Search Results

Search found 4688 results on 188 pages for 'io redirection'.

Page 130/188 | < Previous Page | 126 127 128 129 130 131 132 133 134 135 136 137  | Next Page >

  • Is there any explorer.exe problem in windows 7 ?

    - by sml
    s += "<p style=\"text-align: left;\"><a href=\"javascript:window.print()\">PRINT</a></p>"; System.IO.File.WriteAllText(@"CheckForm.html", s); System.Diagnostics.ProcessStartInfo startInfo = new System.Diagnostics.ProcessStartInfo(); startInfo.FileName = "explorer.exe"; startInfo.Arguments = "CheckForm.html"; System.Diagnostics.Process.Start(startInfo); I'm having a trouble when I tried to open my c# windows application in windows 7 otherwise there is no problem. I couldn't open explorer.exe in Windows 7 with above code. Any suggestions?

    Read the article

  • Can obfuscation (proguard) lead to MIDlet malfunction?

    - by eMgz
    Hi, Im trying to obfuscate a Java MIDlet with proguard. It runs ok on the PC, however, when I run it on the phone, the program opens, connects to the server, and then freezes. If I disable obfuscation, it runs ok again on the phone. Ive tryed all the obfuscation levels for apps (7, 8 and 9 at NetBeans), and none of them seems to work properly, and I cant release this app for comercial use without obfuscation. Also, the compiler throws some warnings: Note: duplicate definition of library class [java.io.ByteArrayOutputStream] Note: there were 14 duplicate class definitions. But I dont know if this is realy the problem. Does anyone knows what is wrong? The obfuscator arguments are listed below: Obfuscator Arguments (7): -dontusemixedcaseclassnames -default package '' -keep public class ** { public *; } Obfuscator Arguments (8): same as (7) plus -overloadaggressively. Obfuscator Arguments (9): same as (8) but -keep public class ** extends javax.microedition.midlet.MIDlet { public *; } instead. Thanks.

    Read the article

  • Reworking my singly linked list

    - by Stradigos
    Hello everyone, thanks for taking the time to stop by my question. Below you will find my working SLL, but I want to make more use of C# and, instead of having two classes, SLL and Node, I want to use Node's constructors to do all the work (To where if you pass a string through the node, the constructor will chop it up into char nodes). The problem is, after an a few hours of tinkering, I'm not really getting anywhere... using System; using System.Collections.Generic; using System.Text; using System.IO; namespace PalindromeTester { class Program { static void Main(string[] args) { SLL mySLL = new SLL(); mySLL.add('a'); mySLL.add('b'); mySLL.add('c'); mySLL.add('d'); mySLL.add('e'); mySLL.add('f'); Console.Out.WriteLine("Node count = " + mySLL.count); mySLL.reverse(); mySLL.traverse(); Console.Out.WriteLine("\n The header is: " + mySLL.gethead); Console.In.ReadLine(); } class Node { private char letter; private Node next; public Node() { next = null; } public Node(char c) { this.data = c; } public Node(string s) { } public char data { get { return letter; } set { letter = value; } } public Node nextNode { get { return next; } set { next = value; } } } class SLL { private Node head; private int totalNode; public SLL() { head = null; totalNode = 0; } public void add(char s) { if (head == null) { head = new Node(); head.data = s; } else { Node temp; temp = new Node(); temp.data = s; temp.nextNode = head; head = temp; } totalNode++; } public int count { get { return totalNode; } } public char gethead { get { return head.data; } } public void traverse() { Node temp = head; while(temp != null) { Console.Write(temp.data + " "); temp = temp.nextNode; } } public void reverse() { Node q = null; Node p = this.head; while(p!=null) { Node r=p; p=p.nextNode; r.nextNode=q; q=r; } this.head = q; } } } } Here's what I have so far in trying to work it into Node's constructors: using System; using System.Collections.Generic; using System.Text; using System.IO; namespace PalindromeTester { class Program { static void Main(string[] args) { //Node myList = new Node(); //TextReader tr = new StreamReader("data.txt"); //string line; //while ((line = tr.ReadLine()) != null) //{ // Console.WriteLine(line); //} //tr.Close(); Node myNode = new Node("hello"); Console.Out.WriteLine(myNode.count); myNode.reverse(); myNode.traverse(); // Console.Out.WriteLine(myNode.gethead); Console.In.ReadLine(); } class Node { private char letter; private Node next; private Node head; private int totalNode; public Node() { head = null; totalNode = 0; } public Node(char c) { if (head == null) { head = new Node(); head.data = c; } else { Node temp; temp = new Node(); temp.data = c; temp.nextNode = head; head = temp; } totalNode++; } public Node(string s) { foreach (char x in s) { new Node(x); } } public char data { get { return letter; } set { letter = value; } } public Node nextNode { get { return next; } set { next = value; } } public void reverse() { Node q = null; Node p = this.head; while (p != null) { Node r = p; p = p.nextNode; r.nextNode = q; q = r; } this.head = q; } public void traverse() { Node temp = head; while (temp != null) { Console.Write(temp.data + " "); temp = temp.nextNode; } } public int count { get { return totalNode; } } } } } Ideally, the only constructors and methods I would be left with are Node(), Node(char c), Node(string s), Node reserve() and I'll be reworking traverse into a ToString overload. Any suggestions?

