Search Results

Search found 567 results on 23 pages for 'amit singh tomar'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 13/23 | < Previous Page | 9 10 11 12 13 14 15 16 17 18 19 20  | Next Page >

  • Abstract class over Interfaces in ADO.Net Environment

    - by Amit Ranjan
    I am developing a web app but is not satisfied with is architecture that I am following. The architecture is plain old conventional 3 tier architecture. What i want is follow some design pattern or architecture that will be help me in decoupling my code. I have idea about MVC and MVP architectures for Web App but i need different from that. I want to use OOPS concepts using abstract classes and interfaces, polymorphism etc in my app but not MVC and MVP. I dont know why? I havent tried any ado.net application earlier via abstract class or interfaces, so i need your help. Thanks

    Read the article

  • Brackets matching using BIT

    - by amit.codename13
    edit: I was trying to solve a spoj problem. Here is the link to the problem : http://spoj.pl/problems/BRCKTS I can think of two possible data structures for solving the problem one using segment tree and the other using a BIT. I have already implemented the solution using a segment tree. I have read about BIT but i can't figure out how to do a particular thing with it(which i have mentioned below) I am trying to check if brackets are balanced in a given string containing only ('s or )'s. I am using a BIT(Binary indexed tree) for solving the problem. The procedure i am following is as follows: I am taking an array of size equal to the number of characters in the string. I am assigning -1 for ) and 1 for ( to the corresponding array elements. Brackets are balanced in the string only if the following two conditions are true. The cumulative sum of the whole array is zero. Minimum cumulative sum is non negative. i.e the minimum of cumulative sums of all the prefixes of the array is non-negative. Checking condition 1 using a BIT is trivial. I am facing problem in checking condition 2.

    Read the article

  • search engine crawling frequency

    - by Aditya Pratap Singh
    I want to design a search engine for news websites ie. download various article pages from these websites, index the pages, and answer search queries on the index. I want a short pseudocode to find an appropriate crawling frequency -- i do not want to crawl too often because the website may not have changed, and do not want to crawl too infrequently because index would then be out of date. Assume that crawling code looks as follows while(1) { sleep(sleep_interval); // sleep for sleep_interval crawl(website); // crawls the entire website diff = diff(currently_crawled_website, previously_crawled_website); // returns a % value of difference between the latest and previous crawls of the website sleep_interval = infer_sleep_interval(diff, sleep_interval); } looking for a pseudocode for the infer_sleep_interval method: long sleep_interval infer_sleep_interval(int diff_percentage,long previous_sleep_interval) { ... ... ... } i want to design method which adaptively alters the sleeping interval based on the update frequency of the website.

    Read the article

  • jQuery - events won't fire for dynamically created tab elements..

    - by Amit
    Hi, I am using jQuery UI Tabs. <div id="tabs"> <ul id="tablist"> <li><a href="#fragment-1"><span>One</span></a></li> </ul> </div> I have a button that adds new tabs. I use the following code: var newTabId = $('#tabs').tabs('option', 'selected') + 1; $('#tabs').tabs("add",'someUrl.htm','New Tab',newTabId); (Tab will be added next to the currently selected tab) Now none of the newly added tabs fire any events such as a click or hover $('#tablist li').click(function(){ alert('test message'); }); But events fire properly for the tabs that were there in the initial source code. How to resolve?

    Read the article

  • How to edit javascript in browser?

    - by Amit
    Hi I was looking for a way to edit javascript in browser such as firefox on the fly and execute it. Firebug allows us to edit html and css on the fly but javascript is a pain.... i have to go back to the source and modify that.. Is there a way to do it?

    Read the article

  • Trying to insert a row using stored procedured with a parameter binded to an expression.

    - by Arvind Singh
    Environment: asp.net 3.5 (C# and VB) , Ms-sql server 2005 express Tables Table:tableUser ID (primary key) username Table:userSchedule ID (primary key) thecreator (foreign key = tableUser.ID) other fields I have created a procedure that accepts a parameter username and gets the userid and inserts a row in Table:userSchedule Problem: Using stored procedure with datalist control to only fetch data from the database by passing the current username using statement below works fine protected void SqlDataSourceGetUserID_Selecting(object sender, SqlDataSourceSelectingEventArgs e) { e.Command.Parameters["@CurrentUserName"].Value = Context.User.Identity.Name; } But while inserting using DetailsView it shows error Procedure or function OASNewSchedule has too many arguments specified. I did use protected void SqlDataSourceCreateNewSchedule_Selecting(object sender, SqlDataSourceSelectingEventArgs e) { e.Command.Parameters["@CreatedBy"].Value = Context.User.Identity.Name; } DetailsView properties: autogen fields: off, default mode: insert, it shows all the fields that may not be expected by the procedure like ID (primary key) not required in procedure and CreatedBy (user id ) field . So I tried removing the 2 fields from detailsview and shows error Cannot insert the value NULL into column 'CreatedBy', table 'D:\OAS\OAS\APP_DATA\ASPNETDB.MDF.dbo.OASTest'; column does not allow nulls. INSERT fails. The statement has been terminated. For some reason parameters value is not being set. Can anybody bother to understand this and help?

