=[self imageByCropping:image1 toRect:CGRectMake(0, 0, 320, 240)]; NSData *imgdata1 = UIImageJPEGRepresentation(image1,0.3); [image1 release]; CGImageRelease(screens[j+1]); screens[j+1] = NULL; NSString *urlString=@"http://www.test.itmate4.com/iPhoneToServerTwice.php"; // setting up the request object now NSMutableURLRequest *request = [[NSMutableURLRequest alloc]init]; [request setURL:[NSURL URLWithString:urlString]]; [request setHTTPMethod:@"POST"]; NSString *fileName=[VideoID stringByAppendingString:@"_"]; fileName=[fileName stringByAppendingString:[NSString stringWithFormat:@"%d",k]]; NSString *fileName2=[VideoID stringByAppendingString:@"_"]; fileName2=[fileName2 stringByAppendingString:[NSString stringWithFormat:@"%d",k+1]]; /* add some header info now we always need a boundary when we post a file also we need to set the content type You might want to generate a random boundary.. this is just the same as my output from wireshark on a valid html post */ NSString *boundary = [NSString stringWithString:@"---------------------------14737809831466499882746641449"]; NSString *contentType = [NSString stringWithFormat:@"multipart/form-data; boundary=%@",boundary]; [request addValue:contentType forHTTPHeaderField: @"Content-Type"]; /* now lets create the body of the post */ //NSString *count=[NSString stringWithFormat:@"%d",front];; NSMutableData *body = [NSMutableData data]; [body appendData:[[NSString stringWithFormat:@"\r\n--%@\r\n",boundary] dataUsingEncoding:NSUTF8StringEncoding]]; //[body appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"userfile\"; count=\"@\"";filename=\"%@.jpg\"\r\n",count,fileName] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"userfile\"; filename=\"%@.jpg\"\r\n",fileName] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[[NSString stringWithString:@"Content-Type: application/octet-stream\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[NSData dataWithData:imgdata]]; [body appendData:[[NSString stringWithFormat:@"\r\n--%@--\r\n",boundary] dataUsingEncoding:NSUTF8StringEncoding]]; //second boundary NSString *string1 = [[NSString alloc] initWithFormat:@"\r\n--%@\r\n",boundary]; NSString *string2 =[[NSString alloc] initWithFormat:@"Content-Disposition: form-data; name=\"userfile2\"; filename=\"%@.jpg\"\r\n",fileName2]; NSString *string3 =[[NSString alloc] initWithFormat:@"\r\n--%@--\r\n",boundary]; [body appendData:[string1 dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[string2 dataUsingEncoding:NSUTF8StringEncoding]]; //experiment //[body appendData:[[NSString stringWithFormat:@"Content-Disposition: form-data; name=\"userfile2\"; filename=\"%@.jpg\"\r\n",fileName2] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[[NSString stringWithString:@"Content-Type: application/octet-stream\r\n\r\n"] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[NSData dataWithData:imgdata1]]; //[body appendData:[[NSString stringWithFormat:@"\r\n--%@--\r\n",boundary] dataUsingEncoding:NSUTF8StringEncoding]]; [body appendData:[string3 dataUsingEncoding:NSUTF8StringEncoding]]; // setting the body of the post to the reqeust [request setHTTPBody:body]; // now lets make the connection to the web NSData *returnData = [NSURLConnection sendSynchronousRequest:request returningResponse:nil error:nil]; NSString *returnString = [[NSString alloc] initWithData:returnData encoding:NSUTF8StringEncoding]; if([returnString isEqualToString:@"SUCCESS"]) { NSLog(returnString); k=k+2; j=j+2; [self performSelectorInBackground:@selector(save:) withObject:(id)[NSNumber numberWithInt:j]]; } //k=k+2; [imgdata release]; [imgdata1 release]; [NSThread sleepForTimeInterval:.01]; } [pool drain]; <-------------Line 266 } As you can see in log report. I am getting the error, Line 266. Some autorelease problem Any help !!!? coz I am not getting why its happening.