    Read the article

  • Can't get my head around background workers in .NET

    - by Connel
    I have wrote an application that syncs two folders together. The problem with the program is that it stops responding whilst copying files. A quick search of stack-overflow told me I need to use something called a background worker. I have read a few pages on the net about this but find it really hard to understand as I'm pretty new to programming. Below is the code for my application - how can I simply put all of the File.Copy(....) commands into their own background worker (if that's even how it works)? Below is the code for the button click event that runs the sub procedure and the sub procedure I wish to use a background worker on all the File.Copy lines. Button event: protected virtual void OnBtnSyncClicked (object sender, System.EventArgs e) { //sets running boolean to true booRunning=true; //sets progress bar to 0 prgProgressBar.Fraction = 0; //resets values used by progressbar dblCurrentStatus = 0; dblFolderSize = 0; //tests if user has entered the same folder for both target and destination if (fchDestination.CurrentFolder == fchTarget.CurrentFolder) { //creates message box MessageDialog msdSame = new MessageDialog(this, DialogFlags.Modal, MessageType.Error, ButtonsType.Close, "You cannot sync two folders that are the same"); //sets message box title msdSame.Title="Error"; //sets respone type ResponseType response = (ResponseType) msdSame.Run(); //if user clicks on close button or closes window then close message box if (response == ResponseType.Close || response == ResponseType.DeleteEvent) { msdSame.Destroy(); } return; } //tests if user has entered a target folder that is an extension of the destination folder // or if user has entered a desatination folder that is an extension of the target folder if (fchTarget.CurrentFolder.StartsWith(fchDestination.CurrentFolder) || fchDestination.CurrentFolder.StartsWith(fchTarget.CurrentFolder)) { //creates message box MessageDialog msdContains = new MessageDialog(this, DialogFlags.Modal, MessageType.Error, ButtonsType.Close, "You cannot sync a folder with one of its parent folders"); //sets message box title msdContains.Title="Error"; //sets respone type and runs message box ResponseType response = (ResponseType) msdContains.Run(); //if user clicks on close button or closes window then close message box if (response == ResponseType.Close || response == ResponseType.DeleteEvent) { msdContains.Destroy(); } return; } //gets folder size of target folder FileSizeOfTarget(fchTarget.CurrentFolder); //gets folder size of destination folder FileSizeOfDestination(fchDestination.CurrentFolder); //runs SyncTarget procedure SyncTarget(fchTarget.CurrentFolder); //runs SyncDestination procedure SyncDestination(fchDestination.CurrentFolder); //informs user process is complete prgProgressBar.Text = "Finished"; //sets running bool to false booRunning = false; } Sync sub-procedure: protected void SyncTarget (string strCurrentDirectory) { //string array of all the directories in directory string[] staAllDirectories = Directory.GetDirectories(strCurrentDirectory); //string array of all the files in directory string[] staAllFiles = Directory.GetFiles(strCurrentDirectory); //loop over each file in directory foreach (string strFile in staAllFiles) { //string of just the file's name and not its path string strFileName = System.IO.Path.GetFileName(strFile); //string containing directory in target folder string strDirectoryInsideTarget = System.IO.Path.GetDirectoryName(strFile).Substring(fchTarget.CurrentFolder.Length); //inform user as to what file is being copied prgProgressBar.Text="Syncing " + strFile; //tests if file does not exist in destination folder if (!File.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName)) { //if file does not exist copy it to destination folder, the true below means overwrite if file already exists File.Copy (strFile, fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName, true); } //tests if file does exist in destination folder if (File.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName)) { //long (number) that contains date of last write time of target file long lngTargetFileDate = File.GetLastWriteTime(strFile).ToFileTime(); //long (number) that contains date of last write time of destination file long lngDestinationFileDate = File.GetLastWriteTime(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName).ToFileTime(); //tests if target file is newer than destination file if (lngTargetFileDate > lngDestinationFileDate) { //if it is newer then copy file from target folder to destination folder File.Copy (strFile, fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget + "/" + strFileName, true); } } //gets current file size FileInfo FileSize = new FileInfo(strFile); //sets file's filesize to dblCurrentStatus and adds it to current total of files dblCurrentStatus = dblCurrentStatus + FileSize.Length; double dblPercentage = dblCurrentStatus/dblFolderSize; prgProgressBar.Fraction = dblPercentage; } //loop over each folder in target folder foreach (string strDirectory in staAllDirectories) { //string containing directories inside target folder but not any higher directories string strDirectoryInsideTarget = strDirectory.Substring(fchTarget.CurrentFolder.Length); //tests if directory does not exist inside destination folder if (!Directory.Exists(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget)) { //it directory does not exisit create it Directory.CreateDirectory(fchDestination.CurrentFolder + "/" + strDirectoryInsideTarget); } //run sync on all files in directory SyncTarget(strDirectory); } } Any help will be greatly appreciated as after this the program will pretty much be finished :D