    Read the article

  • Super class variables not printing through sub class

    - by Abhishek Singh
    Can u tell me why this code is not displaying any result on the console. class employee { protected String name; protected double salary; protected String dob; public employee(String name, double salary, String dob) { this.name = name; this.salary = salary; this.dob = dob; } public employee(String name, double salary) { this.name = name; this.salary = salary; } } public class Manage extends employee { String dept1; public Manage(String name, double salary, String dob, String dept1) { super(name, salary, dob); this.dept1 = dept1; } public Manage(String name, double salary, String dept1) { super(name, salary); this.dept1 = dept1; } public static void main(String args[]) { employee e = new employee("Vikas", 122345); employee e2 = new employee("Vikas", 122345, "12-2-1991"); Manage m = (Manage) new Manage("Vikas", 122345, "Sales"); Manage m2 = new Manage("Vikas", 122345, "12-2-1991", "sales"); m.display(); m2.display(); } public void display() { System.out.println("Name " + name); System.out.println("Salary " + salary); System.out.println("Birth " + dob); System.out.println("Department " + dept1); } }

    Read the article

  • Cordova - Scrolling with a fixed header and footer (ios)

    - by Samu Singh
    Using Cordova (phonegap) & bootstrap to make a mobile application, testing on IOS for now. Getting an issue with a header and footer bar that are fixed with scrollable content in the middle. When tapping to scroll, the header/footer bar moves down or up with the content but then snaps back to place as soon as the scrolling completes. If I use -webkit-overflow-scrolling: touch; it works as expected, but it makes it really awkward to scroll through the content, and if you scroll passed the end, it only scrolls the header or footer (with elastic overflow) until you stop for a second. here's my html for the header/footer bars: <div id="headerBar"> <div class="container-fluid" style="background-color: #1569C7"> <div class="row"> <div class="col-xs-3 text-left"> <button id="logoutButton" type="button" class="btn btn-default"> Log Out </button> <button type="button" class="btn btn-default" id="restoreQuestionFeedButton"> <span class="glyphicon glyphicon-chevron-left"></span> </button> </div> <div class="col-xs-6 text-center" style="height: 55px"> <strong id="usernameText"></strong> </div> <div class="col-xs-3 text-right"> <button id="oldCreatQuestionButton" type="button" class="btn btn-default"> <span class="glyphicon glyphicon-plus"></span> </button> </div> </div> </div> </div> <div id="footerBar"> <div class="container-fluid" style="padding: 0"> <div class="row text-center"> <button id="createQuestionButton" type="button" class="btn btn-default footerButton"> <span class="glyphicon glyphicon-plus"></span> <strong>Ask a new free question!</strong> </button> </div> </div> </div> And here is the related CSS: #headerBar { position: fixed; z-index: 100; top: 0; left: 0; width: 100%; background-color: #1569C7; } #footerBar { position: fixed; z-index: 100; bottom: 0; left: 0; width: 100%; background-color: #1569C7 !important; }

    Read the article

  • using internationalization on list data

    - by singh
    i am using Struts2 in application. <s:iterator value="listObject"> <s:component template="abc.vm"> <s:param name="text" value="listValue" /> <s:param name="prefix" value="listIndex" /> </s:component> </s:iterator> listValue is a values of list. i am using iterator to traverse the list. now on listValue, i want to put here internationalization concept.so that all the list value can be display based on Locale which store in a list. please suggest!

    Read the article

  • Serelization of a class and its sub-class....

    - by Amit
    There is a main class having 2 subClasses(each represent separate entity) and all classes needs to be serialized.. how should I proceed ? My requirement is when I serelize MainClass, I should get the xml for each sub class and main class as well. Thanks in advance... and if my approach is incorrect... correct that as well.. Ex given below... class MainClass { SubClass1 objSubclass1 = null; SubClass2 objSubclass2 = null; public MainClass() { objSubclass1 = new SubClass1(); objSubclass2 = new SubClass2(); } [XmlElement("SubClass1")] public SubClass1 SubClass1 {get {return objSubclass1;} } [XmlElement("SubClass2")] public SubClass2 SubClass2 {get {return objSubclass2;} } } Class SubClass1 { Some properties here... } Class SubClass2 { Some properties here... }

    Read the article

  • SQL query for getting data in two fields from one column.

