Search Results

Search found 4517 results on 181 pages for 'expression sketchflow'.

Page 126/181 | < Previous Page | 122 123 124 125 126 127 128 129 130 131 132 133  | Next Page >

  • What logic operator to use, as3?

    - by VideoDnd
    What operator or expression can I use that will fire on every number, including zero? I want a logic operator that will fire with ever number it receives. My animations pause at zero. This skips on zero if (numberThing> 0); This skips on 9 if (numberThing>> 0); This jitters 'fires quickly and goes back on count' if (numberThing== 0); EXPLANATION I'm catching split string values in a logic function, and feeding them to a series of IF, ELSE IF statements. I'm using this with a timer, so I can measure the discrepency. CODE • I GET VALUES FROM TIMER • STRING GOES TO TEXTFIELD 'substr' • NUMBER TRIGGERS TWEENS 'parseInt' • Goes to series of IF and ELSE IF statements

    Read the article

  • Create Sum of calculated rows in Microsoft Reporting Services

    - by kd7iwp
    This seems like it should be simple but I can't find anything yet. In Reporting Services I have a table with up to 6 rows that all have calculated values and dynamic visibility. I would like to sum these rows. Basically I have a number of invoice items and want to make a total. I can't change anything on the DB side since my stored procedures are used elsewhere in the system. Each row pulls data from a different dataset as well, so I can't do a sum of the dataset. Can I sum all the rows with a table footer? Similarly to totaling a number of rows in Excel? It seems very redundant to put my visibility expression from each row into my footer row to calculate the sum.

    Read the article

  • jQuery 1.4.x and the @ symbol

    - by David
    I used to use this script for jquery email obfuscation: $(".replaceAt").replaceWith("@"); $(".obfuscate").each(function () { $(this).attr("href", "mailto:"+$(this).text()); }); <a class="obfuscate">name<span class="replaceAt">-AT-</span>server.com</a> But with jQuery 1.4.x, I now get this error: uncaught exception: Syntax error, unrecognized expression: @ Looking this up on the net, it looks like jQuery thinks that the @ is a special character. I tried to "\@" it and a few other things with not luck. I'm not enough of a jQuery ninja to know how to fix this. Any ideas?

    Read the article

  • regex to format a float in php

    - by Itamar Bar-Lev
    I have a PHP function for formatting a float to a given amount of decimal points that uses number_format(), and then removes the unneeded zeros (and also the '.' if possible): $float = number_format($float, $decimalPlaces, '.', ''); for ($i = 0; $i < $decimalPlaces; $i++) { if (substr($float, strlen($float) - 1, strlen($float)) == '0') { $float = substr($float, 0, strlen($float) - 1); } } if (substr($float, strlen($float) - 1, strlen($float)) == '.') { $float = substr($float, 0, strlen($float) - 1); } Is it possible to do so more effectively with a regular expression?

    Read the article

  • Visual Studio confused by server code inside javascript

    - by Felix
    I ran into an annoying problem: the following code gives a warning in Visual Studio. <script type="text/javascript"> var x = <%: ViewData["param"] %>; </script> The warning is "Expected expression". Visual Studion gets confused, and all the javascript code after that is giving tons of warnings. Granted, it's all warnings, and it works perfectly fine in runtime - but it is very easy to miss real warnings among dozen of false positives. It was working the same way in VS2008, and it wasn't fixed in VS2010. Does anybody know if there is a workaround, or a patch?

    Read the article

  • Using Regex groups in bash

    - by AlexeyMK
    Greetings, I've got a directory with a list of pdfs in it: file1.pdf, file2.pdf, morestuff.pdf ... etc. I want to convert these pdfs to pngs, ie file1.png, file2.png, morestuff.png ... etc. The basic command is, convert from to, But I'm having trouble getting convert to rename to the same file name. The obvious 'I wish it worked this way' is convert *.pdf *.png But clearly that doesn't work. My thought process is that I should utilize regular expression grouping here, to say somethink like convert (*).pdf %1.png but that clearly isn't the right syntax. I'm wondering what the correct syntax is, and whether there's a better approach (that doesn't require jumping into perl or python) that I'm ignoring. Thanks!

    Read the article

  • (type theoretical) How is ([] ==) [] typed in haskell?

    - by Ingo
    It sounds silly, but I can't get it. Why can the expression [] == [] be typed at all? More specifically, which type (in class Eq) is inferred to the type of list elements? In a ghci session, I see the following: Prelude> :t (==[]) (==[]) :: (Eq [a]) => [a] -> Bool But the constraint Eq [a] implies Eq a also, as is shown here: Prelude> (==[]) ([]::[IO ()]) <interactive>:1:1: No instance for (Eq (IO ())) arising from use of `==' at <interactive>:1:1-2 Probable fix: add an instance declaration for (Eq (IO ())) In the definition of `it': it = (== []) ([] :: [IO ()]) Thus, in []==[], the type checker must assume that the list element is some type a that is in class Eq. But which one? The type of [] is just [a], and this is certainly more general than Eq a = [a].