    Read the article

  • DataContractJsonSerializer set value extension point

    - by svinto
    using System.IO; using System.Runtime.Serialization; using System.Runtime.Serialization.Json; using System.Text; namespace ConsoleApplication1 { internal class Program { private static void Main(string[] args) { var pony = new Pony(); var serializer = new DataContractJsonSerializer(pony.GetType()); var example = @"{""Foo"":null}"; var stream = new MemoryStream(Encoding.UTF8.GetBytes(example.ToCharArray())); stream.Position = 0; pony = (Pony) serializer.ReadObject(stream); // The previous line throws an exception. } } [DataContract] public class Pony { [DataMember] private int Foo { get; set; } } } Sometimes the serialization throws a casting error on Int32s being set to null. Is there any way to hook into the Json-serializer?

    Read the article

  • Problem using System.Xml in unit test in MonoDevelop (MonoTouch)

    - by hambonious
    I'm new to the MonoDevelop and MonoTouch environment so hopefully I'm just missing something easy here. When I have a unit test that requires the System.Xml or System.Xml.Linq namespaces, I get the following error when I run the test: System.IO.FileNotFoundException : Could not load file or assembly 'System.Xml.Linq, Version=2.0.5.0, Culture=neutral, PublicKeyToken=31bf3856ad364e35' or one of its dependencies. Things I've verified: I have the proper usings in the test. The project builds with no problems. Using these namespaces work fine when I run the app in the emulator. I've written a very simple unit test to prove that unit testing works at all (and it does). I'm a test driven kinda guy so I can't wait to get this working so I can progress with my app. Thanks in advance.

    Read the article

  • Seam cache provider with ehcache null

    - by Cateno Viglio
    Hi every one, I'm trying to configure seam/ehcache following the tutorial from jboss page: http://docs.jboss.org/seam/2.1.2/reference/en-US/html/cache.html I put the ehcache.1.2.3.jar in project.ear/lib and injected CacheProvider as especified, but the CacheProvider always return null. The documentation doesn't show any aditional configuration for ehcache, just for jboss cache. I am probably doing something wrong, it's impossible be so easy :). besides put the jar in /lib, i created the following seam component to test: @Scope(ScopeType.SESSION) @Name("cacheBean") public class CacheSeamBean implements java.io.Serializable { @In(required=false, create=true) private EntityManager em; @Logger private Log log; @In private Events events; @In CacheProvider cacheProvider; Boolean blLoaded = Boolean.FALSE; @Create public void buscar() { if (!blLoaded){ List<Parametro> lstParametro = em.createQuery("select p from Parametro p").getResultList(); for (Parametro parametro : lstParametro){ cacheProvider.put(parametro.getCodigo(), parametro.getValor()); } blLoaded= Boolean.TRUE; } } } Thanks

