Search Results

Search found 814 results on 33 pages for 'chinna 82'.

Page 13/33 | < Previous Page | 9 10 11 12 13 14 15 16 17 18 19 20  | Next Page >

  • wireless is disabled by hardware lenovo 3000g430

    - by sudheer
    sir i have problem with my wifi switch sir please tell me solution for my problem (wifi is disabled by hardware). output of sudo lshw -C network is sudo] password for sudheer: *-network DISABLED description: Wireless interface product: BCM4312 802.11b/g LP-PHY vendor: Broadcom Corporation physical id: 0 bus info: pci@0000:06:00.0 logical name: eth2 version: 01 serial: 00:21:00:72:3a:93 width: 64 bits clock: 33MHz capabilities: pm msi pciexpress bus_master cap_list ethernet physical wireless configuration: broadcast=yes driver=wl0 driverversion=5.100.82.38 latency=0 multicast=yes wireless=IEEE 802.11bg resources: irq:19 memory:f4700000-f4703fff *-network description: Ethernet interface product: NetLink BCM5906M Fast Ethernet PCI Express vendor: Broadcom Corporation physical id: 0 bus info: pci@0000:07:00.0 logical name: eth0 version: 02 serial: 00:1e:68:ad:24:0b size: 100Mbit/s capacity: 100Mbit/s width: 64 bits clock: 33MHz capabilities: pm vpd msi pciexpress bus_master cap_list ethernet physical tp 10bt 10bt-fd 100bt 100bt-fd autonegotiation configuration: autonegotiation=on broadcast=yes driver=tg3 driverversion=3.121 duplex=full firmware=sb v3.04 ip=172.16.52.79 latency=0 link=yes multicast=yes port=twisted pair speed=100Mbit/s resources: irq:47 memory:f4600000-f460ffff output of iwconfig is lo no wireless extensions. eth2 IEEE 802.11 Access Point: Not-Associated Link Quality:5 Signal level:0 Noise level:0 Rx invalid nwid:0 invalid crypt:0 invalid misc:0 eth0 no wireless extensions. sudheer@sudheer:~$ sudo iwlistscanning sudo: iwlistscanning: command not found ***sudheer@sudheer:~$ sudo iwlist scanning*** lo Interface doesn't support scanning. eth2 Failed to read scan data : Invalid argument eth0 Interface doesn't support scanning.

    Read the article

  • SD Card only mounted after a reboot

    - by hattenn
    I have a Kingston 2GB MicroSD and I plug it in via an inconix MicroSD Adapter to the internal card reader of my Samsung N210 Netbook with Ubuntu 10.10, but it doesn't show up. Only if I reboot the system when the card's plugged in it shows up. Why does it need a reboot for mounting? sudo fdisk -l gives the output below. But I can only see the drive when I reboot the computer while the card's plugged. Disk /dev/sda: 160.0 GB, 160041885696 bytes 255 heads, 63 sectors/track, 19457 cylinders Units = cylinders of 16065 * 512 = 8225280 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x9a5a7990 Device Boot Start End Blocks Id System /dev/sda1 1 1959 15728640 27 Unknown Partition 1 does not end on cylinder boundary. /dev/sda2 * 1959 1972 102400 7 HPFS/NTFS /dev/sda3 1972 18992 136718750 83 Linux /dev/sda4 18992 19458 3738625 5 Extended /dev/sda5 18992 19458 3738624 82 Linux swap / Solaris Disk /dev/sdb: 1973 MB, 1973420032 bytes 60 heads, 59 sectors/track, 1088 cylinders Units = cylinders of 3540 * 512 = 1812480 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x00000000 Device Boot Start End Blocks Id System /dev/sdb1 1 1089 1927100+ 6 FAT16

    Read the article

  • Dell inspiron not finding Vodafone router

    - by Jeggy
    I have a "Dell inspiron 1564" and ubuntu doesn't find my friends router it works great at home, he has a vodafone router jeggy@jeggy-XPS:~$ sudo lshw -C network *-network description: Wireless interface product: BCM4312 802.11b/g LP-PHY vendor: Broadcom Corporation physical id: 0 bus info: pci@0000:04:00.0 logical name: eth1 version: 01 serial: 78:e4:00:2a:d1:eb width: 64 bits clock: 33MHz capabilities: pm msi pciexpress bus_master cap_list ethernet physical wireless configuration: broadcast=yes driver=wl0 driverversion=5.100.82.38 latency=0 multicast=yes wireless=IEEE 802.11bg resources: irq:17 memory:f0200000-f0203fff *-network description: Ethernet interface product: RTL8101E/RTL8102E PCI Express Fast Ethernet controller vendor: Realtek Semiconductor Co., Ltd. physical id: 0 bus info: pci@0000:05:00.0 logical name: eth0 version: 02 serial: b8:ac:6f:67:32:52 size: 10Mbit/s capacity: 100Mbit/s width: 64 bits clock: 33MHz capabilities: pm msi pciexpress msix vpd bus_master cap_list rom ethernet physical tp mii 10bt 10bt-fd 100bt 100bt-fd autonegotiation configuration: autonegotiation=on broadcast=yes driver=r8169 driverversion=2.3LK-NAPI duplex=half firmware=N/A latency=0 link=no multicast=yes port=MII speed=10Mbit/s resources: irq:42 ioport:3000(size=256) memory:f0410000-f0410fff memory:f0400000-f040ffff memory:f0420000-f043ffff *-network description: Ethernet interface physical id: 4 logical name: ham0 serial: 7a:79:05:ff:3e:ec size: 10Mbit/s capabilities: ethernet physical configuration: autonegotiation=off broadcast=yes driver=tun driverversion=1.6 duplex=full firmware=N/A ip=5.255.62.236 link=yes multicast=yes port=twisted pair speed=10Mbit/s

