Search Results

Search found 1184 results on 48 pages for 'rajesh kumar chandra'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 14/48 | < Previous Page | 10 11 12 13 14 15 16 17 18 19 20 21  | Next Page >

  • how to consume .net webservices

    - by Rajesh Rolen- DotNet Developer
    please tell that can we consume .net web services in php or not. if yes then please tell me how can we do it. i am to create a web service which takes values and save it in database also it will take values and reply some data as a standard xml format. i know how to create web service and how to use it in asp.net but don't know how to use/call it from php. thing is that i will not be writing code in php to consume but wants to know that do i need to take care of any special thing or need to do some extra code to make it available and use by php developers. i am to create web service in .net framework 2.0 Thanks

    Read the article

  • How to load the model ????

    - by rajesh
    How can i load model i have tried several times but do not get the ans my code is <?php class NotesController extends AppController { var $name='Notes'; var $helpers = array('Html','Form','Ajax','Javascript'); var $uses = array('note'); var $components = array('ModelLoader'); function index(){ $this->ModelLoader->setController($this); $result = $this->params['url']['obj']; //print_r($result); $ee=$this->ModelLoader->load('note'); $pass = $this->note->search($result);

    Read the article

  • How to access Outlook's Scheduler in asp.net

    - by Rajesh Rolen- DotNet Developer
    Please tell me how can i use/integrate/get Outlook's Scheduler in my asp.net application. i mean a person can use Outlook's scheduler to create his schedule..and i can show it in my asp.net application. or if any sample scheduler code/control is available than also give me link of it.. plez help me out.. thanks. i have just read about "Google Data API" and "Calendar Data API" plez tell me about it.. is it can provide me facilities of good scheduler?

    Read the article

  • Please help me to create a insert query (error of foreign key constrant)

    - by Rajesh Rolen- DotNet Developer
    I want to move data from one database's table to another database's table its giving me foreign key error. please tell me how can i insert all those data which is valid except those rows who have error of foreign key. i am using sql server 2005 My query is : SET IDENTITY_INSERT City ON INSERT INTO City ([cityid],[city],[country],[state],[cityinfo] ,[enabled],[countryid],[citycode],[stateid],[latitude],[longitude]) SELECT [cityid],[city],[country],[state],[cityinfo] ,[enabled],[countryid],[citycode],[stateid],[latitude],[longitude] FROM TD.DBo.City getting this error: The INSERT statement conflicted with the FOREIGN KEY constraint "FK__city__countryid__3E52440B". The conflict occurred in database "schoolHigher", table "dbo.country", column 'countryId'. please tell how can i move those data whose foreign key is valid.

    Read the article

  • Please tell me what is error in my date comparison sql query

    - by Rajesh Rolen- DotNet Developer
    Please help me to find out error in my SQL query. I have created this query to compare dates select * from Joinplans jp where cast(convert(varchar,GETDATE(),103) AS datetime) BETWEEN CASE(convert(varchar,jp.planstartDate,103) AS datetime) AND CASE(convert(varchar,DATEADD(DAY,jp.planDays,jp.planstartDate),103) AS DATETIME) It's giving me the error: incorrect near 'AS' I am using SQL Server 2005.

    Read the article

  • Please tell me what is error in my date comparision sql query

    - by Rajesh Rolen- DotNet Developer
    please help me to find out error in my sql query. i have created this query to compare dates select * from Joinplans jp where cast(convert(varchar ,GETDATE(),103) AS datetime) BETWEEN CASE(convert(varchar,jp.planstartDate,103) AS datetime) AND CASE(convert(varchar,DATEADD(DAY,jp.planDays,jp.planstartDate),103) AS DATETIME) It's giving me the error: incorrect near 'AS' I am using SQL Server 2005.

    Read the article

  • Show image from clipboard to defalut imageviewer of windows using c#.net

    - by Rajesh Rolen- DotNet Developer
    I am using below function to make a image of current form and set it in clipboard Image bit = new Bitmap(this.Width, this.Height); Graphics gs = Graphics.FromImage(bit); gs.CopyFromScreen(this.Location, new Point(0, 0), bit.Size); Guid guid = System.Guid.NewGuid(); string FileName = guid.ToString(); //Copy that image in the clipbaord. Image imgToCopy = Image.FromFile(Path.Combine(Environment.CurrentDirectory, FileName + ".jpg")); Clipboard.SetImage(imgToCopy); Now my image is in clipboard and i am able to show it in picturebox on other form using below code : mypicturebox.Image = Clipboard.GetImage(); Now the the problem is that i want to show it in default imageviewer of that system. so for that i think using "System.Diagnostics.Process.Start" we can do that.. but i dont know, how to find default imageviewer and how to set clipboard's image in that ... please help me out... if i find solution than thats good otherwise i am thinking to save that file from clipboard to harddisk and then view it in window's default imageviewer... please help me to resolve my problem.. i am using c#.net