    Read the article

  • Install WAS 7.0 on RHEL 6

    - by Madhur Ahuja
    I am trying to install Websphere 7 x64 on RHEL 6 x64. I am using Developer edition. When I try to execute ./install on the command prompt, it waits for few seconds and then returns to prompt without any error. I have installed all the pre-requisites as listed in this article: http://pic.dhe.ibm.com/infocenter/wasinfo/v7r0/index.jsp?topic=%2Fcom.ibm.websphere.installation.base.doc%2Finfo%2Faes%2Fae%2Ftins_linuxsetup_rhel6.html Any idea how to troubleshoot this ?

    Read the article

  • Windows Service Limit Crashes Services on Startup

    - by Paul Williams
    We have developed a custom Windows service in C# as part of a large Enterprise application. Our QA department tests multiple versions of this service. The QA lab has several (over 20) copies of this service installed on one Windows 2003 test box. Each copy is in its own folder and has a unique service name, though each executable file is named the same (OurWindowsService.exe, for example). Each service uses the same Windows credentials (a domain user). The purpose of this service is to handle MSMQ messages. The queued messages do all sorts of important stuff. For some reason, they can run only 5 of these services at a time. When we start a 6th, the service crashes on startup. For example, I can start #1, #2, #3, #4, and #5. When I start #6, it crashes. However, if I stop #1 and start #6, #6 runs fine, and now #1 fails to start. When the services crash, the following error appears in the Windows event log: Faulting application OurWindowsService.exe, version 5.40.1.1, faulting module kernel32.dll, version 5.2.3790.4480, fault address 0x0000bef7. I was able to use WinDbg to generate a postmortem dump file. The dump file revealed that the crash occurs trying to delay load SHLWAPI.dll: 0:000> kb100 ChildEBP RetAddr Args to Child 0012ece4 79037966 c06d007e 00000000 00000001 KERNEL32!RaiseException+0x53 0012ed4c 790099ba 00000008 0012ed08 7c82860c mscoree!__delayLoadHelper2+0x139 0012ed98 790075b1 001550c8 0012edac 0012fb34 mscoree!_tailMerge_**SHLWAPI_dll**+0xd 0012edb0 79007623 001550c8 0012edf8 0012edf4 mscoree!XMLGetVersionWithSupported+0x22 0012ee00 790069a4 aa06f1b0 00000000 000001fe mscoree!RuntimeRequest::GetRuntimeVersion+0x56 0012f478 790077aa 00000001 7903fb4c 0012fb34 mscoree!RuntimeRequest::ComputeVersionString+0x5bd 0012f89c 79007802 00000001 0012f8b4 7903fb4c mscoree!RuntimeRequest::FindVersionedRuntime+0x11c 0012f8b8 79007b19 00000001 00000000 aa06fa6c mscoree!RuntimeRequest::RequestRuntimeDll+0x2c 0012ffa4 79007c02 00000001 0012ffbc 00000000 mscoree!GetInstallation+0x72 0012ffc0 77e6f23b 00000000 00000000 7ffdf000 mscoree!_CorExeMain+0x12 0012fff0 00000000 79007bf0 00000000 78746341 KERNEL32!BaseProcessStart+0x23 I believe the error code handed to Kernel32.RaiseException, c06d007e, means Module Not Found, but I'm not certain. Does this sound familiar to anyone? Are we hitting some limit on the number of service instances on some file name? Does MSMQ dislike more than 5 listening services?

    Read the article

  • How do I fix a corrupted copy of .Net Framework on Windows 7?

    - by David
    I receive the following error when trying to run applications that require .net Framework 3.5: "Could not load file or assembly 'System.Core, Version=3.5.0.0, Culture=neutral, PublicKeyToken=b77a5c561934e089' or one of its dependencies. The module was expected to contain an assembly manifest." I've tried numerous fixes, such as reinstalling through ad/remove software, copying the .net folder over from a clean windows 7 install, and running the .net cleanup tool. Just wondering if anyone has run into this issue before, or has an idea on how to fix it.

    Read the article

  • How do I make netdiag work?