    Read the article

  • Unable to mount an LVM Hard-drive after upgrade

    - by Bruce Staples
    I imagine this is a basic gotcha ... but I can't see it. I have a system with 2(physical) harddrives. The boot system (/dev/sda) was running 10.04 & the second drive (/dev/sdb) was just a mounted filesystem. I did a clean load of Ubuntu 12.04 overwriting /dev/sda (not an upgrade) & now cannot mount the second drive. so I do not know what to enter it into the fstab ... I had expected to use: /dev/sdb /tera ext4 defaults 0 2 But even manual mounting fails (I also have tried various "-t" options on the off chance!) sudo mount -t ext4 /dev/sdb1 /tera mount: wrong fs type, bad option, bad superblock on /dev/sdb1, missing codepage or helper program, or other error In some cases useful info is found in syslog - try dmesg | tail or so Output from disk queries indicate that it is a Linux LVM & a healthy disk still. sudo lshw -C disk *-disk:0 description: ATA Disk product: WDC WD5000AACS-0 vendor: Western Digital physical id: 0 bus info: scsi@2:0.0.0 logical name: /dev/sda version: 01.0 serial: WD-WCASU1401098 size: 465GiB (500GB) capabilities: partitioned partitioned:dos configuration: ansiversion=5 signature=00015a55 *-disk:1 description: ATA Disk product: WDC WD10EADS-00L vendor: Western Digital physical id: 1 bus info: scsi@3:0.0.0 logical name: /dev/sdb version: 01.0 serial: WD-WCAU47836304 size: 931GiB (1TB) capabilities: partitioned partitioned:dos configuration: ansiversion=5 sudo fdisk -l Disk /dev/sda: 500.1 GB, 500106780160 bytes 255 heads, 63 sectors/track, 60801 cylinders, total 976771055 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x00015a55 Device Boot Start End Blocks Id System /dev/sda1 * 2048 972580863 486289408 83 Linux /dev/sda2 972582910 976769023 2093057 5 Extended /dev/sda5 972582912 976769023 2093056 82 Linux swap / Solaris Disk /dev/sdb: 1000.2 GB, 1000204886016 bytes 255 heads, 63 sectors/track, 121601 cylinders, total 1953525168 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x00000000 Device Boot Start End Blocks Id System /dev/sdb1 1 1953525167 976762583+ 8e Linux LVM LVM doesn't appear to be an option for mount or fstab. ... and here's a Smart data Screenshot from Disk Utility.

    Read the article

  • There's IP but can't reach gateway

    - by icky
    I have just installed ubuntu 12.04 on my new laptop, and brought it back to home, but I found the wireless network does not work. Strangely, it has the correct ip, but can't connect to the gateway. ifconfig gives ip 192.168.64.36, with broadcast 192.168.79.255 and mask 255.255.240.0, this are all correct, the gateway is at 192.168.64.1 cat /etc/resolv.conf nameserver 192.168.64.1 nameserver 127.0.0.1 which i think it's also right. but when I ping 192.168.64.1, all packages are lost. Please help me with this, I really do not know what happened to my network settings. Huckle, Thank you for your reply ifconfig wlan0 Link encap:Ethernet Hwaddr 88:f9:af:2a:ca:1b inet addr:192.168.64.36 Bcast:192.168.79.255 Mask:255.255.240.0 inet6 addr: fe80::8a9f:faff:fea2/64 Scope:Link UP BROADCAST RUNNING MULTICAST MTU:1500 Metric:1 RX packets:27 errors:0 dropped:0 overruns:0 frame:0 TX packets:376 errors:0 dropped:0 overruns:0 carrier:0 collisions:0 txqueuelen:1000 RX bytes:3950 TX byetes:60288 iwconfig wlan0 IEEE 802.11bgn ESSID:"Chiono" Mode:Managed Frequency:2.417 GHz Access Point: 82:54:99:94:6D:43 Bit Rate=13.5 Mb/s Tx-Power=13 dBm Retry long limit:7 RTS thr:off Fragment thr:off Encryption key:off Power Management:on Link Quality=70/70 Signal Level=-32 dBm Rx invalid nwid:0 Rx invalid crypt:0 RX invalid frag:0 Tx excessive retries: 9 Invalid misc:10 Missed beacon:0 route Kernel IP routing table Destination Gateway Genmask Flags Metric Ref Use Iface default 192.168.64.1 0.0.0.0 UG 0 0 0 wlan0 link-local * 255.255.0.0 U 1000 0 0 wlan0 192.168.64.0 * 255.255.240.0 U 2 0 0 0 wlan0 Thank you very much