    Read the article

  • Multiple schema validation in Java

    - by user279554
    Hi, I am trying to do multiple schema validation in Java. I don't understand where I am doing wrong. Any help will be appreciated. abc.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:xn="project-xml-r4j_another.xsd"> <xsd:import namespace="project-xml-r4j_another.xsd"/> <xsd:element name="abc" type="abc"> </xsd:element> <xsd:complexType name="abc"> <xsd:sequence> <xsd:element name="test" type="test" minOccurs="0" maxOccurs="1"> </xsd:element> <!--<xsd:element name="proj" type="xn:proj"/>--> </xsd:sequence> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> <xsd:complexType name="test"> <xsd:attribute name="id" type="xsd:ID" use="required"></xsd:attribute> <xsd:attribute name="value" use="required"> <xsd:simpleType> <xsd:restriction base="xsd:string"> <xsd:maxLength value="100" /> </xsd:restriction> </xsd:simpleType> </xsd:attribute> </xsd:complexType> </xsd:schema> project-xml-r4j_another.xsd <?xml version="1.0" encoding="UTF-8"?> <xsd:schema xmlns:xsd="http://www.w3.org/2001/XMLSchema" targetNamespace="project-xml-r4j_another.xsd" xmlns="project-xml-r4j_another.xsd" elementFormDefault="qualified" attributeFormDefault="unqualified"> <xsd:element name="proj" type="proj"> <xsd:annotation> <xsd:documentation> The project is the root tag of a project-xml. </xsd:documentation> </xsd:annotation> </xsd:element> <xsd:complexType name="proj"> <xsd:attribute name="id" type="xsd:ID" use="required"/> </xsd:complexType> </xsd:schema> Test case package test; import java.io.File; import java.io.IOException; import javax.xml.XMLConstants; import javax.xml.transform.Source; import javax.xml.transform.stream.StreamSource; import javax.xml.validation.Schema; import javax.xml.validation.SchemaFactory; import javax.xml.validation.Validator; import org.apache.log4j.Logger; import org.junit.Test; import org.xml.sax.SAXException; import org.xml.sax.SAXParseException; import org.xml.sax.helpers.DefaultHandler; import com.ericsson.ccrtool.core.project.projectxml.InvalidProjectXmlException; public class TestSchema { private static final Logger logger = Logger.getLogger(TestSchema.class); static final String W3C_XML_SCHEMA = XMLConstants.W3C_XML_SCHEMA_NS_URI; @Test public void test() { System.out.println("TestSchema.test()"); try { SchemaFactory schemaFactory = SchemaFactory.newInstance(W3C_XML_SCHEMA); // create a grammar object. Source [] source = { new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\abc.xsd")), new StreamSource(new File("C:\\jaydeep\\Ericsson\\R5B\\project-xml-r4j.xsd"))}; Schema schemaGrammar = schemaFactory.newSchema(source); Validator schemaValidator = schemaGrammar.newValidator(); schemaValidator.setErrorHandler(new MessageHandler()); // validate xml instance against the grammar. schemaValidator.validate(new StreamSource("C:\\jaydeep\\Ericsson\\R5B\\project_tmmk17cells_xnaveen_project-xml.xml")); } catch (SAXException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } catch (IOException e) { throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + e.getMessage(), e); } } class MessageHandler extends DefaultHandler { private String errMessage = ""; @Override public void warning(SAXParseException e) { logger.info("Warning Line " + e.getLineNumber() + ": " + e.getMessage()); } @Override public void error(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } @Override public void fatalError(SAXParseException e) { errMessage = new String("Error Line " + e.getLineNumber() + ": " + e.getMessage()); logger.info(errMessage); throw new InvalidProjectXmlException("Project-xml validation failed, Exception: " + errMessage); } } } Thanks, Jaydeep

    Read the article

  • Need help with displaying the message correctly in the pole display

    - by SA
    Hi, I am using an HP RS232 pole display with the following setting: Char type: USA/Europe (default) Command mode: EPSON (default) Baud rate: 9600, n , 8, 1 (default?) Passthru None (Default) Here's the code using System.IO.Ports; private SerialPort port; port = new SerialPort("COM2", 9600, Parity.None, 8, StopBits.One); port.Handshake = Handshake.None; Port.WriteLine("Welocome to something something"); It has 2 lines consisting of 20 characters each with a total of 40 characters. I have no control how and where the characters get displayed. I have set it to accept ASCII char set and so I am able to type as is visble in the Writeline message

    Read the article

  • How to force javax xslt transformer to encode entities in utf-8?