    - by Mohamed Abobakr
    I'm trying to run the netdiag command to troubleshoot the internet connection but when I run it in cmd I get the following message: 'netdiag' is not recognized as an internal or external command, operable program or batch file. Also, I have tried typing "net diag", which gives me a syntax error, but that NET command seems to be something completely different. Searching on google for answers gives me results that deal with Windows Server 2003; I'm on a Windows XP machine.

    Read the article

  • what is the location of the log file for bugzilla on windows

    - by mohang
    We are using Bugzlla on windows. We set up the SMTP server configuration in the admin parameters. But Bugzilla is unable to send emails. It always reports "Could not authenticate user". How to know the details of the error? Everything we configured are working fine when used in another system. Can you please point out the location of the log file Any points to troubleshoot the issue is greatly appreciated.

    Read the article

  • NetBeans remote synchronization : failed to save file

    - by yoda
    Hi, I'm using NetBeans in a project, making use of remote sync to save both locally and to a FTP server. This feature works in other projects, but this time is failing when trying to save the file to the remote server. The IDE log tells me that had occurred a unknown error, as well as this : Upload failed: org.netbeans.modules.php.project.connections.TransferInfo [transfered: [], failed: {index.php=Cannot upload file index.php (unknown reason).}, partially failed: {}, ignored: {}, runtime: 61136 ms] Cannot logout from server The version of the IDE is 6.8. Cheers

    Read the article

  • VirtualBox imported VM - VERR_NOT_SUPPORTED - VERR_CFGM_VALUE_NOT_FOUND

    - by user40460
    On VirtualBox, I've exported a Ubuntu Server VM (File \ Export Appliance) and tried to imported it on a different machine. every thing went well with export and import. But, when I start the imported VM, I get this VERR_NOT_SUPPORTED error VERR_CFGM_VALUE_NOT_FOUND. Its quite weird. If I ditch the Import process and straight away create a new VM and use the exported VMDK, it works fine!! Both machines are using the same version of VirtualBox (3.2.4 r62467) Any clues?

    Read the article

  • VPS host can't send email to Google and Yahoo Mail

    - by mandeler
    Hi, I got a new VPS setup and I'm wondering why I can't send emails to yahoo and gmail. Here's the error in /var/log/maillog: 00:43:00 mylamp sendmail[32507]: o45Gh0nc032505: to=, ctladdr= (48/48), delay=00:00:00, xdelay=00:00:00, mailer=esmtp, pri=120405, relay=alt4.gmail-smtp-in.l.google.com. [74.125.79.27], dsn=4.0.0, stat=Deferred: Connection refused by alt4.gmail-smtp-in.l.google.com What seems to be the problem?

    Read the article

  • MS SQL server services not installed - help!

    - by judahgabriel
    Hi guys, I've installed SQL Server 2008 R2, but connecting to my local machine in SQL Management Studio fails: Putting "localhost" or "." as the server name results in the same error. I've narrowed down the problem: there are no SQL services installed: Bringing up the Services control panel applet shows me there are no MS SQL services installed. Things I've tried: Repair install of SQL Complete uninstall and reinstall of all MS SQL products. How can I get SQL Server running?

    Read the article

  • Granting read-write rights to my web application on VPS

    - by davykiash
    Am currently testing a bulk CSV import functionality web application and I came across a error The given destination is not writeable My application is zend based and uses the MVC structure application --uploads library --Zend public --index.php What Ubuntu command do I exectute to safely grant the necessary rights to my uploads folder in my web application?

    Read the article

  • Server getting stuck while upgrading from ESX 3.5i to ESX3.5

    - by AmitPawar
    Hi All, i am getting the following error while upgrading the server from ESX3.5i to ESX3.5.. and the server gets Stuck. it says : Starting System Management Homepage:.......ok Starting HP Insight Manager Agents: ipmi_si : servching for PCI device 0x3302 ipmi_si : Trying "Kcs" at memory address 0xf7ef.... ipmi_si : Found PCI BMC at BAR address 0xf7ef.... In try_get_dev_id And the server gets stuck, had anyone seen this and how to resolve this? Thanks, Amit

    Read the article

  • Can you mount a sysprep image using DISM

    - by Tester123
    I created a script to mount a sysprepped Windows 7 image to a directory so I can edit a specific file in the image and then unmount it. The script seems to work just fine however, each time I try I seem to be getting some sort of error about the Image. Errors such as: The image is supposedly damaged or corrupted The image mounts but nothing appears in the directory So I guess the overall question is it possible to mount an syprepped Windows 7 Wim Image into a directory?