    Read the article

  • Resolution changes when using switch

    - by Edward D
    So, the "real" resolution of my monitor is 1024x768. That's what I'd use on my docked Windows laptop, and what I'd use on my Xubuntu desktop connected directly. When I connect a switch, to switch between the two, however, the ubuntu machine's resolution changes. Everything's still proportional, and it still thinks it's doing 1024x768, but the icons and fonts appear larger. Not 800x600 larger, but still big. When I used Xubuntu Precise, I created an xorg.conf file to set a resolution of 1280x1024 which made it look the way it does without the switch ... as a workaround. When I upgraded to Trusty, I lost this. I tried to re-create it, but doesn't seem to load my file. Ideally, I'd like to correct the original problem, but I'd settle for being able to up the resolution. I searched for a while, and tried to do it, but I'm giving up ... please help me out. Controller: Intel Corporation 82915G/P/GV/GL/PL/910GL Memory Controller Hub (rev 04) Monitor: NEC MultiSync LCD 1850e http://www.necdisplay.com/documents/UserManuals/LCD1850E_manual.pdf OS: Xubuntu 14.04 Trusty /etc/X11/xorg.conf: # YOU CREATED THIS FILE # sudo leafpad /etc/X11/xorg.conf Section "Device" Identifier "Configured Video Device" EndSection Section "Monitor" Identifier "NEC LCD1850E" # I found Synchronization Range at: # http://www.necdisplay.com/documents/UserManuals/LCD1850E_manual.pdf HorizSync 31.0-82.0 VertRefresh 55.0-85.0 EndSection Section "Screen" Identifier "Default Screen" Monitor "NEC LCD1850E" Device "Configured Video Device" SubSection "Display" Depth 24 Modes "1280x1024" "1280x960" "1024x768" "800x600" "848x480" "640x480" EndSubSection EndSection

    Read the article

  • My D-Link Router is only allowing one connection

    - by Blaze
    My Router (Model: DI-624) is only allowing one wireless connection to one laptop. The other laptop is stuck hanging at connecting to the Internet I have the SSID set as "Pedro-Home" and is using a WPA PSK secured password. I have set the router using "Blaze-PC" while wired. Both Laptops critically need the Internet. > Dynamic DHCP Client List > > Host Name IP Address MAC > Address Expired Time > Blaze-PC 192.168.0.100 70-f1-a1-ff-39-a8 Apr/21/2011 17:49:14 > pedro 192.168.0.105 00-26-82-c8-47-25 Apr/21/2011 17:50:05 <<This computer isn't connecting.

    Read the article

  • UDF Partition reported full when it is not

    - by Capt.Nemo
    I was using these instructions to setup an external hard disk with udf. I have been able to setup a multi-partition system using those instructions, but I seem to have hit a wall, where the partition is reported as full while writing to the disk. Every other tool available to me reports it as free. Relevant lshw output Here's a screenshot showing the disk: Both the output of df and the file manager (caja) report the disk as free. Filesystem Size Used Avail Use% Mounted on /dev/sda9 9.0G 7.6G 910M 90% / udev 974M 12K 974M 1% /dev /dev/sda1 50G 47G 295M 100% /media/Data /dev/sda6 49G 41G 5.9G 88% /home /dev/sda2 155G 127G 29G 82% /media/Entertainment /dev/sda8 14G 13G 516M 96% /media/Stuff /dev/sdb2 120G 1.9G 112G 2% /media/3c887659-5676-4946-875b-b797be508ce7 /dev/sdb3 11G 2.6G 7.7G 25% /media/108b0a1d-fd1a-4f38-b1c6-4ad1a20e34a3 /dev/sdb1 802G 34G 768G 5% /media/disk I seem to have hit a wall near the 35GB mark. Despite being shown as 35gb/860gb used everywhere, the following happens on a write attempt: [2017][/media/Dory]$ echo D>>echo bash: echo: write error: No space left on device Writing byte by byte, the maximum I can take it to is 34719248K. The most weird part is that on mounting it Windows, Windows can write to the disk easily, and the writes are being read fine back in Ubuntu. However, the used-bytes remains at 34719248K in Ubuntu (It goes higher on Windows, however).

