Search Results

Search found 1174 results on 47 pages for 'ashish kumar mehta'.

Page 14/47 | < Previous Page | 10 11 12 13 14 15 16 17 18 19 20 21  | Next Page >

  • How to catch exception in the main thread if the exception occurs in the secondary thread?

    - by Ashish Ashu
    How to catch exception in the main thread if the exception occurs in the secondary thread? The code snippet for the scenario is given below: private void button1_Click(object sender, EventArgs e) { try { Thread th1 = new Thread(new ThreadStart(Test)); th1.Start(); } catch (Exception) { } } void Test() { for (int i = 0; i < 100; i++) { Thread.Sleep(100); if (i == 2) throw new MyException(); } } }

    Read the article

  • vsts load testing wcf app

    - by ashish.s
    I have a simple test written like this public class Test { [ThreadStatic] private static ServiceClient client; [TestMethod] public void TestCase1() { If( client == null) { .... //instantiate client } client.CallMyServiceMethod() } [TestMethod] public void TestCase2() { using(var newClient = new ServiceClient()) { newClient.CallMyServiceMethod() } } The percentage of new users is set to 100 % for the test, and the user load is constant load of 1. But the response time for TestCase1 is about 3 times better than TestCase2. Can someone see what i am missing here ? many thanks

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • why does this code crash?

    - by ashish yadav
    why does this code crash? is using strcat illegal on character pointers? #include <stdio.h> #include <string.h> int main() { char *s1 = "Hello, "; char *s2 = "world!"; char *s3 = strcat(s1, s2); printf("%s",s3); return 0; } please give a proper way with referring to both array and pointers.

    Read the article

  • best algorithm for swapping?

    - by ashish yadav
    i have heard from a friend of mine that the best algorithm for swapping is " (a^=b^=a^=b)" where a and b are two integers to be swapped. but when i applied this using c language it resulted in crashing. can anyone of you fine people explain the possible reason for that? please suggest the best algorithm for swapping. thank you!!!!

    Read the article

  • change font in sharedbook api in php

    - by ashish
    I m using Sharedbook api to generate a memory book, although it's working perfect, but font of the memory book is unchangeable ...means i can't change the font family of that book. I tried to change the font then it display error. please suggest me how to change Font of that memory book.. Thank is advance

    Read the article

  • How to change the direction of wpf marquee dynamically?

    - by ashish semwal
    Hi all, I want to change the direction of my marquee on changeDirection button click. My code for changing direction is : private void changeDirection_click(object sender, RoutedEventArgs e) { if (_marqueeType == MarqueeType.RightToLeft) { _marqueeType = MarqueeType.LeftToRight; StartMarqueeing(_marqueeType); } else if (_marqueeType == MarqueeType.LeftToRight) { _marqueeType = MarqueeType.RightToLeft; StartMarqueeing(_marqueeType); } } And code for start marquee is : public void StartMarqueeing(MarqueeType marqueeType) { double height = canMain.ActualHeight - marqueeList.ActualHeight; marqueeList.Margin = new Thickness(0, 0, 0, 0); doubleAnimation.From = -marqueeList.ActualWidth; doubleAnimation.To = canMain.ActualWidth; doubleAnimation.RepeatBehavior = RepeatBehavior.Forever; doubleAnimation.Duration = new Duration(TimeSpan.FromSeconds(_marqueeTimeInSeconds)); if (marqueeType == MarqueeType.RightToLeft) { Storyboard.SetTargetProperty(doubleAnimation, new PropertyPath("(Canvas.Right)")); _storyBoard.Children.Add(doubleAnimation); _storyBoard.Begin(marqueeList, true); } else if (marqueeType == MarqueeType.LeftToRight) { Storyboard.SetTargetProperty(doubleAnimation, new PropertyPath("(Canvas.Left)")); _storyBoard.Children.Add(doubleAnimation); _storyBoard.Begin(marqueeList, true); } } Now here I am able to change the direction from Right to Left only first time. But when I am change it from Left to Right it’s not changing the marquee position Left to Right. Please help me on this...........its urgent!!!!!!!!!!!

    Read the article

  • accessing base class's method with derived class's object which has a method of same name.

    - by ashish yadav
    when accessing foo() of "base" using derived class's object. include class base { public: void foo() { std::cout<<"\nHello from foo\n"; } }; class derived : public base { public: void foo(int k) { std::cout<<"\nHello from foo with value = "< } how to access base class method having a method of same name in derived class. the error generated has been shown. i apologize if i am not clear but i feel i have made myself clear as water. thanks in advance.