    - by calavera.info
    I'm working on filter that should transform an output with some stylesheet. Important sections of code looks like this: PrintWriter out = response.getWriter(); ... StringReader sr = new StringReader(content); Source xmlSource = new StreamSource(sr, requestSystemId); transformer.setOutputProperty(OutputKeys.ENCODING, "UTF-8"); transformer.setParameter("encoding", "UTF-8"); //same result when using ByteArrayOutputStream xo = new java.io.ByteArrayOutputStream(); StringWriter xo = new StringWriter(); StreamResult result = new StreamResult(xo); transformer.transform(xmlSource, result); out.write(xo.toString()); The problem is that national characters are encoded as html entities and not by using UTF. Is there any way to force transformer to use UTF-8 instead of entities?

    Read the article

  • Naming convention for utility classes in Java

    - by Zarjay
    When writing utility classes in Java, what are some good guidelines to follow? Should packges be "util" or "utils"? Is it ClassUtil or ClassUtils? When is a class a "Helper" or a "Utility"? Utility or Utilities? Or do you use a mixture of them? The standard Java library uses both Utils and Utilities: javax.swing.Utilities javax.print.attribute.AttributeSetUtilities javax.swing.plaf.basic.BasicGraphicsUtils Apache uses a variety of Util and Utils, although mostly Utils: org.apache.commons.modeler.util.DomUtil org.apache.commons.modeler.util.IntrospectionUtils org.apache.commons.io.FileSystemUtils org.apache.lucene.wordnet.AnalyzerUtil org.apache.lucene.util.ArrayUtil org.apache.lucene.xmlparser.DOMUtils Spring uses a lot of Helper and Utils classes: org.springframework.web.util.UrlPathHelper org.springframework.core.ReflectiveVisitorHelper org.springframework.core.NestedExceptionUtils org.springframework.util.NumberUtils So, how do you name your utility classes?

    Read the article

  • StackExchange API key

    - by user21289
    I am working on a project with the StackExchange API, the problem is at a moment I have this Exception on eclipse console: java.io.IOException: Server returned HTTP response code: 400 for URL: https://api.stackexchange.com/2.1/questions?order=desc&sort=votes&tagged=OSM&site=stackoverflow at sun.net.www.protocol.http.HttpURLConnection.getInputStream(Unknown Source) at sun.net.www.protocol.https.HttpsURLConnectionImpl.getInputStream(Unknown Source) atbr.inf.pucrio.sog.StackOverflowAcessor.getQuestionsIds(StackOverflowAcessor.java:41) After verifying on the browser with the same link, I have this error message: {"error_id":502,"error_name":"throttle_violation","error_message":"too many requests from this IP, more requests available in 74089 seconds"} I am wondering if this is dur to the limited numbers of the queries per day, if it is the case, how can I do to have the key? if it is not, how can I do to resolve the problem?

    Read the article

  • Compact Framework : Read a SQL CE database on a PDA from a PC

    - by CF_Maintainer
    Hello, I have tasked with upgrading a CF Framework 1.1 suite of apps. Currently, the PC starts a server [after confirming via RAPI that the device exists and is connected] and spawns a app on the PDA as the client. The client process on the PDA talks with the db on the PDA and returns records to the PC app [using SQL CE 2.0. OpenNETCF 1.4 for communication/io]. I have a chance to upgrade the PC and PDA suite of apps to Framework 3.5 & CF 3.5 respectively. Due to a business requirement, I cannot get rid of workflow requiring the PC app to show a preview of the work done on the PDA. Question : Are there better ways to achieve the above in general with the constraints I have? I would really appreciate any Ideas/advice.