    Read the article

  • Copying unicode symbols from Firefox address bar as is

    - by sindikat
    Let's say I open a webpage with some Unicode characters, say, Cyrillic, in the address like this: http://ru.wikipedia.org/wiki/??????????????_?????????????? When I try to copy it from the address bar somewhere else, it becomes unreadable rubbish: http://ru.wikipedia.org/wiki/%D0%A4%D1%83%D0%BD%D0%BA%D1%86%D0%B8%D0%BE%D0%BD%D0%B0%D0%BB%D1%8C%D0%BD%D0%B0%D1%8F_%D0%B7%D0%B0%D0%BA%D1%80%D0%B5%D0%BF%D0%BB%D1%91%D0%BD%D0%BD%D0%BE%D1%81%D1%82%D1%8C I guess this is for compatibility. However for readability I want to copy it straight away with proper Unicode characters. What and how should I tweak to make that possible?

    Read the article

  • Accessing second hard drive

    - by Jonathan
    So I recently installed Ubuntu 10.10 64-bit on my computer. I installed it on my 60gb SSD hard drive, and in the installation it never acknowledged the existence of my second hard drive. The hard drive that I keep all my files on, and which I want to make my home folder if I can, is a Western Digital Caviar Black 1TB SATA 6Gb/s 64MB cache (WD1002FAEX). I've read the following: https://help.ubuntu.com/community/Mount but honestly cannot work out how to access the hard drive from my Ubuntu installation. I did have Windows 7 64-bit prior to installing Ubuntu. I have backed up all the files on the hard drive, but if I could just access them straight off that would be super cool. Does anyone know how I can use the second hard drive? Thank you for your help EDIT: The following directories are currently in my /dev/ folder: ati/, block/, bsg/, bus/, char/, cpu/, isk/, input/, mapper/, net/, pktcdvd/, pts/, shm/, snd/, and usb/ EDIT: Result from sudo fdisk -l Disk /dev/sda: 60.0 GB, 60022480896 bytes 255 heads, 63 sectors/track, 7297 cylinders Units = cylinders of 16065 * 512 = 8225280 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x000d2dfd Device Boot Start End Blocks Id System /dev/sda1 * 1 6994 56174592 83 Linux /dev/sda2 6994 7298 2438145 5 Extended /dev/sda5 6994 7298 2438144 82 Linux swap / Solaris @djeykib So very close to fixing it.. unfortunately on the last command you gave it says this: $ sudo apt-get install linux-lts-backport-natty Reading package lists... Done Building dependency tree Reading state information... Done E: Unable to locate package linux-lts-backport-natty Checking on http://www.ubuntuupdates.org/ppas reveals that it is only available for 10.04. Looks like I'll have to unplug and re-plug hardware if I want it working still :(

    Read the article

  • How can I triple boot Xubuntu, Ubuntu and Windows?

    - by ag.restringere
    Triple Booting Xubuntu, Ubuntu and Windows I'm an avid Xubuntu (Ubuntu + XFCE) user but I also dual boot with Windows XP. I originally created 3 partitions and wanted to use the empty one as a storage volume but now I want to install Ubuntu 12.04 LTS (the one with Unity) to do advanced testing and packaging. Ideally I would love to keep these two totally separate as I had problems in the past with conflicts between Unity and XFCE. This way I could wipe the Ubuntu w/ Unity installation if there are problems and really mess around with it. My disk looks like this: /dev/sda1 -- Windows XP /dev/sda2 -- Disk /dev/sda: 200.0 GB, 200049647616 bytes 255 heads, 63 sectors/track, 24321 cylinders, total 390721968 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Device Boot Start End Blocks Id System /dev/sda1 * 63 78139454 39069696 7 HPFS/NTFS/exFAT /dev/sda2 78141440 156280831 39069696 83 Linux /dev/sda3 156282878 386533375 115125249 5 Extended /dev/sda4 386533376 390721535 2094080 82 Linux swap / Solaris /dev/sda5 156282880 386533375 115125248 83 Linux Keep each in it's own partition and totally separate and be able to select from each of the three systems from the GRUB boot menu... sda1 --- [Windows XP] sda2 --- [Ubuntu 12.04] "Unity" sda3(4,5) -- [Xubuntu 12.02] "Primary XFCE" What is the safest and easiest way to do this without messing my system up and requiring invasive activity?

    Read the article

  • Banshee gapless playback does not work when playing mp3s

    - by ComputerGuy505
    Even though I have gapless playback enabled in Banshee's settings menu, there is a very short pause between songs. This might be due to the fact that my hard drive's partitions seem wierd. fdisk -l produces this output: Disk /dev/sda: 750.2 GB, 750156374016 bytes 255 heads, 63 sectors/track, 91201 cylinders, total 1465149168 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 4096 bytes I/O size (minimum/optimal): 4096 bytes / 4096 bytes Disk identifier: 0x4a73c3cb Device Boot Start End Blocks Id System /dev/sda1 * 2048 409599 203776 7 HPFS/NTFS/exFAT /dev/sda2 409600 724153740 361872070+ 7 HPFS/NTFS/exFAT /dev/sda3 1456826368 1465145343 4159488 c W95 FAT32 (LBA) /dev/sda4 724154366 1456826367 366336001 5 Extended Partition 4 does not start on physical sector boundary. /dev/sda5 1440159744 1456826367 8333312 82 Linux swap / Solaris /dev/sda6 724154368 1440159743 358002688 83 Linux Partition table entries are not in disk order Playing mp3's from /dev/sda2 or /dev/sda6 produces this problem. I don't seem to have gapless playback on Rhythmbox or Clementine either, if those media players are supposed to have it. I'm not sure what other info to provide. This is just annoying to me. Thanks for any help.