    Read the article

  • Java EE deployment error

    - by Rajesh
    While deploying a particular project I'm getting deployment error like "module has not been deployed"... but I'm able to deploy other projects... the error shown is as follows In-place deployment at F:\onlineexam_1\build\web deploy?path=F:\onlineexam_1\build\web&name=onlineexam_1&force=true failed on GlassFish v3 Domain F:\onlineexam_1\nbproject\build-impl.xml:577: The module has not been deployed. BUILD FAILED (total time: 3 seconds)

    Read the article

  • scroll bar important query???

    - by rajesh
    Hello all, actually i downloaded code for scroll from....... http://sorgalla.com/jcarousel/ but when i added it in my page and add using code ... function addElement(url,imagePath){ alert(url); alert(imagePath); var container = document.getElementById('sncs'); items = container.getElementsByTagName("li"); //alert(items.length); var new_element = document.createElement('li'); new_element.innerHTML =""; //var raj='1'+new_element.innerHTML; //alert() new_element.className="jcarousel-item jcarousel-item-horizontal jcarousel-item-4 jcarousel-item-4-horizontal"; //container.insertBefore(new_element, container.firstChild); container.appendChild( new_element ); } it added li not at the end but below scroll what will be the problem..... Please help me to sort out this problem....

    Read the article

  • How to write CData in xml

    - by Rajesh Rolen- DotNet Developer
    i have an xml like : <?xml version="1.0" encoding="UTF-8"?> <entry> <entry_id></entry_id> <entry_status></entry_status> </entry> i am writing data in it like: XmlNode xnode = xdoc.SelectSingleNode("entry/entry_status"); xnode.InnerText = "<![CDATA[ " + Convert.ToString(sqlReader["story_status"]) + " ]]>" ; but its change "<" to "&lt" of CDATA. Please tell me how to fill values in above xml as a CData format. i know that we can create CDATA like : XmlNode itemDescription = doc.CreateElement("description"); XmlCDataSection cdata = doc.CreateCDataSection("<P>hello world</P>"); itemDescription.AppendChild(cdata); item.AppendChild(itemDescription); but my process is to read node of xml and change its value not to append in it. Thanks

    Read the article

  • When i am adding eventHandler on combo in datagridview, its adding eventHandler to all other combo o

    - by Rajesh Rolen- DotNet Developer
    i am using VS2005 (c#.net desktop application). when i am adding eventHandler to a combo of datagridview, its automatically adding same eventhandler to all other combos of same datagridview.. my code: private void dgvtstestdetail_EditingControlShowing(object sender, DataGridViewEditingControlShowingEventArgs e) { DataGridView grid = (sender as DataGridView); if (grid.CurrentCell.OwningColumn == grid.Columns["gdvtstd_TestParameter"]) { ComboBox cb = (e.Control as ComboBox); cb.SelectedIndexChanged -= new EventHandler(dvgCombo_SelectedIndexChanged); cb.SelectedIndexChanged += new EventHandler(dvgCombo_SelectedIndexChanged); } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • how to Send Parameter????

    - by rajesh
    Hi. I have problem that how can i can send image path to the function........ myn code is........ <a href="#" onclick="addElement(this.id);" id="cricket" tabindex="1">Cricket</a> i want to send my image path in the function addElement along with id..... Please somebody help.....

    Read the article

  • how to Send Parameter????

    - by rajesh
    Hi. I have problem that how can i can send image path to the function........ myn code is........ Cricket i want to send my image path in the function addElement along with id..... Please somebody help.....

    Read the article

  • Please Help me to create a replace function in vb.net

    - by Rajesh Rolen- DotNet Developer
    Please Help me in creating a replace function. Problem: Their is a alfanumeric value of any lenght (string) and i want to replace its all characters with 'X' except right four characters Like : Value : 4111111111111111 Result Should be: XXXXXXXXXXXX1111 I have created a function but got stuck: public function myfunction(str as string) str.Replace(str.Substring(0, str.Length - 5), 'X') 'but here i want no of x to be equvals to count of lenght of str - 4 end function please tell me a better fuction to perform such a operation

    Read the article

  • How to create own dotnet obfuscator

    - by Rajesh Rolen- DotNet Developer
    I know that dot net dlls and exe contain their assemblies with them so every body can extract code from it. so to tell me how can i create my own dotnet obfuscator and tell me if their exist any other way to protect my application to deassemble. and plez dont give me link of any paid obfuscator. i would prefer code sample in c# or vb.net

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 10 11 12 13 14 15 16 17 18 19 20 21  | Next Page >