Search Results

Search found 540 results on 22 pages for 'whitespace'.

Page 13/22 | < Previous Page | 9 10 11 12 13 14 15 16 17 18 19 20  | Next Page >

  • How do I make vim's autoindent not drop trailing spaces?

    - by Joey Adams
    In some text editors (e.g. Kate, gedit), when auto indent is enabled, pressing return twice will leave a trailing whitespace (which I want): if (code) { .... ....| } While others cater to the coding standard where trailing spaces (even in blank lines) aren't allowed: if (code) { ....| } What annoys me about this is that if I arrow up after auto-indenting, the auto-indent is lost: if (code) { | .... } If I run vim and :set autoindent , I get the latter behavior. My question is, how do I set vim to keep the trailing spaces rather than automatically removing them if they go unused?

    Read the article

  • Customize autoindent settings in VIMRC file

    - by Shane Reustle
    I have autoindent enabled in my .vimrc file but have run into an annoying bug/feature. For example, when I'm tabbed in 3 times, and I hit return, the new line is also tabbed in 3 times. Then when I hit enter again, that new line is also indented 3 times, as it should. The problem occurs when I go back up to the previous line (the first of the 2 new lines). VIM automatically removes the whitespace because it saw it as an empty line. Is there a way to disable this from happening? I'd like to be able to back to coding like this: function test(){ <return> <return> } <up> <right> Thanks!

    Read the article

  • php-fpm start error

    - by Sujay
    I am using php-fpm. I recently recompiled php for including imap functions. But on php-fpm start it gives the following error: Starting php_fpm Error in argument 1, char 1: no argument for option - Usage: php-cgi [-q] [-h] [-s] [-v] [-i] [-f ] php-cgi [args...] -a Run interactively -C Do not chdir to the script's directory -c | Look for php.ini file in this directory -n No php.ini file will be used -d foo[=bar] Define INI entry foo with value 'bar' -e Generate extended information for debugger/profiler -f Parse . Implies `-q' -h This help -i PHP information -l Syntax check only (lint) -m Show compiled in modules -q Quiet-mode. Suppress HTTP Header output. -s Display colour syntax highlighted source. -v Version number -w Display source with stripped comments and whitespace. -z Load Zend extension ................................... failed What could be the problem? Is it in php-fpm.conf or php.ini.

    Read the article

  • Using a script that uses Duplicity + S3 excluding large files

    - by Jason
    I'm trying to write an backup script that will exclude files over a certain size. If i run the script duplicity gives an error. However if I copy and paste the same command generated by the script everything works... Here is the script #!/bin/bash # Export some ENV variables so you don't have to type anything export AWS_ACCESS_KEY_ID="accesskey" export AWS_SECRET_ACCESS_KEY="secretaccesskey" export PASSPHRASE="password" SOURCE=/home/ DEST=s3+http://s3bucket GPG_KEY="gpgkey" # exclude files over 100MB exclude () { find /home/jason -size +100M \ | while read FILE; do echo -n " --exclude " echo -n \'**${FILE##/*/}\' | sed 's/\ /\\ /g' #Replace whitespace with "\ " done } echo "Using Command" echo "duplicity --encrypt-key=$GPG_KEY --sign-key=$GPG_KEY `exclude` $SOURCE $DEST" duplicity --encrypt-key=$GPG_KEY --sign-key=$GPG_KEY `exclude` $SOURCE $DEST # Reset the ENV variables. export AWS_ACCESS_KEY_ID= export AWS_SECRET_ACCESS_KEY= export PASSPHRASE= When the script is run I get the error; Command line error: Expected 2 args, got 6 Where am i going wrong??

    Read the article

  • Text comparison utility

    - by Aaron
    I know this has been asked before...but I have a spin as I have been trying out varying free software offerings. I want to rid out department of DiffDoc the problem is that I am having trouble locating something that will do what we need. WinMerge has been the latest attempt... The problem is simple. One Word doc...one PDF with a portion of it containing the text to be compared against. Compare them and be done. Raw text, ignore whitespace, ignore carriage returns, etc... Just compare the text and give me the results in some sort of report. NOTE: Have tried ExamDiff, kdiff3, Tortoise, and a few others...