    Read the article

  • How to regex match a string of alnums and hyphens, but which doesn't begin or end with a hyphen?

    - by Shahar Evron
    I have some code validating a string of 1 to 32 characters, which may contain only alpha-numerics and hyphens ('-') but may not begin or end with a hyphen. I'm using PCRE regular expressions & PHP (albeit the PHP part is not really important in this case). Right now the pseudo-code looks like this: if (match("/^[\p{L}0-9][\p{L}0-9-]{0,31}$/u", string) and not match("/-$/", string)) print "success!" That is, I'm checking first that the string is of right contents, doesn't being with a '-' and is of the right length, and then I'm running another test to see that it doesn't end with a '-'. Any suggestions on merging this into a single PCRE regular expression? I've tried using look-ahead / look-behind assertions but couldn't get it to work.

    Read the article

  • How do I create regex groups for replacement?

    - by resting
    I have this sample string: Image: SGD$45.32 SKU: 3f3f3 dfdfd grg4t BP 6yhf Pack Size: 1000's Color: Green Price: SGD$45.32 SGD$45... I would like to remove all the prices namely: SGD$45.32 Price: SGD$45.32 SGD$45 I have this expression thats supposed to match the 3 groups: $pattern = '/(Price.+\sSGD\$\d+\.\d{2})(SGD\$\d+\.\d{2})(SGD\$\d+)/'; $new_snippet = preg_replace($pattern, '', $snippet);` But apparently its not working. It works if I replace a single group at a time. But, I'd like to know if it possible to replace all possible matching groups with a single statement. Tried preg_match_all($pattern, $snippet, $matches); to show matches based on the above pattern, but no matches are found if I put all 3 groups together.

    Read the article

  • Using DateDiff in Entity Framwork on a SQL CE database

    - by deverop
    I have a method which should return a list of anonymous objects with a calculated column like this: var tomorrow = DateTime.Today.AddDays(1); return from t in this.Events where (t.StartTime >= DateTime.Today && t.StartTime < tomorrow && t.EndTime.HasValue) select new { Client = t.Activity.Project.Customer.Name, Project = t.Activity.Project.Name, Task = t.Activity.Task.Name, Rate = t.Activity.Rate.Name, StartTime = t.StartTime, EndTime = t.EndTime.Value, Hours = (System.Data.Objects.SqlClient.SqlFunctions.DateDiff("m", t.StartTime, t.EndTime.Value) / 60), Description = t.Activity.Description }; Unfortunately I get the following error from the DateDiff function: The specified method 'System.Nullable1[System.Int32] DateDiff(System.String, System.Nullable1[System.DateTime], System.Nullable`1[System.DateTime])' on the type 'System.Data.Objects.SqlClient.SqlFunctions' cannot be translated into a LINQ to Entities store expression. Any ideas what I could have done wrong here? EDIT: I also tried the EntityFunctions class mentioned here, but that did not work as well. Minutes = EntityFunctions.DiffMinutes(t.EndTime, t.StartTime),

    Read the article

  • Check for default value of attribute in XPath

    - by iref
    Hi, i have XML schema: <xsd:complexType name="contactsType"> <xsd:sequence> <xsd:element name="contact" type="contactType" minOccurs="0" maxOccurs="unbounded"/> </xsd:sequence> <xsd:attribute name="visible" type="xsd:boolean" default="true"/> </xsd:complexType> and i want to find all contacts which have @visible=true, //contacts[@visible='true'] but this expression doesn' t return nodes without set @visible like this: <contacts /> so i want to know if there is any function in XPath which returns also default values of attributes Thanks Jan

    Read the article

  • Some unclear PHP syntax

    - by serhio
    I am a PHP beginner and saw on the forum this PHP expression: $regex = <<<'END' / ( [\x00-\x7F] # single-byte sequences 0xxxxxxx | [\xC0-\xDF][\x80-\xBF] # double-byte sequences 110xxxxx 10xxxxxx | [\xE0-\xEF][\x80-\xBF]{2} # triple-byte sequences 1110xxxx 10xxxxxx * 2 | [\xF0-\xF7][\x80-\xBF]{3} # quadruple-byte sequence 11110xxx 10xxxxxx * 3 ) | ( [\x80-\xBF] ) # invalid byte in range 10000000 - 10111111 | ( [\xC0-\xFF] ) # invalid byte in range 11000000 - 11111111 /x END; Is this code correct? What do these strange (for me) constructions like <<<, 'END', /, /x, and END; mean? I recieve: Parse error: syntax error, unexpected T_SL in /home/vhosts/mysite.com/public_html/mypage.php on line X Thanks

    Read the article

  • Run time error '3075' in Access 2007

    - by Thys
    I am getting the following error when I try to open a report in Access 2007. The code works fine in Access 2003. run time error '3075' Syntax error (missing operator) in query expression '[COUNTRY_ID]=' here is the code giving the error... How could I fix this? Private Sub List25_Click() Combo20.SetFocus 'DoCmd.FindRecord List25.ItemData(List25.ListIndex) Forms![Country Rate Administration].Filter = "[COUNTRY_ID]=" & List25.ItemData(List25.ListIndex) Forms![Country Rate Administration].FilterOn = True End Sub Thansk in advance for your help!

