Search Results

Search found 4848 results on 194 pages for 'expression blend'.

Page 140/194 | < Previous Page | 136 137 138 139 140 141 142 143 144 145 146 147  | Next Page >

• a question on webpage data scraping using Java

  - by Gemma

  Hi there. I am now trying to implement a simple HTML webpage scraper using Java.Now I have a small problem. Suppose I have the following HTML fragment. <div id="sr-h-left" class="sr-comp"> <a class="link-gray-underline" id="compare_header" rel="nofollow" href="javascript:i18nCompareProd('/serv/main/buyer/ProductCompare.jsp?nxtg=41980a1c051f-0942A6ADCF43B802'); " Compare Showing 1 - 30 of 1,439 matches, The data I am interested is the integer 1.439 shown at the bottom.I am just wondering how can I get that integer out of the HTML. I am now considering using a regular expression,and then use the java.util.Pattern to help get the data out,but still not very clear about the process. I would be grateful if you guys could give me some hint or idea on this data scraping. Thanks a lot.

  Read the article

• Redirect www.example.com/apple to food.example.com/fruits/apple

  - by Senthil

  I want to redirect users from www.example.com/apple to http://food.example.com/fruits/apple Note: This is a hardcoded redirection. Even a mapping if you will. "apple" will not be substituted with anything else. Nothing in the two URLs will change except for the domain of course. So there is no need for a regular expression to match the "apple" or anything else. There is already dozens of RewriteCond and RewriteRule things in the .htaccess file. I do not want them to be affected. This redirection is independent of those. I have access to the .htaccess file at the root of www.example.com and the httpd.conf What code should I put in .htaccess in order to achieve this? Or should I change the httpd.conf?

  Read the article

• Can't enumerate LinQ results with left join

  - by nvtthang

  var itemSet = from item in da.GetList<Models.account>() join file in objFileStorageList on item.account_id equals file.parent_id into objFile from fileItem in objFile.DefaultIfEmpty() where item.company != null && item.company.company_id == 123 orderby item.updatedDate descending select new { Id = item.account_id, RefNo = item.refNo, StartDate = item.StartDate , EndDate = item.EndDate , Comment = item.comment, FileStorageID = fileItem != null ? fileItem.fileStorage_id : -1, Identification = fileItem != null ? fileItem.identifier : null, fileName = fileItem != null ? fileItem.file_nm : null }; It raises error message when I try to enumerate through collection result from Linq query above. LINQ to Entities does not recognize the method 'System.Collections.Generic.IEnumerable1[SCEFramework.Models.fileStorage] DefaultIfEmpty[fileStorage](System.Collections.Generic.IEnumerable1[SCEFramework.Models.fileStorage])' method, and this method cannot be translated into a store expression foreach (var item in itemSet) { string itemRef= item.RefNo; } Please suggest me any solutions. Thanks in advance.

  Read the article

• asp.net databinding string is passed to function but runtime occurs

  - by rod

  Hi All, I'm using a code-behind function (called TestFx) in my binding expression. I'm passing a string and the function accepts a string but I still get a runtime error saying invalid args. But if I change the method to accept an object and inspect the value, "it's a string!" Can someone please explain? -rod ProductDescription: <asp:Label ID="ProductDescriptionLabel" runat="server" Text='<%# TestFx(Eval("ProductDescription")) %>' /> <br />

  Read the article

• Error: A SQLParamenter wtih ParameterName @myparm is not contained by this SQLParameter Collection

  - by SidC

  Good Morning, I'm working on an ASP.NET 3.5 webforms application and have written the following code: Protected Sub btnSubmit_Click(ByVal sender As Object, ByVal e As System.EventArgs) Handles btnSubmit.Click Dim connectionString As String = WebConfigurationManager.ConnectionStrings("Diel_inventoryConnectionString").ConnectionString Dim con As New SqlConnection(connectionString) Dim adapter1 As New SqlDataAdapter adapter1.SelectCommand = New SqlCommand adapter1.SelectCommand.CommandType = CommandType.StoredProcedure adapter1.SelectCommand.CommandText = "PartSproc" Dim parmNSN As New SqlParameter("@NSN", SqlDbType.NVarChar) Dim parmName As New SqlParameter("@PartName", SqlDbType.NVarChar) txtNSN.Text = adapter1.SelectCommand.Parameters("@NSN").Value txtSearch.Text = adapter1.SelectCommand.Parameters("@PartName").Value Dim dt As New DataTable() adapter1.Fill(dt) MySearch.DataSource = dt MySearch.DataBind() End Sub When I run the page, I receive the error A SQLParameter with @NSN is not contained by this SQLParameter Collection. I tried using apostrophes around the @NSN and @PartName but that does not work either and presents expression expected error. How might I rectify the above code so that it references the @NSN and @PartName parameters correctly? Thanks, Sid

  Read the article

• the problem about different treatment to __VA_ARGS__ when using VS 2008 and GCC

  - by liuliu

  I am trying to identify a problem because of an unusual usage of variadic macros. Here is the hypothetic macro: #define va(c, d, ...) c(d, __VA_ARGS__) #define var(a, b, ...) va(__VA_ARGS__, a, b) var(2, 3, printf, “%d %d %d\n”, 1); For gcc, the preprocessor will output printf("%d %d %d\n", 1, 2, 3) but for VS 2008, the output is printf, “%d %d %d\n”, 1(2, 3); I suspect the difference is caused by the different treatment to VA_ARGS, for gcc, it will first expand the expression to va(printf, "%d %d %d\n", 1, 2, 3), and treat 1, 2, 3 as the VA_ARGS for macro va. But for VS 2008, it will first treat b as VA_ARGS for macro va, and then do the expansion. Which one is correct interpretation for C99 variadic macro? or my usage falls into an undefined behavior?

