Search Results

Search found 21488 results on 860 pages for 'image conversion'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 131/860 | < Previous Page | 127 128 129 130 131 132 133 134 135 136 137 138  | Next Page >

  • Unusable Source for Ubuntu image on Xen 3

    - by Roberto Aloi
    Hi all, I'm trying to create a new VM in Xen 3, running Ubuntu 10.4 (32 bit) as the guest OS. Xen 3 is installed on a machine running OpenSuse 11.2. I downloaded the Ubuntu image from the ubuntu.com website and I mounted it on /dev/loop0. When I try to create the new VM in Xen with the given source, Xen complains the "source is unusable". I've also checked the md5 sum for the image. It's fine. Any suggestion or hint that could help me?

    Read the article

  • free Raw-File Converter/Editor

    - by RCIX
    I have RAW files output by a program with a specific set of properties (Photoshop RAW, 16 bits, IBM PC byte order, no header, 1 non-interleaved channel, variable sizes like 257X257 or 129X513); does anyone know of a free tool that will allow me to convert to and from this format, and possibly do basic editing (selection, copy/paste, rotation of selection)? I've tried Picasa, XNView, and Paint Shop Pro 7 and none of them work properly. The closest i get is Paint Shop Pro which will at least make a serviceable attempt to open these files but i can't set all of the proper settings. XNView just might be able to edit it if i can figure out how to change the open settings for a particular raw file. So my questions at current are: how do i tell XNView to open a raw file a particular way? Failing that, is there any free tool that can open Photoshop-RAW files with the above settings (that's not photoshop)? If it helps, i'm trying to import/export/edit hieghtmap data for maps for Supreme Commander.

    Read the article

  • Taking an image backup of an entire server?

    - by WarDoGG
    I am currently using a dedicated server for my hosting needs. However, the costs are too high and I would like to suspend everything until I work out my business strategy again. Is there a way I can take a complete backup of the filesystem and run it in VMWare ? I cannot just copy the entire filesystem because there are lots of tools installed and tight changes to the server configuration files I myself dont know about (by the developers), but I need a snapshot of the entire disk image along with processes installed and everything is as is because for development needs, I need to work on this copy in VMWare or VirtualBox etc. Is it possible for me to take a full image copy ? How do I do it ?

    Read the article

  • mkvmerge: How to merge two videos, one without audio?

    - by ProGNOMmers
    I have two videos, one without audio (the second). Trying to merge them I have this error: mkvmerge concat1.webm +concat2.webm -o output.webm mkvmerge v5.8.0 ('No Sleep / Pillow') built on Oct 19 2012 13:07:37 Automatically enabling WebM compliance mode due to output file name extension. 'concat1.webm': Using the demultiplexer for the format 'Matroska'. concat2.webm': Using the demultiplexer for the format 'Matroska'. 'concat1.webm' track 0: Using the output module for the format 'VP8'. concat2.webm' track 0: Using the output module for the format 'VP8'. concat2.webm' track 1: Using the output module for the format 'Vorbis'. No append mapping was given for the file no. 1 (concat2.webm'). A default mapping of 1:0:0:0,1:1:0:1 will be used instead. Please keep that in mind if mkvmerge aborts with an error message regarding invalid '--append-to' options. Error: The file no. 0 ('concat1.webm') does not contain a track with the ID 1, or that track is not to be copied. Therefore no track can be appended to it. The argument for '--append-to' was invalid. Is there a way to say to mkvmerge to make the audio track longer? Thank you!

    Read the article

  • How can I get ffmpeg to convert a .mov to a .gif?

    - by user29336
    I'm trying to convert a .mov to a .gif and I'm not having success. Here's the error: ffmpeg -pix_fmt rgb24 -i yesbuddy.mov output.gif ffmpeg version 0.11.1 Copyright (c) 2000-2012 the FFmpeg developers built on Jun 12 2012 17:47:34 with clang 2.1 (tags/Apple/clang-163.7.1) configuration: --prefix=/usr/local/Cellar/ffmpeg/0.11.1 --enable-shared --enable-gpl --enable-version3 --enable-nonfree --enable-hardcoded-tables --enable-libfreetype --cc=/usr/bin/clang --enable-libx264 --enable-libfaac --enable-libmp3lame --enable-librtmp --enable-libtheora --enable-libvorbis --enable-libvpx --enable-libxvid --enable-libopencore-amrnb --enable-libopencore-amrwb --enable-libass --enable-libvo-aacenc --disable-ffplay libavutil 51. 54.100 / 51. 54.100 libavcodec 54. 23.100 / 54. 23.100 libavformat 54. 6.100 / 54. 6.100 libavdevice 54. 0.100 / 54. 0.100 libavfilter 2. 77.100 / 2. 77.100 libswscale 2. 1.100 / 2. 1.100 libswresample 0. 15.100 / 0. 15.100 libpostproc 52. 0.100 / 52. 0.100 Option pixel_format not found. If I leave out the -pix_fmt rgb24 part it complains. Thoughts on how to fix?

