Search Results

Search found 1126 results on 46 pages for 'rajesh kumar g'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 12/46 | < Previous Page | 8 9 10 11 12 13 14 15 16 17 18 19  | Next Page >

  • Java EE deployment error

    - by Rajesh
    While deploying a particular project I'm getting deployment error like "module has not been deployed"... but I'm able to deploy other projects... the error shown is as follows In-place deployment at F:\onlineexam_1\build\web deploy?path=F:\onlineexam_1\build\web&name=onlineexam_1&force=true failed on GlassFish v3 Domain F:\onlineexam_1\nbproject\build-impl.xml:577: The module has not been deployed. BUILD FAILED (total time: 3 seconds)

    Read the article

  • scroll bar important query???

    - by rajesh
    Hello all, actually i downloaded code for scroll from....... http://sorgalla.com/jcarousel/ but when i added it in my page and add using code ... function addElement(url,imagePath){ alert(url); alert(imagePath); var container = document.getElementById('sncs'); items = container.getElementsByTagName("li"); //alert(items.length); var new_element = document.createElement('li'); new_element.innerHTML =""; //var raj='1'+new_element.innerHTML; //alert() new_element.className="jcarousel-item jcarousel-item-horizontal jcarousel-item-4 jcarousel-item-4-horizontal"; //container.insertBefore(new_element, container.firstChild); container.appendChild( new_element ); } it added li not at the end but below scroll what will be the problem..... Please help me to sort out this problem....

    Read the article

  • When i am adding eventHandler on combo in datagridview, its adding eventHandler to all other combo o

    - by Rajesh Rolen- DotNet Developer
    i am using VS2005 (c#.net desktop application). when i am adding eventHandler to a combo of datagridview, its automatically adding same eventhandler to all other combos of same datagridview.. my code: private void dgvtstestdetail_EditingControlShowing(object sender, DataGridViewEditingControlShowingEventArgs e) { DataGridView grid = (sender as DataGridView); if (grid.CurrentCell.OwningColumn == grid.Columns["gdvtstd_TestParameter"]) { ComboBox cb = (e.Control as ComboBox); cb.SelectedIndexChanged -= new EventHandler(dvgCombo_SelectedIndexChanged); cb.SelectedIndexChanged += new EventHandler(dvgCombo_SelectedIndexChanged); } }

    Read the article

  • How to write CData in xml

    - by Rajesh Rolen- DotNet Developer
    i have an xml like : <?xml version="1.0" encoding="UTF-8"?> <entry> <entry_id></entry_id> <entry_status></entry_status> </entry> i am writing data in it like: XmlNode xnode = xdoc.SelectSingleNode("entry/entry_status"); xnode.InnerText = "<![CDATA[ " + Convert.ToString(sqlReader["story_status"]) + " ]]>" ; but its change "<" to "&lt" of CDATA. Please tell me how to fill values in above xml as a CData format. i know that we can create CDATA like : XmlNode itemDescription = doc.CreateElement("description"); XmlCDataSection cdata = doc.CreateCDataSection("<P>hello world</P>"); itemDescription.AppendChild(cdata); item.AppendChild(itemDescription); but my process is to read node of xml and change its value not to append in it. Thanks

    Read the article

  • how to Send Parameter????

    - by rajesh
    Hi. I have problem that how can i can send image path to the function........ myn code is........ <a href="#" onclick="addElement(this.id);" id="cricket" tabindex="1">Cricket</a> i want to send my image path in the function addElement along with id..... Please somebody help.....

    Read the article

  • how to Send Parameter????

    - by rajesh
    Hi. I have problem that how can i can send image path to the function........ myn code is........ Cricket i want to send my image path in the function addElement along with id..... Please somebody help.....

    Read the article

  • Please Help me to create a replace function in vb.net

    - by Rajesh Rolen- DotNet Developer
    Please Help me in creating a replace function. Problem: Their is a alfanumeric value of any lenght (string) and i want to replace its all characters with 'X' except right four characters Like : Value : 4111111111111111 Result Should be: XXXXXXXXXXXX1111 I have created a function but got stuck: public function myfunction(str as string) str.Replace(str.Substring(0, str.Length - 5), 'X') 'but here i want no of x to be equvals to count of lenght of str - 4 end function please tell me a better fuction to perform such a operation

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How to create own dotnet obfuscator

    - by Rajesh Rolen- DotNet Developer
    I know that dot net dlls and exe contain their assemblies with them so every body can extract code from it. so to tell me how can i create my own dotnet obfuscator and tell me if their exist any other way to protect my application to deassemble. and plez dont give me link of any paid obfuscator. i would prefer code sample in c# or vb.net

    Read the article

  • How to tell visual studio that i have installed visual C# too?

    - by Rajesh Kumar
    I got visual studio 2005 express edition installed on my machine.But it did not contain any C# or web developer with it. So i later installed visual C# too. Now , I can create a C# project through visual C#. But I cant use visual studio for the same purpose. I guess there would be some mechanism to integrate visual C# with visual studio. Can anyone help me out?

    Read the article

  • Problem in datagridviewComboBoxColumn

    - by Rajesh Rolen- DotNet Developer
    In my datagridview , when in click on datagridviewComboBoxColumn to populate its dropdownlist it not show me dropdown list for that i need to click 2 times. at first time it just focus to datagridviewComboBoxColumn and on second click it populate its dropdown. but i want to populate its dropdownlist on single click. please help me out. i am using c#.net (vs 2005)

    Read the article

  • Apply CSS Style on all elements except with a SPECIFIC ID

    - by Rajesh Paul
    CSS Code(what I need) <style> div[id!='div1']// I actually needed an inequality operator for NOT EQUAL TO { font-size:40px; } </style> HTML code <body> <div>abc</div> <div>def</div> <div id='div1'>ghi</div> </body> The CSS didn't work as I intended. I actually wanted to define the style for all <div>-elements except the one with id='div1'. How can I do that?

    Read the article

  • stock trade app help

    - by Rajesh Kumar Chandra
    Ok my last post disapper so I ask again. Ok if you cant send me code to stock trading app, i understand its dificult for to get code from forum can you point me to techonologies to use for making stock app. i got job from online brocker copany, they need to display both bombay exchange and others java, or c . or asp maybe thanks

    Read the article

  • How can get autosuggest in cake php

    - by rajesh
    i hav entered my code in controller like below function keyup(){ $this-Note-simple(); if(strlen($searchq)0){ while ($row = mysql_fetch_array($getRecord)) { echo $row['name']; echo $row['department']; } return $row; } } as soon as i entered this one it doesn't display any info .... what correction should require.......

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 8 9 10 11 12 13 14 15 16 17 18 19  | Next Page >