    Read the article

  • Problem with script that excludes large files using Duplicity and Amazon S3

    - by Jason
    I'm trying to write an backup script that will exclude files over a certain size. If i run the script duplicity gives an error. However if i copy and paste the same command generated by the script everything works... Here is the script #!/bin/bash # Export some ENV variables so you don't have to type anything export AWS_ACCESS_KEY_ID="accesskey" export AWS_SECRET_ACCESS_KEY="secretaccesskey" export PASSPHRASE="password" SOURCE=/home/ DEST=s3+http://s3bucket GPG_KEY="gpgkey" # exclude files over 100MB exclude () { find /home/jason -size +100M \ | while read FILE; do echo -n " --exclude " echo -n \'**${FILE##/*/}\' | sed 's/\ /\\ /g' #Replace whitespace with "\ " done } echo "Using Command" echo "duplicity --encrypt-key=$GPG_KEY --sign-key=$GPG_KEY `exclude` $SOURCE $DEST" duplicity --encrypt-key=$GPG_KEY --sign-key=$GPG_KEY `exclude` $SOURCE $DEST # Reset the ENV variables. export AWS_ACCESS_KEY_ID= export AWS_SECRET_ACCESS_KEY= export PASSPHRASE= When the script is run I get the error; Command line error: Expected 2 args, got 6 Where am i going wrong??

    Read the article

  • Backup script that excludes large files using Duplicity and Amazon S3

    - by Jason
    I'm trying to write an backup script that will exclude files over a certain size. My script gives the proper command, but when run within the script it outputs an an error. However if the same command is run manually everything works...??? Here is the script based on one easy found with google #!/bin/bash # Export some ENV variables so you don't have to type anything export AWS_ACCESS_KEY_ID="accesskey" export AWS_SECRET_ACCESS_KEY="secretaccesskey" export PASSPHRASE="password" SOURCE=/home/ DEST=s3+http://s3bucket GPG_KEY="7743E14E" # exclude files over 100MB exclude () { find /home/jason -size +100M \ | while read FILE; do echo -n " --exclude " echo -n \'**${FILE##/*/}\' | sed 's/\ /\\ /g' #Replace whitespace with "\ " done } echo "Using Command" echo "duplicity --encrypt-key=$GPG_KEY --sign-key=$GPG_KEY `exclude` $SOURCE $DEST" duplicity --encrypt-key=$GPG_KEY --sign-key=$GPG_KEY `exclude` $SOURCE $DEST # Reset the ENV variables. export AWS_ACCESS_KEY_ID= export AWS_SECRET_ACCESS_KEY= export PASSPHRASE= If run I recieve the error; Command line error: Expected 2 args, got 6 Enter 'duplicity --help' for help screen. Any help your could offer would be greatly appreciated.

    Read the article

  • Generic software code style enforcer

    - by FuzziBear
    It seems to me to be a fairly common thing to do, where you have some code that you'd like to automatically run through a code style tool to catch when people break your coding style guide(s). Particularly if you're working on code that has multiple languages (which is becoming more common with web-language-x and javascript), you generally want to apply similar code style guides to both and have them enforced. I've done a bit of research, but I've only been able to find tools to enforce code style guidelines (not necessarily applying the code style, just telling you when you break code style guidelines) for a particular language. It would seem to me a reasonably trivial thing to do by just using current IDE rules for syntax highlighting (so that you don't check style guide rules inside quotes or strings, etc) and a whole lot of regexes to enforce some really generic things. Examples: if ( rather than if( checking lines with only whitespace Are there any tools that do this kind of really generic style checking? I'd prefer it to be easily configurable for different languages (because like it or not, some things would just not work cross language) and to add new "rules" to check new things.

    Read the article

  • How do I change until the next underscore in VIm?

    - by Nathan Long
    If I have this text in vim, and my cursor is at the first character: www.foo.com I know that I can do: cw to change up to the first period, because a word (lowercase w) ends at any punctuation OR white space cW to change the whole address, because a Word (uppercase w) ends only at whitespace Now, what if I have this: stupid_method_name and want to change it to this? awesome_method_name Both cw and cW change the whole thing, but I just want to change the fragment before the underscore. My fallback technique is c/_, meaning 'change until you hit the next underscore in a search,' but for me, that also causes all underscores to be highlighted as search terms, which is slightly annoying. Is there a specifier like w or W that doesn't include underscores?

    Read the article

  • What do you wish language designers paid attention to?