    Read the article

  • Windows 2003 registry corrupt - endless reboot

    - by Jack
    Windows 2003 will run the loading screen then it stop with "Stop c000218 registry file failure or corrupt. The registry can not load the hive \systemroot\system32\config\security" then it start a count down about dumping the physical memory to disk and reboot itself again. I found Error starting Windows SBS 2003 - STOP: c0000218 but the config is different directory than mine. Is it the same step to try for recovery console?

    Read the article

  • Why do my 3GP videos not play audio using VLC?

    - by GiH
    I have a Nexus One phone and when I record video the container seems to be 3GP. When I try to playback using VLC I'm getting no audio, and an error saying that there is nothing I can do because VLC does not support the "samr" codec. Is there really nothing I can do to watch my videos on VLC? If not, whats the alternative? I really like VLC specifically because I never have to download codecs...

    Read the article

  • Unable to telnet out on port 25 on windows server 2008

    - by NickGPS
    Hi All, I just setup a Windows 2008 R2 server and am trying to get a basic mail server up and running so that I can send emails from my applications. I setup a virtual SMTP server in IIS6 and tried doing a local telnet to port 25, which seemed to work fine. There were no errors during this stage and I can see the mail message appear in the Queue folder. The problem is that mail never leaves the Queue folder. I then tried to telnet to a remote mail server on port 25 but couldn't connect:- telnet 209.85.227.27 25 Could not open connection to the host, on port 25: Connection failed) I checked my firewall and there is a default setting to allow all outgoing TCP traffic with no restriction. I even setup a specific rule for outgoing port 25 traffic but to no avail. I then ran a SmtpDiag.exe command .\SmtpDiag.exe [email protected] [email protected] and received the following output Searching for Exchange external DNS settings. Computer name is WIN-SERVERNAME. Failed to connect to the domain controller. Error: 8007054b Checking SOA for gmail.com. Checking external DNS servers. Checking internal DNS servers. SOA serial number match: Passed. Checking local domain records. Checking MX records using TCP: gmail.com. Checking MX records using UDP: gmail.com. Both TCP and UDP queries succeeded. Local DNS test passed. Checking remote domain records. Checking MX records using TCP: gmail.com. Checking MX records using UDP: gmail.com. Both TCP and UDP queries succeeded. Remote DNS test passed. Checking MX servers listed for [email protected]. Connecting to gmail-smtp-in.l.google.com [209.85.227.27] on port 25. Connecting to the server failed. Error: 10060 Failed to submit mail to gmail-smtp-in.l.google.com. Is there any other diagnostics I can do to figure out if it's my firewall or something else? I have removed antivirus to make sure that it wasn't causing the problem. Any ideas would be much appreciated.

    Read the article

  • After installing Windows XP Service Pack 3 - Generic Host Process For Win32 Services problem starts

    - by Muhammad Kashif Nadeem
    After installing Service Pack 3 I am getting this error "Generic Host Process For Win32 Services Encountered A Problem and needs to close. When this message pops my computer just stuck and I can not even restart it normally. The only fix of this problem is to un-install service pack 3 and run fix from Microsoft which is available for Service Pack 2. Any help to fix this. Thanks.

    Read the article

  • After installing Windows XP Service Pack 3 - Generic Host Process For Win32 Services problem starts

    - by Muhammad Kashif Nadeem
    After installing Service Pack 3 I am getting this error "Generic Host Process For Win32 Services Encountered A Problem and needs to close. When this message pops my computer just stuck and I can not even restart it normally. The only fix of this problem is to un-install service pack 3 and run fix from Microsoft which is available for Service Pack 2. Any help to fix this. Thanks.

    Read the article

  • Why does cifs asks for su rights to write any data into it?