    Read the article

  • Unable to create a Windows 7 system image of a failing hard drive

    - by Rahul
    The hard disk of my one year old T400 Thinkpad has started failing periodic hardware tests. I get a "Targeted Read Test Failed" error. The "SMART short self test" times out. I am now trying to create a Windows 7 System image of the hard disk but it fails without giving any specific error messages. I tried using Comodo Backup but got an error (code 101117) there as well. I have copied the important files in Dropbox but would like to take a full System backup as I have plenty of software installed on the machine. Does anyone know why this is happening and how I can take a backup of the system image ?

    Read the article

  • How can I convert and repair MPEG-TS (DVB-S captures) for better playback?

    - by SofaKng
    I have a lot of MPEG-TS video files (H.264 video with AC3 or MP3 in a .TS container) captured from a DVB-S capture card. When I play these videos it's much slower to seek in the video (ie. skip 30 seconds, etc) than with other files. I'm not sure if the problem is the H.264 encoding (reference frame count?) or the MPEG-TS container, or if the MPEG-TS file contains sync errors, etc. Does anybody have a good workflow for converting and repairing these files?

    Read the article

  • Convert FAT32 to NTFS, risk/time?

    - by Rakward
    After a quick search I found that through a command prompt I can convert a drive from FAT32 to NTFS without losing data(see here). What I want to ask here is, how safe is this method on a 1.5 TB drive with 500 GB of data? What are the chances of this freezing up(or is there really nothin to worry about) and what is the probable time, a couple of minutes or a whole hour? Sorry if this seems like a stupid question, just want to play on the safe side here ...

    Read the article

  • Image doesn't fill monitor when connected via HDMI

    - by russau
    Connecting a Dell Studio Slim to a Dell ST2210 21.5" monitor. The PC has a ATI Radeon HD 4350 video card. The video card has DVI and HDMI connections. When I connect with the DVI everything works fine. When I connect with the HMDI the image doesn't fill the screen, i.e. there's a approx 1 inch black border around the image. Win7 tells me the res is 1920x1080 (the native res of the monitor). Tried rebooting, no luck.

    Read the article

  • How to embed word doc as background picture of an Access report using .EMF or equivalent ?

    - by iDevlop
    My company's standard paper has logo, address and all the details in the right margin with a vertical blue line. I have that as a word template. I want to have the same thing as the background of my Invoices report. I managed to do that 5 years ago by saving to EMF format (vector format, prints out nicely) and putting the file as the background of the report. Now my company is moving, and I need to change the address on my invoices, but I can't find out how I did to convert the word doc to EMF. Any suggestion ? By EMF or another process, but I want to avoid BMP, which is huge and does not print nicely. Thanks !

    Read the article

  • How can I convert a large number of Word documents to HTML as fast as possible?

    - by metal gear solid
    I have to convert 500 Microsoft Word 2003 files into HTML documents. What would be the shortest possible way? I'm not just talking about extension .doc to HTML. I want to convert word files's data into HTML tags. Word 2007 is installed in my system. Any suggestion which can help to accomplish this task quickly would be nice. If you will suggest any tool then that should not be commercial. Should be free or portable.

    Read the article

  • Batch converting video from avc1 to xvid

    - by Tommy Brunn
    I need a way to batch convert 720p video files from avc1 to xvid in Ubuntu 10.04. I'm not terribly concerned about file size, but I do wish to retain the picture quality as much as possible. I believe the audio is encoded as aac, which is fine for my purposes. What would be the best and easiest way to do this? I've tried using Handbrake. During my first attempt, I had it using ffmpeg to convert to MPEG-4, but that just gave me a super-low quality video at twice the file size. Trying h.264 now, so we'll see how that works out. But just in case it doesn't pan out so well, what other ways do you recommend? I was thinking I'd write a bash script to reencode the files one by one, but the problem is that I have very little knowledge about codecs and containers and whatnot - so I wouldn't know what parameters I would pass ffmpeg/mencoder.

    Read the article

  • Converting Powerpoint to PDF solutions?

    - by OWiz
    I asked a version of this question earlier, but I'm in need of other solutions, so this is a more pointed question. I'm in need of a server-based solution for converting ppt files to pdf files. This solution can either sit on the current web server as a console command-triggered service, it can be integrated into the C# code of the web all, or it can be it's own server. It also can't be based off of Libreoffice or Openoffice, as those two have problems converting SmartArt. I'm currently using Libreoffice. I've tried Powerpoint console commands combined with a PDF driver but I can't get that to work from C#. I've tried a .vbs script, but that briefly opens the powerpoint window.

    Read the article

  • How to suppress the unsolicited footer when converting HTML -> PDF with Acrobat?