    Read the article

  • Unsure about TRIM enabled on my SSD

    - by user84750
    I have a SSD OCZ Vertex4 installed on my laptop. I'm running Ubuntu 12.04 LTS. I have enable TRIM by adding "discard" to my fstab file. (also added option noatime). I rebooted my Ubuntu and followed These instructions here to test TRIM. The end results of my tempfile was all ffff's, when it should have read all zero's, which is telling me TRIM is not really working or enabled correctly. Did I miss something? Also, will it be a problem if only my /home directory is encrypted. AND if you ask why I have swap on my SSD, it's because I let Ubuntu set up my partition. When I have my SSD, I just wanted to install Ubuntu as fast as possible. =) I've done testing to see at which point it will start to use swap and it took a lot of applications open to finally use swap. I currently have 4 GB of memory. I might shrink this to like 512 MB or 1 GB the most. Here's some info about my file system setup. sudo hdparm -I /dev/sda1 | grep "TRIM supported" Data Set Management TRIM supported (limit 16 blocks) sudo fdisk -l /dev/sda Device Boot Start End Blocks Id System /dev/sda1 * 2048 242016255 121007104 83 Linux /dev/sda2 242018302 250068991 4025345 5 Extended /dev/sda5 242018304 250068991 4025344 82 Linux swap / Solaris ls /dev/mapper control cryptswap1

    Read the article

  • Passenger 'premature end of script headers' error

    - by fatnic
    Hi. I really need help debugging an error I'm getting with Passenger on Apache. I've just made a fresh install of Ubuntu 10.4 and have Apache, Ruby and Passenger installed. I'm trying to run a simple rack app but keep getting this error in my Apache error.log [Tue Sep 28 05:54:41 2010] [error] [client 86.171.2.82] Premature end of script headers: The error then continues with The backend application (process 25574) did not send a valid HTTP response; instead, it sent nothing at all. It is possible that it has crashed; please check whether there are crashing bugs in this application. *** Exception NoMethodError in PhusionPassenger::Rack::ApplicationSpawner (undefined method `call' for nil:NilClass) (process 25574): I've tried older versions of passenger also but get the same error. Ubuntu 10.4 Apache 2.2.14 Ruby 1.9.2-p0 Passenger 2.2.15

    Read the article

  • Win7 no longer available after installing 12.04

    - by Michael
    I have installed Ubuntu 12.04 but my Windows 7 partition seems to have been lost. It is in sda2. Can anyone help me how to get this Windows 7 partition back without having to reinstall Windows 7? Disk /dev/sda: 500.1 GB, 500107862016 bytes 255 heads, 63 sectors/track, 60801 cylinders, total 976773168 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0xd45cd45c Device Boot Start End Blocks Id System /dev/sda1 2048 61433855 30715904 83 Linux /dev/sda2 * 61433856 122873855 30720000 7 HPFS/NTFS/exFAT /dev/sda3 122873856 976769023 426947584 7 HPFS/NTFS/exFAT Disk /dev/sdb: 203.9 GB, 203928109056 bytes 255 heads, 63 sectors/track, 24792 cylinders, total 398297088 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x03ee03ee Device Boot Start End Blocks Id System /dev/sdb1 * 63 20482874 10241406 c W95 FAT32 (LBA) /dev/sdb2 20482875 40965749 10241437+ 1c Hidden W95 FAT32 (LBA) /dev/sdb3 40965750 398283479 178658865 f W95 Ext'd (LBA) /dev/sdb5 40965813 76694309 17864248+ 7 HPFS/NTFS/exFAT /dev/sdb6 76694373 108856439 16081033+ 7 HPFS/NTFS/exFAT /dev/sdb7 108856503 398283479 144713488+ 7 HPFS/NTFS/exFAT Disk /dev/sdc: 1000.2 GB, 1000204886016 bytes 240 heads, 63 sectors/track, 129201 cylinders, total 1953525168 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x00000001 Device Boot Start End Blocks Id System /dev/sdc1 * 63 20480543 10240240+ 82 Linux swap / Solaris /dev/sdc2 20480605 1953519119 966519257+ f W95 Ext'd (LBA) /dev/sdc5 20480607 1953519119 966519256+ 7 HPFS/NTFS/exFAT

    Read the article

  • Partition does not start on physical sector boundary?