    Read the article

  • Can jpg images support animation?

    - by Ashish
    Well guys. we are not supposed to ask theoratical questions here .. but dint know any other forum where someone would answer this :) jpeg image How is the above jpg image can be animated? As far as I know jpg format does not support animation.

    Read the article

  • protobuf-net NOT faster than binary serialization?

    - by Ashish Gupta
    I wrote a program to serialize a 'Person' class using XMLSerializer, BinaryFormatter and ProtoBuf. I thought protobuf-net should be faster than the other two. Protobuf serialization was faster than XMLSerialization but much slower than the binary serialization. Is my understanding incorrect? Please make me understand this. Thank you for the help. Following is the output:- Person got created using protocol buffer in 347 milliseconds Person got created using XML in 1462 milliseconds Person got created using binary in 2 milliseconds Code below using System; using System.Collections.Generic; using System.Linq; using System.Text; using ProtoBuf; using System.IO; using System.Diagnostics; using System.Runtime.Serialization.Formatters.Binary; namespace ProtocolBuffers { class Program { static void Main(string[] args) { string XMLSerializedFileName = "PersonXMLSerialized.xml"; string ProtocolBufferFileName = "PersonProtocalBuffer.bin"; string BinarySerializedFileName = "PersonBinary.bin"; var person = new Person { Id = 12345, Name = "Fred", Address = new Address { Line1 = "Flat 1", Line2 = "The Meadows" } }; Stopwatch watch = Stopwatch.StartNew(); watch.Start(); using (var file = File.Create(ProtocolBufferFileName)) { Serializer.Serialize(file, person); } watch.Stop(); Console.WriteLine(watch.ElapsedMilliseconds.ToString()); Console.WriteLine("Person got created using protocol buffer in " + watch.ElapsedMilliseconds.ToString() + " milliseconds " ); watch.Reset(); watch.Start(); System.Xml.Serialization.XmlSerializer x = new System.Xml.Serialization.XmlSerializer(person.GetType()); using (TextWriter w = new StreamWriter(XMLSerializedFileName)) { x.Serialize(w, person); } watch.Stop(); Console.WriteLine(watch.ElapsedMilliseconds.ToString()); Console.WriteLine("Person got created using XML in " + watch.ElapsedMilliseconds.ToString() + " milliseconds"); watch.Reset(); watch.Start(); using (Stream stream = File.Open(BinarySerializedFileName, FileMode.Create)) { BinaryFormatter bformatter = new BinaryFormatter(); //Console.WriteLine("Writing Employee Information"); bformatter.Serialize(stream, person); } watch.Stop(); Console.WriteLine(watch.ElapsedMilliseconds.ToString()); Console.WriteLine("Person got created using binary in " + watch.ElapsedMilliseconds.ToString() + " milliseconds"); Console.ReadLine(); } } [ProtoContract] [Serializable] public class Person { [ProtoMember(1)] public int Id {get;set;} [ProtoMember(2)] public string Name { get; set; } [ProtoMember(3)] public Address Address {get;set;} } [ProtoContract] [Serializable] public class Address { [ProtoMember(1)] public string Line1 {get;set;} [ProtoMember(2)] public string Line2 {get;set;} } }

    Read the article

  • Problem in databinding a dictionary in ListView combo-box column.

    - by Ashish Ashu
    I have a listview of which itemsource is set to my custom collection, let's say MyCollection. The code below is not full code , it's just a code snippets to explain the problem. class Item : INotifyPropertyChanged { Options _options; public Options OptionProp { get { return _options; } set { _options = value; OnPropertyChanged ("OptionProp");} } string _Name; public string NameProp { get { return _Name; } set { _Name = value; OnPropertyChanged ("NameProp");} } } class Options : Dictionary<string,string> { public Options() { this.Clear(); this.Add("One" , "1" ); this.Add("Two" , "2" ); this.Add("Three" , "3" ); } } MyCollection in my viewModel class viewModel { ObservableCollection<Item> **MyCollection**; KeyValuePair<sting,string> **SelectedOption**; } The listview Item Source is set to my MyCollection. <ListView ItemSource = MyCollectoin> I Listview contains two columns of which I have defined a datatemplats in the listview. First column is a combo-box of which Itemsource is set to Options ( defined above ) Second column is a simple textblock to display Name. Problem 1. I have defined a datatemplate for first column in which I have a combo box , I have set the Itemsource =**MyCollection** and SelectedItem = SelectedOption of the combo-box. User can perform following operations in the listview: Add ( Add the row in the listview ) Move Up ( Move row up in the listview ) Move Down ( Move down the item in the listview ) .Now when I add the row in the listview , the combo-box selected index is always comes to -1 (first column). However the combo box contains options One, Two and Three. Also, I have initialized the SelectedOption to contain the first item, i:e One. problem 2. . Let suppose, I have added a single row in a listview and I have selected Option "one" in the combo box manually. Now when I perform Move Up or Move Down operations the selected index of a combo box is again set to -1. In the Move Up or Move Down operation , I am calling MoveUp and MoveDown methods of the Observable collection. Probelm 3 How to serialize the entire collection in XML. Since I can't serialize the Dictionary and KeyValue Pair. I have to restore the state of the listview.