    - by gojira
    I often convert & combine (via contextmenu) HTML pages to PDF using Acrobat (not Acrobat Reader). I use Adobe Acrobat Pro 9 Extended, version 9.1.2. The converted PDFs always have the full path of the original file on the bottom of the PDF-page, also they have an additional header line with the document. I need to suppress that. I do not want the unsolicited header and footer in the resulting PDF files as they are a pain to reomve manually, with a certain page count per document it becomes impossible. Is it possible to suppres that and if, how?

    Read the article

  • Batch convert AppleWorks files into PDF within originating folder, delete original file?

    - by Manca Weeks
    Probably AppleScript is the way to go with this - I have found scripts online that do this, but snag on oversize printable area and put files in the same folder - I need files to stay in the folder the source came from. If the script also deleted the original AppleWorks file, that would be even better, but not required. I have tried the last script from this post: https://discussions.apple.com/message/10127260#10127260#10127260 Any suggestions would be much appreciated.

    Read the article

  • Image resolution not showing up in "Get info" dialog in Mac OS X

    - by R.A
    When I bought a Mac Mini with Mac OS X, I could show image dimensions in the Get Info dialog. After that, I installed some mobile application development software and later I noticed, Get Info was not showing the image dimensions anymore. I need to check the dimensions of those images to include artwork in my project. Now, I reinstalled my Mac OS X and it's working fine – it is showing the dimensions: Before that, 516x314 was missing. Why did that happen? How can I prevent it from happening again?

    Read the article

  • how to know if a video file can be played on a dvd player

    - by user23950
    Is there an application that can emulate a dvd player? I've converted a .mp4 video using allok video converter. And choose the output format to be xVid(.avi)<--that is exactly what is written on the application. I don't want to waste a blank dvd and try if it really can be played. So if you have tried this before please tell me if it works. And I have tried burning .avi files and it works because they are genuine avi files which I did not convert

    Read the article

  • 500 MB Avi video from CD lagging/glitching when reproduced

    - by Caki Esther
    I created an extra cd with Nero Burning that contains both audio tracks (I can hear them correctly) and a .avi presentation (pretty big one, 540 MB on a 700 MB cd). The audio is fine but the problem is that when the video is played from the cd (with whatever media player: Windows Media Player, VLC, etc..) it lags/glitches/stutters. I'd like the video to be smooth, how should I burn the video to reduce this effect? I mean: what kind of compression/format and why?

    Read the article

  • convert video to images

    - by Liam
    How can I convert a video file to a sequence of images, for example one frame every N seconds. Can mplayer or ffmpeg do this? I have used MPlayer to grab screenshots manually but I would like to automate this for a long video.

    Read the article

  • Convert text to table

    - by Quattro
    I would like convert text into a table. Here is a link to the text http://www.tcdb.org/public/tcdb Short example: >gnl|TC-DB|A0CIB0|1.A.17.3.1 Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1 MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI >gnl|TC-DB|A0CS82|9.B.82.1.5 Chromosome undetermined scaffold_26, whole genome shotgun sequence - Paramecium tetraurelia. MIIEEQIEEKMIYKAIHRVKVNYQKKIDRYILYKKSRWFFNLLLMLLYAYRIQNIGGFYI VTYIYCVYQLQLLIDYFTPLGLPPVNLEDEEEDDDQFQNDFSELPTTLSNKNELNDKEFR PLLRTTSEFKVWQKSVFSVIFAYFCTYIPIWDIPVYWPFLFCYFFVIVGMSIRKYIKHMK KYGYTILDFTKKK I wanted to have columns for example delimited with pipe | or ; |>gnl|TC-DB|A0CIB0|1.A.17.3.1| Chromosome undetermined scaffold_19, whole genome shotgun sequence OS=Paramecium tetraurelia GN=GSPATT00007662001 PE=4 SV=1| MDDQNQPILQEQPKPKQKKPLLNTKMVKKQKMQNKKEENLREILNFYTNQVDARKFLQKM KAVVDSNQQEKKYQDDFLNPNEYNEMQDIYEDYNMGDLVIVFPNPDADGVKNPPITYKEA PLTKTNFYSKIGNVSYENDIDELCVDEMEYLRNMRNVDGEHMDQDHVKEEI I am working with Windows and I don't know how to do it I just know every row starts with > I want to substitute the first whitespace in a row with a delimiter like | or ; after the first regular expression new line in a row, I want also a delimiter everything between the regular expression first new line and > should go into a new column (it's a sequence of a protein)

    Read the article

  • PowerISO for Mac can't convert .img

    - by None
    I have a bootable .img file that I want to convert to a bootable .iso file. I downloaded poweriso for Mac and used this command: poweriso convert MyOS.img -o MyOS.iso -ot iso which returned this output: PowerISO Copyright(C) 2004-2008 PowerISO Computing, Inc Type poweriso -? for help MyOS.img: The file format is invalid or unsupported. I thought PowerISO could convert .img to .iso. Was I incorrect, or did I use the wrong commands or something like that?

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 127 128 129 130 131 132 133 134 135 136 137 138  | Next Page >