    Read the article

  • Android serialization: ImageView

    - by embo
    I have a simple class: public class Ball2 extends ImageView implements Serializable { public Ball2(Context context) { super(context); } } Serialization ok: private void saveState() throws IOException { ObjectOutputStream oos = new ObjectOutputStream(openFileOutput("data", MODE_PRIVATE)); try { Ball2 data = new Ball2(Game2.this); oos.writeObject(data); oos.flush(); } catch (Exception e) { Log.e("write error", e.getMessage(), e); } finally { oos.close(); } } But deserealization private void loadState() throws IOException { ObjectInputStream ois = new ObjectInputStream(openFileInput("data")); try { Ball2 data = (Ball2) ois.readObject(); } catch (Exception e) { Log.e("read error", e.getMessage(), e); } finally { ois.close(); } } fail with error: 03-24 21:52:43.305: ERROR/read error(1948): java.io.InvalidClassException: android.widget.ImageView; IllegalAccessException How deserialize object correctly?

    Read the article

  • Android RandomAccessFile usage from resource

    - by lacas
    my code is String fileIn = resources.getResourceName(resourceID); Log.e("fileIn", fileIn); //BufferedReader buffer = new BufferedReader(new InputStreamReader(fileIn)); RandomAccessFile buffer = null; try { buffer = new RandomAccessFile(fileIn, "r"); } catch (FileNotFoundException e) { Log.e("err", ""+e); } /fileIn(6062): ls3d.gold.paper:raw/wwe_obj i get 11-26 15:06:35.027: ERROR/err(6062): java.io.FileNotFoundException: /ls3d.gold.paper:raw/wwe_obj (No such file or directory) How can I access a file using randomaccessfile in java? How can I load from a resource? (R.raw.wwe_obj)

    Read the article

  • Why is there a seemingly identical copy of the JDK 1.5 core runtime in org.osgi.foundation-1.0.0.jar?

    - by Jonathan Neufeld
    I am maintaining a web application that depends on OSGi and Maven pulls-in a jar called org.osgi-foundation-1.0.0.jar that seems to contain the same classes as part of the JDK core runtime such as: java.util.*; java.io.*; etc. and so on. This seems very strange and I have to ask why this is necessary. More-over, my web-application fails to deploy on JBoss 6 because these are "illegal package names" for a third-party library. What is the purpose of org.osgi-foundation-1.0.0.jar ? is it necessary?

    Read the article

  • Problem with building with csc task in Ant

    - by Wing C. Chen
    I have an ant build target using csc: <target name="compile"> <echo>Starting compiling ServiceLauncher</echo> <csc optimize="true" debug="true" warnLevel="1" unsafe="false" targetType="exe" failonerror="true" incremental="false" mainClass = "ServiceLauncher.Launcher" srcdir="ServiceLauncher/Launcher/" outputfile="ServiceLauncher.exe" > <reference file="libs/log4net.dll"/> <define name="RELEASE"/> </csc> </target> When I run it, the following exception comes up: csc failed: java.io.IOException: Cannot run program "csc": CreateProcess error=2, The system cannot find the file specified However, it runs without the exception but never correctly builds the .exe file, when I manually add in an empty ServiceLauncher.exe. How can I correctly build this .Net project "ServiceLauncher"?

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Java based Atom/RSS Library that works in Google App Engine

    - by Littlejon
    I am trying to publish an Atom/RSS feed in my Java based Google App Engine code. I have tried using Rome and keep getting the following error (tried googling without success), also the code I am running that generates the error is the demo code (so I get the feeling Rome won't work with GAE) java.lang.NoClassDefFoundError: org/jdom/JDOMException at com.sun.syndication.io.SyndFeedOutput.<init>(SyndFeedOutput.java:44) What I am looking for is recommendations for a simple Java library to create and publish an Atom feed from within Google App Engine. Thanks.

    Read the article

  • Java: conditional initialization?