    - by Berin Loritsch
    The purpose of this question is not to assemble a laundry list of programming language features that you can't live without, or wish was in your main language of choice. The purpose of this question is to bring to light corners of languge design most language designers might not think about. So, instead of thinking about language feature X, think a little more philisophically. One of my biases, and perhaps it might be controversial, is that the softer side of engineering--the whys and what fors--are many times more important than the more concrete side. For example, Ruby was designed with a stated goal of improving developer happiness. While your opinions may be mixed on whether it delivered or not, the fact that was a goal means that some of the choices in language design were influenced by that philosophy. Please do not post: Syntax flame wars (I could care less whether you use whitespace [Python], keywords [Ruby], or curly braces [Java, C/C++, et. al.] to denote program blocks). That's just an implementation detail. "Any language that doesn't have feature X doesn't deserve to exist" type comments. There is at least one reason for all programming languages to exist--good or bad. Please do post: Philisophical ideas that language designers seem to miss. Technical concepts that seem to be poorly implemented more often than not. Please do provide an example of the pain it causes and if you have any ideas of how you would prefer it to function. Things you wish were in the platform's common library but seldom are. One the same token, things that usually are in a common library that you wish were not. Conceptual features such as built in test/assertion/contract/error handling support that you wish all programming languages would implement properly--and define properly. My hope is that this will be a fun and stimulating topic.

    Read the article

  • Hash Algorithm Randomness Visualization

    - by clstroud
    I'm curious if anyone here has any idea how the images were generated as shown in this response: Which hashing algorithm is best for uniqueness and speed? Ian posted a very well-received response but I can't seem to understand how he went about making the images. I hate to make a new question dedicated to this, but I can't find any means to ask him more directly. On the other hand, perhaps someone has an alternative perspective. The best I can personally come up with would be to have it almost like a bar graph, which would illustrate how evenly the buckets of the hash table are being generated. I have a working Cocoa program that does this, but it can't generate anything like what he showed there. So the question is two fold I suppose: A) How does one truly interpret the data he shows? Is it more than "less whitespace = better"? B) How does one generate such an image based on some set of inputs, a hash, and an index? Perhaps I'm misunderstanding entirely, but I really would like to know more about this particular visualization technique. Or maybe I'm mis-applying this to hash tables rather than just hashes in general, but in that case I don't know how it would be "bounded" for the image.

    Read the article

  • Reocurring unpack failed on git repo improted from svn

    - by xavier
    I have a git repo created from svn with git-svn. Everything converted just fine, but from time to time, when I try to git push, I get: error: unpack failed: unpack-objects abnormal exit Other repos on our server (created from scratch or imported from svn) work fine. The solution is usually to unstage, commit and push files one by one, modify the one that fails (e.g. add a whitespace or something) and commit it once again. It's obviously very irritating, for big commits it's a productivity killer - and requires a lot of server pushes. I'd be grateful for any suggestions on where to look, I couldn't google anything up.

    Read the article

  • PHP Calculating Text to Content Ratio

    - by James
    I am using the following code to calculate text to code ratio. I think it is crazy that no one can agree on how to properly calculate the result. I am looking any suggestions or ideas to improve this code that may make it more accurate. <?php // Returns the size of the content in bytes function findKb($content){ $count=0; $order = array("\r\n", "\n", "\r", "chr(13)", "\t", "\0", "\x0B"); $content = str_replace($order, "12", $content); for ($index = 0; $index < strlen($content); $index ++){ $byte = ord($content[$index]); if ($byte <= 127) { $count++; } else if ($byte >= 194 && $byte <= 223) { $count=$count+2; } else if ($byte >= 224 && $byte <= 239) { $count=$count+3; } else if ($byte >= 240 && $byte <= 244) { $count=$count+4; } } return $count; } // Collect size of entire code $filesize = findKb($content); // Remove anything within script tags $code = preg_replace("@<script[^>]*>.+</script[^>]*>@i", "", $content); // Remove anything within style tags $code = preg_replace("@<style[^>]*>.+</style[^>]*>@i", "", $content); // Remove all tags from the system $code = strip_tags($code); // Remove Extra whitespace from the content $code = preg_replace( '/\s+/', ' ', $code ); // Find the size of the remaining code $codesize = findKb($code); // Calculate Percentage $percent = $codesize/$filesize; $percentage = $percent*100; echo $percentage; ?> I don't know the exact calculations that are used so this function is just my guess. Does anyone know what the proper calculations are or if my functions are close enough for a good judgement.