    - by jasmines
    I've one HD on my laptop, with two partitions (one ext3 with Ubuntu 12.04 installed and one swap). fdisk is giving me a Partition 1 does not start on physical sector boundary warning. What is the cause and do I need to fix it? If so, how? This is sudo fdisk -l: Disk /dev/sda: 750.2 GB, 750156374016 bytes 255 testine, 63 settori/tracce, 91201 cilindri, totale 1465149168 settori Unità = settori di 1 * 512 = 512 byte Sector size (logical/physical): 512 bytes / 4096 bytes I/O size (minimum/optimal): 4096 bytes / 4096 bytes Identificativo disco: 0x5a25087f Dispositivo Boot Start End Blocks Id System /dev/sda1 * 63 1448577023 724288480+ 83 Linux Partition 1 does not start on physical sector boundary. /dev/sda2 1448577024 1465147391 8285184 82 Linux swap / Solaris This is sudo lshw related result: *-disk description: ATA Disk product: WDC WD7500BPKT-0 vendor: Western Digital physical id: 0 bus info: scsi@0:0.0.0 logical name: /dev/sda version: 01.0 serial: WD-WX21CC1T0847 size: 698GiB (750GB) capabilities: partitioned partitioned:dos configuration: ansiversion=5 signature=5a25087f *-volume:0 description: EXT3 volume vendor: Linux physical id: 1 bus info: scsi@0:0.0.0,1 logical name: /dev/sda1 logical name: / version: 1.0 serial: cc5c562a-bc59-4a37-b589-805b27b2cbd7 size: 690GiB capacity: 690GiB capabilities: primary bootable journaled extended_attributes large_files recover ext3 ext2 initialized configuration: created=2010-02-27 09:18:28 filesystem=ext3 modified=2012-06-23 18:33:59 mount.fstype=ext3 mount.options=rw,relatime,errors=remount-ro,user_xattr,barrier=1,data=ordered mounted=2012-06-28 00:20:47 state=mounted *-volume:1 description: Linux swap volume physical id: 2 bus info: scsi@0:0.0.0,2 logical name: /dev/sda2 version: 1 serial: 16a7fee0-be9e-4e34-9dc3-28f4eeb61bf6 size: 8091MiB capacity: 8091MiB capabilities: primary nofs swap initialized configuration: filesystem=swap pagesize=4096 These are related /etc/fstab lines: UUID=cc5c562a-bc59-4a37-b589-805b27b2cbd7 / ext3 errors=remount-ro,user_xattr 0 1 UUID=16a7fee0-be9e-4e34-9dc3-28f4eeb61bf6 none swap sw 0 0

    Read the article

  • How to remove bad disk from LVM2 with the less data loss on other PVs?

    - by Walkman
    I had a LVM2 volume with two disks. The larger disk became corrupt, so I cant pvmove. What is the best way to remove it from the group to save the most data from the other disk? Here is my pvdisplay output: Couldn't find device with uuid WWeM0m-MLX2-o0da-tf7q-fJJu-eiGl-e7UmM3. --- Physical volume --- PV Name unknown device VG Name media PV Size 1,82 TiB / not usable 1,05 MiB Allocatable yes (but full) PE Size 4,00 MiB Total PE 476932 Free PE 0 Allocated PE 476932 PV UUID WWeM0m-MLX2-o0da-tf7q-fJJu-eiGl-e7UmM3 --- Physical volume --- PV Name /dev/sdb1 VG Name media PV Size 931,51 GiB / not usable 3,19 MiB Allocatable yes (but full) PE Size 4,00 MiB Total PE 238466 Free PE 0 Allocated PE 238466 PV UUID oUhOcR-uYjc-rNTv-LNBm-Z9VY-TJJ5-SYezce So I want to remove the unknown device (not present in the system). Is it possible to do this without a new disk ? The filesystem is ext4.

    Read the article

  • SD Card only mounted after a reboot

    - by evothur
    Hi everyone. I have a Kingston 2GB MicroSD and I plug it in via an inconix MicroSD Adapter to the internal card reader of my Samsung N210 Netbook with Ubuntu 10.10, but it doesn't show up. Only if I reboot the system when the card's plugged in it shows up. Why does it need a reboot for mounting? sudo fdisk -l gives the output below. But I can only see the drive when I reboot the computer while the card's plugged. Disk /dev/sda: 160.0 GB, 160041885696 bytes 255 heads, 63 sectors/track, 19457 cylinders Units = cylinders of 16065 * 512 = 8225280 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x9a5a7990 Device Boot Start End Blocks Id System /dev/sda1 1 1959 15728640 27 Unknown Partition 1 does not end on cylinder boundary. /dev/sda2 * 1959 1972 102400 7 HPFS/NTFS /dev/sda3 1972 18992 136718750 83 Linux /dev/sda4 18992 19458 3738625 5 Extended /dev/sda5 18992 19458 3738624 82 Linux swap / Solaris Disk /dev/sdb: 1973 MB, 1973420032 bytes 60 heads, 59 sectors/track, 1088 cylinders Units = cylinders of 3540 * 512 = 1812480 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x00000000 Device Boot Start End Blocks Id System /dev/sdb1 1 1089 1927100+ 6 FAT16

    Read the article

  • Are Windows partitions gone?