    - by HH
    Ruby has conditional initialization. Apparently, Java does not or does it? I try to write more succintly, to limit the range as small as possible. import java.io.*; import java.util.*; public class InitFor{ public static void main(String[] args){ for(int i=7,k=999;i+((String h="hello").size())<10;i++){} System.out.println("It should be: hello = "+h); } } Errors Press ENTER or type command to continue InitFor.java:8: ')' expected for(int i=7,k=999;i+((String h="hello").size())<10;i++){} ^

    Read the article

  • /clr option in c++

    - by muhammad-aslam
    hello friendzz plz give me a solution for this error "fatal error C1190: managed targeted code requires a '/clr' option" HOw can i resolve this problem?? My configuration is .. Visual studio 2008 windows 7 Here is the code (i got by using net resources) using using namespace System; using namespace System::IO; int main() { // Create a reference to the current directory. DirectoryInfo* di = new DirectoryInfo(Environment::CurrentDirectory); // Create an array representing the files in the current directory. FileInfo* fi[] = di-GetFiles(); Console::WriteLine(S"The following files exist in the current directory:"); // Print out the names of the files in the current directory. Collections::IEnumerator* myEnum = fi-GetEnumerator(); while (myEnum-MoveNext()) { FileInfo* fiTemp = __try_cast(myEnum-Current); Console::WriteLine(fiTemp-Name); } } PLZZZZZZZZ

    Read the article

  • Linking IronPython to WPF

    - by DonnyD
    I just installed VS2010 and the great new IronPython Tools extension. Currently this extension doesn't yet generate event handlers in code upon double-clicking wpf visual controls. Is there anyone that can provide or point me to an example as to how to code wpf event handlers manually in python. I've had no luck finding any and I am new to visual studio. Upon generating a new ipython wpf project the auto-generated code is: import clr clr.AddReference('PresentationFramework') from System.Windows.Markup import XamlReader from System.Windows import Application from System.IO import FileStream, FileMode app = Application() app.Run(XamlReader.Load(FileStream('WpfApplication7.xaml', FileMode.Open))) and the XAML is: <Window xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" Title="WpfApplication7" Height="300" Width="300"> <Button>Click Me</Button> </Window> Any help would be appreciated.

    Read the article

  • Can't Use Path in ASP MVC Action

    - by user1477388
    I am trying to use Path() but it has a blue line under it and says, "local variable (path) cannot be referred to until it is declared." How can I use Path()? Imports System.Globalization Imports System.IO Public Class MessageController Inherits System.Web.Mvc.Controller <EmployeeAuthorize()> <HttpPost()> Function SendReply(ByVal id As Integer, ByVal message As String, ByVal files As IEnumerable(Of HttpPostedFileBase)) As JsonResult ' upload files For Each i In files If (i.ContentLength > 0) Then Dim fileName = path.GetFileName(i.FileName) Dim path = path.Combine(Server.MapPath("~/App_Data/uploads"), fileName) i.SaveAs(path) End If Next End Function End Class

    Read the article

  • Newbie Question: Read and Process a List of Text Files

    - by johnv
    I'm completely new to .NET and am trying as a first step to write a text processing program. The task is simple: I have a list of 10,000 text files stored in one folder, and I'm trying to read each one, store it as a string variable, then run it through a series of functions, then save the final output to another folder. So far I can only manage to manually input the file path like this (in VB.NET): Dim tRead As System.IO.StreamReader Public Function ReadFile() As String Dim EntireFile As String tRead = File.OpenText("c:\textexample\00001.txt") EntireFile = tRead.ReadToEnd Return EntireFile End Function Public Function Step1() ..... End Function Public Function Step2() ..... End Function .............. I'm wondering, therefore, if there's a way to automate this process. Perhaps for example store all input file path into a text file then read each entry at a time, then save the final output into the save path, again listed in a text file. Any help is greatly appreciated. ReplyQuote

    Read the article

  • Spring: Inject static member (System.in) via constructor

    - by Julian Lettner
    I wrote some sort of console client for a simple application. To be more flexible, I thought it would be nice to only depend on java.io.Input-/OutputStream, instead of accessing System.in/out directly. I renamed the class ConsoleClient to StreamClient, added setters and made sure that the instance fields are used instead of System.in/out. At the moment my client code looks like this: ApplicationContext appCtx = new ClassPathXmlApplicationContext("..."); StreamClient cc = (StreamClient) appCtx.getBean("streamClient"); cc.setInputStream(System.in); cc.setOutputStream(System.out); cc.run(); // start client Question: Is there a way to move lines 3 and 4 into the Spring configuration (preferably constructor injection)? Thanks for your time.

    Read the article

< Previous Page | 126 127 128 129 130 131 132 133 134 135 136 137  | Next Page >