    Read the article

  • Passing multiple sets of arguments to a command

    - by Alec
    instances contains several whitespace separated strings, as does snapshots. I want to run the command below, with each instance-snapshot pair. ec2-attach-volume --instance $instances --device /dev/sdf $snapshots For example, if instances contains A B C, and snapshots contains 1 2 3, I want the command to be called like so: ec2-attach-volume -C cert.pem -K pk.pem --instance A --device /dev/sdf 1 ec2-attach-volume -C cert.pem -K pk.pem --instance B --device /dev/sdf 2 ec2-attach-volume -C cert.pem -K pk.pem --instance C --device /dev/sdf 3 I can do either one or the other with xargs -n 1, but how do I do both?

    Read the article

  • Diff -b and -w difference

    - by dotancohen
    From the diff manpage: -b, --ignore-space-change ignore changes in the amount of white space -w, --ignore-all-space ignore all white space From this, I infer that the difference between the -b and -w options must be that -b is sensitive to the type of whitespace (tabs vs. spaces). However, that does not seem to be the case: $ diff 1.txt 2.txt 1,3c1,3 < Four spaces, changed to one tab < Eight Spaces, changed to two tabs < Four spaces, changed to two spaces --- > Four spaces, changed to one tab > Eight Spaces, changed to two tabs > Four spaces, changed to two spaces $ diff -b 1.txt 2.txt $ diff -w 1.txt 2.txt $ So, what is the difference between the -b and -w options? Tested with diffutils 3.2 on Kubuntu Linux 13.04.

    Read the article

  • Is there any diff tool for XML files?

    - by qedi
    Are there any good (Linux) tools for diffing two XML files? Ideally, I would like to be able configure it to some things strict, or loosen some things, like whitespace, or attribute order. I'll often care that the files are functionally the same, but diff by itself, would be annoying to use, especially if the XML file doesn't have a lot of linebreaks. For example, the following should really be okay to me: <tag att1="one" att2="two"> content </tag> <tag att2="two" att1="one"> content </tag>

    Read the article

  • Emacs stops taking input when a file has changed on disk [migrated]

    - by recf
    I'm using Emacs v24.3.1 on Windows 8. I had a file change on disk while I had an Emacs buffer open with that file. As soon as I attempt to make a change to the buffer, a message appears in the minibuffer. Fileblah.txt changed on disk; really edit the buffer? (y, n, r or C-h) I would expect to be able to hit r to have it reload the disk version of the file, but nothing happens. Emacs completely stops responding to input. None of the listed keys work, nor do any other keys as far as I can tell. I can't C-g out of the minibuffer. Alt-F4 doesn't work, not does Close window from the task bar. I have to kill the process from task manager. Anyone have any idea what I'm doing wrong here? In cases it's various modes not playing nice with each other, for reference, my init.el is here. Nothing complex. Here's the breakdown: better-defaults (ido-mode, remove menu-bar, uniquify buffer `forward, saveplace) recentf-mode custom frame title visual-line-mode require final newline and delete trailing whitespace on save Markdown mode with auto-mode-alist Flyspell with Aspell backend Powershell mode with auto-mode-alist Ruby auto-mode-alist Puppet mode with auto-mode-alist Feature (Gherkin) mode with auto-mode-alist The specific file was a markdown file with Github-flavored Markdown mode and Flyspell mode enabled.

    Read the article

  • Anyone can suggest some Game Frameworks for GNU/Linux? [closed]

    - by dysoco
    So I've been developing a little bit with XNA + C# in Windows, not really much: just some 2D stuff, but I've found that XNA is a really good framework. I'm a GNU/Linux user, and I'm definitely migrating my desktop to Gentoo Linux (I've been using Arch in my laptop for a while now). But, of course, I need a C# + XNA alternative... I'm not really an expert in any language, so I can really pick up anything (except, maybe, Functional ones), I prefer C-Like languages like Java or Ruby, I tried Python but found the Whitespace syntax confusing. I would like to hear some of you'r suggestions, I'm not asking for "the best", but for "some suggestions", so I think this is objective enough. Probably you're going to suggest C++ + SDL, but I would prefer something more "High Level" like XNA, but I'm open to discuss anything. So... any ideas ? Note: I think this questions meets the guidelines for this site, if it doesn't: please not only downvote this question, but comment on what can I do to improve it. Thanks. PS: 2D Games, not 3D

    Read the article

  • Context-specific remap

    - by dotancohen
    I have the following handy VIM map: inoremap ( ()<Left> However, sometimes I will enter Insert mode to add a function call around a variable, like so: Was: $sql = "SELECT * FROM " . $someTable; To: $sql = "SELECT * FROM " . mysql_real_escape_string($someTable); The mapping makes a redundant ) after mysql_real_escape_string(. Is there any way to refactor the mapping so that if there exists a character after the cursor, and the character after the cursor is not whitespace, then )<left> is not appended to (? Thanks.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • In Sublime Text 2, how can I indent out to a straight column with multiple cursors on a ragged edge?