    - by AmiT
    I have a table [Tbl1] containing two fields. ID as int And TextValue as nvarchar(max) Suppose there are 7 records. I need a resultset that has two columns Text1 and Text2. The Text1 should have first 4 records and Text2 should have remaining 3 records. [Tbl1] ID | TextValue 1. | Apple 2. | Mango 3. | Orange 4. | Pineapple 5. | Banana 6. | Grapes 7. | Sapota Now, the result-set should have Text1 | Text2 Apple | Banana Mango | Grapes Orange | Sapota Pineapple |

    Read the article

  • Sending URL as a parameter using javascript

    - by Prashant Singh
    I have to send a name and a link from client side to the server. I thought of using AJAX called by Javascript to do this. This is what I mean. I wished to make an ajax request to a file called abc.php with parameters :- 1. http://thumbs2.ebaystatic.com/m/m7dFgOtLUUUSpktHRspjhXw/140.jpg 2. Apple iPod touch, 3rd generation, 32GB To begin with, I encoded the URL and tried to send it. But the server says status Forbidden Any solution to this ? UPDATE :: It end up calling to http://abc.com/addToWishlist.php?rand=506075547542422&image=http://thumbs1.ebaystatic.com/m/mO64jQrMqam2jde9aKiXC9A/140.jpg&prod=Flat%20USB%20Data%20Sync%20Charging%20Charger%20Cable%20Apple%20iPhone%204G%204S%20iPod%20Touch%20Nano Javascript Code :: function addToWishlist(num) { var myurl = "addToWishlist.php"; var myurl1 = myurl; myRand = parseInt(Math.random()*999999999999999); var rand = "?rand="+myRand ; var modurl = myurl1+ rand + "&image=" + encodeURI(storeArray[num][1]) + "&prod=" + encodeURI(storeArray[num][0]); httpq2.open("GET", modurl, true); httpq2.onreadystatechange = useHttpResponseq2; httpq2.send(null); } function useHttpResponseq2() { if (httpq2.readyState == 4) { if(httpq2.status == 200) { var mytext = httpq2.responseText; document.getElementById('wish' + num).innerHTML = "Added to your wishlist."; } } } Server Code <?php include('/home/ankit/public_html/connect_db.php'); $image = $_GET['image']; $prod = $_GET['prod']; $id = $_GET['id']; echo $prod; echo $image; ?> As I mentioned, its pretty basics More Updates : On trying to send a POST request via AJAX to the server, it says :- Refused to set unsafe header "Content-length" Refused to set unsafe header "Connection"

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Preloading and caching of images in silverlight

    - by Prabhjot Singh
    Hi there I have a silverlight application in vs2010 and iam using silverlight 4.0. I have to show a videoppt in which a video is synchronised with images and it runs as a video powerpoint presentation. Is it possible to preload the images or cache them, so that they get rendered as soon as the video starts. If there is a way out, plz guide me.

    Read the article

  • How we set or get focus to any control - and leave the focus in COCOA

    - by Amit Battan
    Hi All How we set or get focus on any control in cocoa. like setfirstresponder We have 2 control A and B, A is firstresponder After action I want to set focus ob B control and also how we get focus on a particular control and how we notify that leave focus..... I need it in validation .... I want to force user to fill a textfield and then go to next field..something like this Thanks Deepika

    Read the article

  • UIImage resize and crop to fit

    - by Amit Hagin
    I read a lot, also here, but couldn't find a simple way to do it: In objective c - I have a big UIImage and a small UIImageView. I want to programmatically shrink the content of a UIImage just enough to fit the smaller dimension within the UIImageView. The larger dimension will be cropped, and the result will be the maximum I can get from an image without changing the proportion. can you please help me?

    Read the article

  • Getting custom attribute from an Exception thrown during testing

    - by Amit Bhargava
    I'm using JUnit4 to test my code. Now, I'm aware that the following annotation allows me to expect an exception of a certain type @Test(expected = NipException.class) However, I have an 'errorCode' property in my exception class which I would also like to verify. This is because the same exception is thrown at three places in the same method with different error codes. How do I access 'errorCode' of the thrown exception?

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 9 10 11 12 13 14 15 16 17 18 19 20  | Next Page >