    Read the article

  • How to track which character is deleted in TextBox in WPF?

    - by Ashish Ashu
    I want to track which character is deleted by the user through Delete or BackSpace Key. I am handling RichTextBox_ChangedEvent of textbox. Can I extract the deleted character from TextChangedEventArgs *e.Changes* and if yes How can I do that? I want to restrict user to from deleting any characters from the TextBox. I want user can delete only two characters ( let's say "(" or ")" ) Please suggest.

    Read the article

  • How to take input for a character pointer without using fget?

    - by ashish yadav
    consider the code #include<stdio.h> int main() { char* a; scanf("%s",a);//&a and &a[0] give same results-crashes printf("%s",); return 0; } why does this code results in crashing?whereas this code using character array works fine? #include<stdio.h> int main() { char a[100]; scanf("%s",&a[0]);//works fine printf("%s",a); return 0; } the difference being character array and pointer?but i knew that pointer just points to the first element that is &a[0] should work fine but upper code crashes for all three that is a,&a and &a[0]? the main thing i would to gather is how can i take input of a character pointer if i insist on using scanf only? i apologize if i am not clear. thanks in advance:)

    Read the article

  • castle dynamic proxy creation

    - by ashish.s
    I am implementing a design where my layer would sit between client and server, and whatever objects i get from server, i would wrap it in a transparent proxy and give to the client, that way i can keep a track of what changed in the object, so when saving it back, i would only send changed information. I looked at castle dynamic proxy, linfu, although they can generate a proxy type, but they cant take existing objects and wrap them instead. Wondering if its possible to do with these frameworks, or if there any other frameworks that enable this...

    Read the article

  • zeromq installtion on mac os snow leopard

    - by Ashish
    I have installed zeromq 2.1.11 on mac os x using the steps given on http://www.zeromq.org/area:download Then i installed pyzmq (python bindings ) But i get the following error : import zmq Traceback (most recent call last): File "<pyshell#1>", line 1, in <module> import zmq File "/Library/Frameworks/Python.framework/Versions/2.7/lib/python2.7/site-packages/zmq/__init__.py", line 35, in <module> from zmq.utils import initthreads # initialize threads ImportError: dlopen(/Library/Frameworks/Python.framework/Versions/2.7/lib/python2.7/site-packages/zmq/utils/initthreads.so, 2): no suitable image found. Did find: /Library/Frameworks/Python.framework/Versions/2.7/lib/python2.7/site-packages/zmq/utils/initthreads.so: no matching architecture in universal wrapper

    Read the article

  • Single log file for multiple webapps

    - by Ashish Aggarwal
    In my tomcat there are multiple webapps deployed and they communicate with each other. Currently they all have their own log file. But when there is some issue comes from call I have to 1st check with the app to whom I made a call and check log file of respective apps involved in the call. So I want that, as all apps is deployed in same tomcat and sharing a common log4j, if a call made to any app then all logs should be in a single log file and no matters how my webapps are involved all error comes from any webapp during the call should be in a single log file. I have no idea how can I achieve this. So any help is appreciable. Edited: I think my question is not cleared so updated with use case: I have three webapps A, B, C having logs files as A.log, B.log and C.log. I made two calls. 1st one to A (that internally calls C) and 2nd to B (that internally calls C). Now logging of first call must be in A.log (with the logs of every step performed inside the webapp c) and second call must be in B.log (with the logs of every step performed inside the webapp c).

    Read the article

< Previous Page | 10 11 12 13 14 15 16 17 18 19 20 21  | Next Page >