    Read the article

  • Replace text in string with delimeters using Regex

    - by user1057735
    I have a string something like, string str = "(50%silicon +20%!(20%Gold + 80%Silver)| + 30%Alumnium)"; I need a Regular Expression which would Replace the contents in between ! and | with an empty string. The result should be (50%silicon +20% + 30%Alumnium). If the string contains something like (with nested delimiters): string str = "(50%silicon +20%!(80%Gold + 80%Silver + 20%!(20%Iron + 80%Silver)|)| + 30%Alumnium)"; The result should be (50%silicon +20% + 30%Alumnium) - ignoring the nested delimiters. I've tried the following Regex, but it doesn't ignore the nesting: Regex.Replace(str , @"!.+?\|", "", RegexOptions.IgnoreCase);

    Read the article

  • VB to C# conversion incongruency with lambdas

    - by Jason
    I have a bit of code that I have been tasked with converting to C# from VB. A snippet of mine seems like it cannot be converted from one to the other, and if so, I just don't know how to do it and am getting a little frustrated. Here's some background: OrderForm is an abstract class, inherited by Invoice (and also PurchaseOrder). The following VB snippet works correctly: Dim Invs As List(Of OrderForm) = GetForms(theOrder.OrderID) .... Dim inv As Invoice = Invs.Find( Function(someInv As Invoice) thePO.SubPONumber = someInv.SubInvoiceNumber) In C#, the best I came to converting this is: List<OrderForm> Invs = GetForms(theOrder.OrderID); .... Invoice inv = Invs.Find( (Invoice someInv) => thePO.SubPONumber == someInv.SubInvoiceNumber); However, I get the following error when I do this: Cannot convert lambda expression to delegate type 'System.Predicate' because the parameter types do not match the delegate parameter types Is there any way to fix this without restructuring my whole codebase?

    Read the article

  • Copy constructor demo (crashing... case 2)

    - by AKN
    Please have a glance at this program: class CopyCon { public: char *name; CopyCon() { name = new char[20]; name = "Hai";//_tcscpy(name,"Hai"); } CopyCon(const CopyCon &objCopyCon) { name = new char[_tcslen(objCopyCon.name)+1]; _tcscpy(name,objCopyCon.name); } ~CopyCon() { if( name != NULL ) { delete[] name; name = NULL; } } }; int main() { CopyCon obj1; CopyCon obj2(obj1); cout<<obj1.name<<endl; cout<<obj2.name<<endl; } This program crashes on execution. Error: "Expression: _BLOCK_TYPE_IS_VALID(pHead-nBlockUse)" If I assign "Hai" to name using aasignment operator, its crashing. Where as when I use string func _tcscpy to assign "Hai" to name, its working perfectly. Can some one explain why so?

    Read the article

  • Boolean data type size and want to print its value?

    - by Vineet
    I want to know data data type of boolean , i used VSIZE() function but it is not working for boolean and Want to print and store boolean value into table. Please let me know how oracle store boolean value ,is there any other way to see data type and value for boolean variable. ERROR " expression is of wrong type" DECLARE a boolean; b number(7):=7; c number(2):=2; BEGIN a:=bc; select vsize(a) into b from dual; dbms_output.put_line(b); END;

    Read the article

  • Function Pointer from base class

    - by camelord
    Hi there, i need a Function Pointer from a base class. Here is the code: class CActionObjectBase { ... void AddResultStateErrorMessage( const char* pcMessage , ULONG iResultStateCode); ... } CActionObjectCalibration( ): CActionObjectBase() { ... m_Calibration = new CCalibration(&CActionObjectBase::AddResultStateErrorMessage); } class CCalibration { ... CCalibration(void (CActionObjectBase::* AddErrorMessage)(const char*, ULONG )); ... void (CActionObjectBase::* m_AddErrorMessage)(const char*, ULONG ); } Inside CCalibration in a Function occurs the Error. I try to call the Function Pointer like this: if(m_AddErrorMessage) { ... m_AddErrorMessage("bla bla", RSC_FILE_ERROR); } The Problem is, that I cannot compile. The Error Message says something like: error C2064: Expression is no Function, that takes two Arguments. What is wrong? regards camelord

    Read the article

  • Numbering Regex Submatches

    - by gentlylisped
    Is there a canonical ordering of submatch expressions in a regular expression? For example: What is the order of the submatches in "(([0-9]{3}).([0-9]{3}).([0-9]{3}).([0-9]{3}))\s+([A-Z]+)" ? a. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([A-Z]+) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) b. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([A-Z]+) or c. somthin' else.