    - by mtoast
    Suppose I've got multiple cursors along several lines, like this: foo| barr| foobar| baz| How can I automatically push the whitespace at the end of each line out to a flat edge, like this?: foo | barr | foobar | baz | (In these examples, | is supposed to be my cursor.) EDIT #1 When you just Tab or Space from the initial arrangement, you get this: # Useful, but not what I'm looking for foo | barr | foobar | baz | That's useful, but not what I'm looking for. I'm looking for some kind of keyboard shortcut that will let me indent from a ragged multi-cursor insert out to a straight column.

    Read the article

  • Reducing the size of the EDB file.

    - by Toby
    I have hit an issue on a MS SBS machine where every morning the datastore for the exchange mailboxes dismounts itself. We believe the issue is that it has grown too large over time and needs cut down a bit. As part of this we have removed (purged) some mail files that were no longer needed, which should have given us a saving of roughly 3GB (more than enough saving for what we need). So I deleted the mailboxes, then purged them and noticed that the .edb file was still reporting the same size, I dismounted and remounted it to see if that would have any effect but it did not. Am I missing a step? I have read online that you can run offline defrag on the file but that seems to only save you a small amount of whitespace. Any help would be greatly appreciated.

    Read the article

  • overriding ctype<wchar_t>

    - by Potatoswatter
    I'm writing a lambda calculus interpreter for fun and practice. I got iostreams to properly tokenize identifiers by adding a ctype facet which defines punctuation as whitespace: struct token_ctype : ctype<char> { mask t[ table_size ]; token_ctype() : ctype<char>( t ) { for ( size_t tx = 0; tx < table_size; ++ tx ) { t[tx] = isalnum( tx )? alnum : space; } } }; (classic_table() would probably be cleaner but that doesn't work on OS X!) And then swap the facet in when I hit an identifier: locale token_loc( in.getloc(), new token_ctype ); … locale const &oldloc = in.imbue( token_loc ); in.unget() >> token; in.imbue( oldloc ); There seems to be surprisingly little lambda calculus code on the Web. Most of what I've found so far is full of unicode ? characters. So I thought to try adding Unicode support. But ctype<wchar_t> works completely differently from ctype<char>. There is no master table; there are four methods do_is x2, do_scan_is, and do_scan_not. So I did this: struct token_ctype : ctype< wchar_t > { typedef ctype<wchar_t> base; bool do_is( mask m, char_type c ) const { return base::do_is(m,c) || (m&space) && ( base::do_is(punct,c) || c == L'?' ); } const char_type* do_is (const char_type* lo, const char_type* hi, mask* vec) const { base::do_is(lo,hi,vec); for ( mask *vp = vec; lo != hi; ++ vp, ++ lo ) { if ( *vp & punct || *lo == L'?' ) *vp |= space; } return hi; } const char_type *do_scan_is (mask m, const char_type* lo, const char_type* hi) const { if ( m & space ) m |= punct; hi = do_scan_is(m,lo,hi); if ( m & space ) hi = find( lo, hi, L'?' ); return hi; } const char_type *do_scan_not (mask m, const char_type* lo, const char_type* hi) const { if ( m & space ) { m |= punct; while ( * ( lo = base::do_scan_not(m,lo,hi) ) == L'?' && lo != hi ) ++ lo; return lo; } return base::do_scan_not(m,lo,hi); } }; (Apologies for the flat formatting; the preview converted the tabs differently.) The code is WAY less elegant. I does better express the notion that only punctuation is additional whitespace, but that would've been fine in the original had I had classic_table. Is there a simpler way to do this? Do I really need all those overloads? (Testing showed do_scan_not is extraneous here, but I'm thinking more broadly.) Am I abusing facets in the first place? Is the above even correct? Would it be better style to implement less logic?