    - by Gigili
    I had Windows 7 on my laptop (factory setting), because of some performance issues, I decided to use recovery options to restore it to its factory condition but I don't know what has happened or what I have done that the whole operating system was gone after playing around with recovery options from the boot menu. I couldn't find Windows, so I installed Ubuntu 11.04 on my laptop. Last time I had Ubuntu on it, it was not really compatible with laptop's configuration and I had a bit of problems trying to do normal tasks I used to do on Windows. Now I want to make sure that Windows and its drivers are gone so that I can try to install a newer version of Ubuntu or Windows. I tried the command sudo fdisk -l And the result shown was: myaccount@myaccount-VPCS116FG:~$ sudo fdisk -l [sudo] password for myaccount: Disk /dev/sda: 320.1 GB, 320072933376 bytes 255 heads, 63 sectors/track, 38913 cylinders Units = cylinders of 16065 * 512 = 8225280 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x00025b5f Device Boot Start End Blocks Id System /dev/sda1 * 1 38409 308515840 83 Linux /dev/sda2 38409 38914 4052993 5 Extended /dev/sda5 38409 38914 4052992 82 Linux swap / Solaris Disk /dev/dm-0: 4150 MB, 4150263808 bytes 255 heads, 63 sectors/track, 504 cylinders Units = cylinders of 16065 * 512 = 8225280 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0xa668cfe8 Disk /dev/dm-0 doesn't contain a valid partition table Is it gone? If not, what command should I try to have access to Windows partitions? Thank you.

    Read the article

  • ubuntu 11.10 can't find wireless after waking from sleep

    - by Colleen
    I've tried a lot of proposed solutions, most of them adding files to /etc/pm/config.d, as well as WiFi stops working after waking from suspend and nothing has worked. hardware info: [colleen@colleen-HP ~]$ sudo lshw -C network [sudo] password for colleen: *-network description: Ethernet interface product: RTL8111/8168B PCI Express Gigabit Ethernet controller vendor: Realtek Semiconductor Co., Ltd. physical id: 0 bus info: pci@0000:07:00.0 logical name: eth0 version: 06 serial: 2c:27:d7:b1:ea:67 size: 10Mbit/s capacity: 1Gbit/s width: 64 bits clock: 33MHz capabilities: pm msi pciexpress msix vpd bus_master cap_list ethernet physical tp mii 10bt 10bt-fd 100bt 100bt-fd 1000bt 1000bt-fd autonegotiation configuration: autonegotiation=on broadcast=yes driver=r8169 driverversion=2.3LK-NAPI duplex=half firmware=N/A latency=0 link=no multicast=yes port=MII speed=10Mbit/s resources: irq:41 ioport:4000(size=256) memory:c1404000-c1404fff memory:c1400000-c1403fff *-network description: Wireless interface product: Centrino Wireless-N 1000 vendor: Intel Corporation physical id: 0 bus info: pci@0000:0d:00.0 logical name: wlan0 version: 00 serial: 8c:a9:82:99:48:8c width: 64 bits clock: 33MHz capabilities: pm msi pciexpress bus_master cap_list ethernet physical wireless configuration: broadcast=yes driver=iwlagn driverversion=3.0.0-21-generic-pae firmware=39.31.5.1 build 35138 ip=192.168.0.4 latency=0 link=yes multicast=yes wireless=IEEE 802.11bgn resources: irq:48 memory:c5500000-c5501fff Is anyone else still having this problem? The two solutions I haven't tried are installing wicd and upgrading because I've heard both are kind of unstable/buggy and wicd frankly scares me.

    Read the article

  • How to mount drive in /media/userName/ like nautilus do using udisks

    - by Bsienn
    As of my current installation of Ubuntu 13.10 Unity, when i click on a drive in nautilus it get mounted in /media/username/mountedDrive i read that nautilus use udisks to do that. Basically i want to auto mount my drive using udisks in start up using this method But problem is, it mounts the drive in /media/mountedDrive, but i want it the way nautilus do in /media/username/mounteDrive I want NTFS Data drive to be auto mounted at /media/bsienn/ bsienn@bsienn-desktop:~$ blkid /dev/sda1: LABEL="System Reserved" UUID="8230744030743D6B" TYPE="ntfs" /dev/sda2: LABEL="Windows 7" UUID="60100EA5100E81F0" TYPE="ntfs" /dev/sda3: LABEL="Data" UUID="882C04092C03F14C" TYPE="ntfs" /dev/sda5: UUID="8768800f-59e1-41a2-9092-c0a8cb60dabf" TYPE="swap" /dev/sda6: LABEL="Ubuntu Drive" UUID="13ea474a-fb27-4c91-bae7-c45690f88954" TYPE="ext4" /dev/sda7: UUID="69c22e73-9f64-4b48-b854-7b121642cd5d" TYPE="ext4" bsienn@bsienn-desktop:~$ sudo fdisk -l Disk /dev/sda: 160.0 GB, 160000000000 bytes 255 heads, 63 sectors/track, 19452 cylinders, total 312500000 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x8d528d52 Device Boot Start End Blocks Id System /dev/sda1 * 2048 206847 102400 7 HPFS/NTFS/exFAT /dev/sda2 206848 117730069 58761611 7 HPFS/NTFS/exFAT /dev/sda3 158690072 312494116 76902022+ 7 HPFS/NTFS/exFAT /dev/sda4 117731326 158689279 20478977 5 Extended /dev/sda5 137263104 141260799 1998848 82 Linux swap / Solaris /dev/sda6 141262848 158689279 8713216 83 Linux /dev/sda7 117731328 137263103 9765888 83 Linux Partition table entries are not in disk order bsienn@bsienn-desktop:~$ cat /etc/fstab # /etc/fstab: static file system information. # # Use 'blkid' to print the universally unique identifier for a # device; this may be used with UUID= as a more robust way to name devices # that works even if disks are added and removed. See fstab(5). # # <file system> <mount point> <type> <options> <dump> <pass> # / was on /dev/sda7 during installation UUID=69c22e73-9f64-4b48-b854-7b121642cd5d / ext4 errors=remount-ro 0 1 # swap was on /dev/sda5 during installation UUID=8768800f-59e1-41a2-9092-c0a8cb60dabf none swap sw 0 0 Desired effect: Picture link