    - by Denys S.
    I'm mounting a windows share as follows: sudo mount -t cifs //192.168.178.49/public -o users,username=name,dom=domain,password=pword /mnt/nas Then I'm trying to create a simple file with some basic text: touch /mnt/nas/me.txt And get an error, however, the file is created (contains 0B of data though): touch: cannot touch ‘me.txt’: Permission denied With sudo it works flawless. How can I allow my current user to write data to the share? Is there a mount option?

    Read the article

  • Plymouth fails to start on boot

    - by thomasfedb
    On boot I get this error: [FAILED] Failed to start Wait for Plymouth Boot Screen to Quit. When I check what systemctl status plymouth-quit-wait.service says I get: [root@zanak thomasfedb]# systemctl status plymouth-quit-wait.service plymouth-quit-wait.service - Wait for Plymouth Boot Screen to Quit Loaded: loaded (/usr/lib/systemd/system/plymouth-quit-wait.service; static) Active: failed (Result: timeout) since Sat, 01 Dec 2012 19:19:48 +0800 Main PID: 866 CGroup: name=systemd:/system/plymouth-quit-wait.service This is on a Fedora 17 system, with nVidia closed source drivers installed via rpmfusion.

    Read the article

  • how to delete files owned by Apache ?

    - by Revolter
    I've installed a CMS on a shared host running Apache, now when I was deleting the root directory with FTP, some folders left with a "Permission denied" error and I can't change their attributes. the best explanation I've got is that the CMS installer has placed the files and has assigned its ownership to the Apache server instead of my user name. (i don't know it can be done) Ijust haven't use the uninstaller because I've lost my admin password - -" so how to delete those folders ?

    Read the article

  • Assembly - Read next sector of a virtual disk

    - by ali
    As any programmer in the world at least once in his/her life, I am trying to create my "revolutionary", the new and only one operating system. :D Well, I am using a virtual emulator (Oracle VM Virtual Box), for which I create a new unknwon operating system, with a vmdk disk. I like vmdk because they are just plain files, so I can paste my boot-loader over the first 512 bytes of the virtual hard disk. Now, I am trying to read the next sector of this virtual disk, on which I would paste a simple kernel that would display a message. I have two questions: Am I reading the second segment (the first -512 bytes- is occupied by the bootloader) correctly? CODE: CitesteDisc: mov bx, 0x8000 ; segment mov es, bx mov bx, 0x0000 ; offset mov ah, 0x02 ; read function mov al, 0x01 ; sectors - this might be wrong, trying to read from hd mov ch, 0x00 ; cylinder mov cl, 0x02 ; sector mov dh, 0x00 ; head mov dl, 0x80 ; drive - trying to read from hd int 0x13 ; disk int mov si, ErrorMessage ; - This will display an error message jc ShowMessage jmp [es:bx] ; buffer Here, I get the error message, after checking CF. However, if I use INT 13, 1 to get last status message, AL is 0 - so no error is saved. Am I pasting my simple kernel in the correct place inside the vmdk? What I do is pasting it after the 512th byte of the file, the first 512 bytes, as I said, are the boot-loader. The file would look like this: BE 45 7C E8 16 00 EB FE B4 0E B7 00 B3 07 CD 10 <- First sector C3 AC 08 C0 74 05 E8 EF FF EB F6 C3 B4 00 B2 80 CD 13 BE 5D 7C 72 F5 BB 00 80 8E C3 BB 00 00 B4 02 B0 06 B5 00 B1 01 B6 00 B2 07 CD 13 BE 4E 7C 72 CF 26 FF 27 57 65 6C 63 6F 6D 65 21 00 52 65 61 64 69 6E 67 20 65 72 72 6F 72 21 00 52 65 73 65 74 74 69 6E 67 20 65 72 72 6F 72 21 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 55 AA <- Boot-loader signature B4 0E B0 2E CD 10 EB FE 00 00 00 00 00 00 00 00 <- Start of the second sector 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 00 So, this is the way I am trying to add the kernel to the second sector. What do you think is wrong with this? Thanks!

    Read the article

< Previous Page | 1190 1191 1192 1193 1194 1195 1196 1197 1198 1199 1200 1201  | Next Page >