    Read the article

  • Perl Regex Multiple Items in Single String

    - by Sho Minamimoto
    I'm trying to parse a single string and get multiple chunks of data out from the same string with the same regex conditions. I'm parsing a single HTML doc that is static (For an undisclosed reason, I can't use an HTML parser to do the job.) I have an expression that looks like $string =~ /\<img\ssrc\="(.*)"/; and I want to get the value of $1. However, in the one string, there are many img tags like this, so I need something like an array returned (@1?) is this possible?

    Read the article

  • What's the official Microsoft way to track counts of dynamic controls to be reconstructed upon Postback?

    - by John K
    When creating dynamic controls based on a data source of arbitrary and changing size, what is the official way to track exactly how many controls need to be rebuilt into the page's control collection after a Postback operation (i.e. on the server side during the ASP.NET page event lifecycle) specifically the point at which dynamic controls are supposed to be rebuilt? Where is the arity stored for retrieval and reconstruction usage? By "official" I mean the Microsoft way of doing it. There exist hacks like Session storage, etc but I want to know the bonafide or at least Microsoft-recommended way. I've been unable to find a documentation page stating this information. Usually code samples work with a set of dynamic controls of known numbers. It's as if doing otherwise would be tougher. Update: I'm not inquiring about user controls or static expression of declarative controls, but instead about dynamically injecting controls completely from code-behind, whether they be mine, 3rd-party or built-in ASP.NET controls.

    Read the article

  • How do you fix the Silverlight application shift that occurs in the Firefox browser?

    - by Roy
    Hi, Currently I have an Silverlight application that when run on Firefox browser (ver 3.6) the entire contents of the Silverlight application shifts a little, and also the scrollbars on both the bottom and the side appear when I first use it. This does not happen in IE 8. How can I fix this in Firefox so it doesn't happen? The project type I created was the "Silverlight 3 Application + Website" via Expression Blend 3. This the code I am using in my MainPage.xaml: <UserControl xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" x:Class="StackoverflowExample.MainPage" Width="640" Height="480"> <Grid x:Name="LayoutRoot" Background="Green"> <Rectangle Fill="#FFBB2020" Stroke="Black" Margin="155,58,266,178"/> <Button Margin="199,180,302,236" Content="Button"/> </Grid> </UserControl>

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Mixed Table Type with other types as parameters to Stored Procedured c#

    - by amemak
    Hi, I am asking about how could i pass multi parameters to a stored procedure, one of these parameters is user defined table. When I tried to do it it shows this error: INSERT INTO BD (ID, VALUE, BID) values( (SELECT t1.ID, t1.Value FROM @Table AS t1),someintvalue) here @Table is the user defined table parameter. Msg 116, Level 16, State 1, Procedure UpdateBD, Line 12 Only one expression can be specified in the select list when the subquery is not introduced with EXISTS. Msg 109, Level 15, State 1, Procedure UpdateBD, Line 11 There are more columns in the INSERT statement than values specified in the VALUES clause. The number of values in the VALUES clause must match the number of columns specified in the INSERT statement. Thank you

    Read the article

  • Can't enumerate LinQ results with left join

    - by nvtthang
    var itemSet = from item in da.GetList<Models.account>() join file in objFileStorageList on item.account_id equals file.parent_id into objFile from fileItem in objFile.DefaultIfEmpty() where item.company != null && item.company.company_id == 123 orderby item.updatedDate descending select new { Id = item.account_id, RefNo = item.refNo, StartDate = item.StartDate , EndDate = item.EndDate , Comment = item.comment, FileStorageID = fileItem != null ? fileItem.fileStorage_id : -1, Identification = fileItem != null ? fileItem.identifier : null, fileName = fileItem != null ? fileItem.file_nm : null }; It raises error message when I try to enumerate through collection result from Linq query above. LINQ to Entities does not recognize the method 'System.Collections.Generic.IEnumerable1[SCEFramework.Models.fileStorage] DefaultIfEmpty[fileStorage](System.Collections.Generic.IEnumerable1[SCEFramework.Models.fileStorage])' method, and this method cannot be translated into a store expression foreach (var item in itemSet) { string itemRef= item.RefNo; } Please suggest me any solutions. Thanks in advance.

    Read the article

< Previous Page | 122 123 124 125 126 127 128 129 130 131 132 133  | Next Page >