    Read the article

  • how to access a mounted device, How can I access the partitions with the console

    - by user1796624
    Hi I'm new to ubuntu and linux so this might be a very begginers question. I have several partitions on my pc and I want to be able to access them with the console. When I type: sudo fdisk -l I get: /dev/sda1 * 2048 97656831 48827392 7 HPFS/NTFS/exFAT /dev/sda2 97656832 234375167 68359168 7 HPFS/NTFS/exFAT /dev/sda3 * 234375168 312500223 39062528 83 Linux /dev/sda4 312502270 625141759 156319745 5 Extended /dev/sda5 312502272 318359551 2928640 82 Linux swap / Solaris /dev/sda6 318361600 625141759 153390080 83 Linux But it seams that the address is existing. for example I cant do cd /dev/sda4. How can I access the partitions with the console?

    Read the article

  • Dual Boot Windows 8 and Ubuntu

    - by Nick
    My laptop has two hard drives, one 320GB HDD and a 30GB SSD. I installed Windows 8 on the HDD and Ubuntu on the SSD. However, after I installed Ubuntu, Windows 8 did not appear on the boot list. I tried boot-repair, but this didn't help.Here is the output of my fdisk -l: Disk /dev/sda: 320.1 GB, 320072933376 bytes 255 heads, 63 sectors/track, 38913 cylinders, total 625142448 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x6cd9314a Device Boot Start End Blocks Id System /dev/sda1 * 2048 625139711 312568832 7 HPFS/NTFS/exFAT Disk /dev/sdb: 30.0 GB, 30016659456 bytes 255 heads, 63 sectors/track, 3649 cylinders, total 58626288 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x6cd93132 Device Boot Start End Blocks Id System /dev/sdb1 * 2048 207126 102539+ 83 Linux /dev/sdb2 208894 58626047 29208577 5 Extended /dev/sdb5 208896 4112383 1951744 82 Linux swap / Solaris /dev/sdb6 4114432 58626047 27255808 83 Linux Disk /dev/mmcblk0: 3965 MB, 3965190144 bytes 49 heads, 48 sectors/track, 3292 cylinders, total 7744512 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x0009c694 Device Boot Start End Blocks Id System /dev/mmcblk0p1 * 8192 7744511 3868160 b W95 FAT32 I also tried sudo grub-update, but that also did nothing.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • ubuntu boots only with usb

    - by klimat
    Just installed Ubuntu 11.04. But it boots only from usb. Seems like I didn't pay attention during selecting boot device. sudo fdisk -l [sudo] password for klim: Disk /dev/sda: 500.1 GB, 500107862016 bytes 255 heads, 63 sectors/track, 60801 cylinders Units = cylinders of 16065 * 512 = 8225280 bytes Sector size (logical/physical): 512 bytes / 4096 bytes I/O size (minimum/optimal): 4096 bytes / 4096 bytes Disk identifier: 0x000177e1 Device Boot Start End Blocks Id System /dev/sda1 1 60045 482302976 83 Linux /dev/sda2 60045 60802 6080513 5 Extended Partition 2 does not start on physical sector boundary. /dev/sda5 60045 60802 6080512 82 Linux swap / Solaris Disk /dev/sdb: 4004 MB, 4004511744 bytes 124 heads, 62 sectors/track, 1017 cylinders Units = cylinders of 7688 * 512 = 3936256 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x000eee1a Device Boot Start End Blocks Id System /dev/sdb1 * 1 1017 3909317 b W95 FAT32 grub updating or another "grub" operations don't work as I've tried. Can I just copy whole boot folder from usb to HD or smth like that? Any kind of help is appreciated. Apologize for my newbie skills.

    Read the article

< Previous Page | 9 10 11 12 13 14 15 16 17 18 19 20  | Next Page >