    Read the article

  • Using SQLXML Bulk Load in .NET Environment - Error with One to Many relationship on Complex Type

    - by user331111
    Hi, I have an error when I am importing an XML file using SQLXMLBulkLoad, wondering if anyone could help. Error: Data mapping to column 'Attribute' was already found in the data. Make sure that no two schema definitions map to the same column Full files and details can be found here http://www.experts-exchange.com/Microsoft/Development/MS-SQL-Server/SQL-Server-2005/Q_26102239.html Exert from XSD: <sql:relationship name="EnvironmentDECAttributes" parent="Environment" parent-key="intEnvironmentID" child="DECAttributes" child-key="intEnvironmentID"/> <complexType name="Environment"> <sequence> <element name="ESANumber" minOccurs="0"> <annotation> <documentation> Environmentally Sensitive Area Number </documentation> </annotation> <simpleType> <restriction base="string"> <maxLength value="15"/> <whiteSpace value="collapse"/> </restriction> </simpleType> </element> <element name="Conditions" minOccurs="0" sql:relation="Conditions" sql:relationship="EnvironmentConditions"> <complexType> <sequence> <element name="Condition" type="vms:EnvironmentalConditions" minOccurs="0" maxOccurs="5"/> </sequence> </complexType> </element> <element name="DECDistrict" minOccurs="0"> <annotation> <documentation> Department of Environment &amp; Conservation District </documentation> </annotation> <simpleType> <restriction base="string"> <maxLength value="31"/> <whiteSpace value="collapse"/> </restriction> </simpleType> </element> <element name="DECAttributes" minOccurs="0" maxOccurs="1" sql:relation="DECAttributes" sql:relationship="EnvironmentDECAttributes"> <complexType> <sequence> <element name="Attribute" type="vms:DECAttributes" minOccurs="0" maxOccurs="unbounded" sql:field="Attribute"> <annotation> <documentation> Department of Environment &amp; Conservation attributes. </documentation> </annotation> </element> </sequence> </complexType> </element> </sequence> </complexType> Exert from XML: <Environment> <DECAttributes> <Attribute>WA</Attribute> <Attribute>SA</Attribute> </DECAttributes> </Environment> Any help/ comments would be appreciated Thanks C

    Read the article

  • XmlException - inserting attribute gives "unexpected token" exception

    - by Anders Svensson
    Hi, I have an XmlDocument object in C# that I transform, using XslTransform, to html. In the stylesheet I insert an id attribute in a span tag, taking the id from an element in the XmlDocument. Here is the template for the element: <xsl:template match="word"> <span> <xsl:attribute name="id"><xsl:value-of select="@id"></xsl:value-of></xsl:attribute> <xsl:apply-templates/> </span> </xsl:template> But then I want to process the result document as an xhtml document (using the XmlDocument dom). So I'm taking a selected element in the html, creating a range out of it, and try to load the element using XmlLoad(): wordElem.LoadXml(range.htmlText); But this gives me the following exception: "'598' is an unexpected token. The expected token is '"' or '''. Line 1, position 10." And if I move the cursor over the range.htmlText, I see the tags for the element, and the "id" shows without quotes, which confuses me (i.e.SPAN id=598 instead of SPAN id="598"). To confuse the matter further, if I insert a blank space or something like that in the value of the id in the stylesheet, it works fine, i.e.: <span> <xsl:attribute name="id"><xsl:text> </xsl:text> <xsl:value-of select="@id"></xsl:value-of></xsl:attribute> <xsl:apply-templates/> </span> (Notice the whitespace in the xsl:text element). Now if I move the cursor over the range.htmlText, I see an id with quotes as usual in attributes (and as it shows if I open the html file in notepad or something). What is going on here? Why can't I insert an attribute this way and have a result that is acceptable as xhtml for XmlDocument to read? I feel I am missing something fundamental, but all this surprises me, since I do this sort of transformations using xsl:attribute to insert attributes all the time for other types of xsl transformations. Why doesn't XmlDocument accept this value? By the way, it doesn't matter if it is an id attribute. i have tried with the "class" attribute, "style" etc, and also using literal values such as "style" and setting the value to "color:red" and so on. The compiler always complains it is an unvalid token, and does not include quotes for the value unless there is a whitespace or something else in there (linebreaks etc.). I hope I have provided enough information. Any help will be greatly appreciated. Basically, what I want to accomplish is set an id in a span element in html, select a word in a webbrowser control with this document loaded, and get the id attribute out of the selected element. I've accomplished everything, and can actually do what I want, but only if I use regex e.g. to get the attribute value, and I want to be able to use XmlDocument instead to simply get the value out of the attribute directly. I'm sure I'm missing something simple, but if so please tell me. Regards, Anders

    Read the article

< Previous Page | 9 10 11 12 13 14 15 16 17 18 19 20  | Next Page >