  Read the article

• gdb: SIGTRAP on std::string::c_str() call

  - by sheepsimulator

  So I've been trying to use gdb to return the value of a string I have by calling > print <member variable name>.c_str() But everytime I do so, I get this: Program received signal SIGTRAP, Trace/breakpoint trap. <some address> in std::string::c_str() from /usr/lib/libstdc++.so.6 GDB remains in the frame where the signal was received. To change this behavior use "set unwindonsignal on" Evaluation of the expression containing the function (std::string::c_str() const) will be abandoned. Two questions: Why/how is the standard library throwing SIGTRAP? I checked basic_string.h and c_str() is defined as: const _CharT* c_str() const { return _M_data(); } I don't see any SIGTRAP-throwing here... is there a way to get around this SIGTRAP? How can I read the text value of the std::string out (without getting some crazy extension library) in gdb?

  Read the article

• Numbering Regex Submatches

  - by gentlylisped

  Is there a canonical ordering of submatch expressions in a regular expression? For example: What is the order of the submatches in "(([0-9]{3}).([0-9]{3}).([0-9]{3}).([0-9]{3}))\s+([A-Z]+)" ? a. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([A-Z]+) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) b. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([A-Z]+) or c. somthin' else.

  Read the article

• F# - This code isn't compiling for me

  - by stacker

  This code isn't compiling for me: let countDown = [5L .. -1L .. 0L];; I have a book that says it should return this: val countDown : int list = [5L; 4L; 3L; 2L; 1L; 0L] Compiler Error: Program.fs(42,24): error FS0010: Unexpected character '-' in expression > > let countDown = [5L .. -1L .. 0L];; let countDown = [5L .. -1L .. 0L];; -----------------------^

  Read the article

• State Animation on ListBox ItemTemplate

  - by Peanut

  I have a listbox which reads from Observable collection, and is ItemTemplate'ed: <DataTemplate x:Key="DataTemplate1"> <Grid x:Name="grid" Height="47.333" Width="577" Opacity="0.495"> <Image HorizontalAlignment="Left" Margin="10.668,8,0,8" Width="34" Source="{Binding ImageLocation}"/> <TextBlock Margin="56,8,172.334,8" TextWrapping="Wrap" Text="{Binding ApplicationName}" FontSize="21.333"/> <Grid x:Name="grid1" HorizontalAlignment="Right" Margin="0,10.003,-0.009,11.33" Width="26" Opacity="0" RenderTransformOrigin="0.5,0.5"> <Image HorizontalAlignment="Stretch" Margin="0" Source="image/downloads.png" Stretch="Fill" MouseDown="Image_MouseDown" /> </Grid> </Grid> </DataTemplate> <ListBox x:Name="searchlist" Margin="8" ItemTemplate="{DynamicResource DataTemplate1}" ItemsSource="{Binding SearchResults}" SelectionChanged="searchlist_SelectionChanged" ItemContainerStyle="{DynamicResource ListBoxItemStyle1}" /> In general, my question is "What is the easiest way to do Animation on Particular Items in this listbox As they are selected? Basically the image inside the "grid1" will be setting its opacity to 1, slowly. I would prefer to use states, but I do not know of any way to just tell blend and xaml to "When a selected item is changed, change the image opacity to 1 over a period of .3 seconds". Infact, I have been doing this in the .cs file using the VisualStateManager. Also, there is another issue. When the selected index is changed, we goto the CS file and look at SelectedItem. SelectedItem returns an instance of the Object in which it was bound to (The object inside the observable collection), and NOT an instance of the DataTemplate/ListItem etc. So how am I able to pull the correct image out of this list? State animation with VisualStateManager I can handle fine if its just normal things, but when it comes to generated listboxes' items, I'm lost. Thanks

  Read the article

• Javascript substrings multiline replace by RegExp

  - by Radek Šimko

  Hi, I'm having some troubles with matching a regular expression in multi-line string. <script> var str="Welcome to Google!\n"; str = str + "We are proud to announce that Microsoft has \n"; str = str + "one of the worst Web Developers sites in the world."; document.write(str.replace(/.*(microsoft).*/gmi, "$1")); </script> http://jsbin.com/osoli3/3/edit As you may see on the link above, the output of the code looks like this: Welcome to Google! Microsoft one of the worst Web Developers sites in the world. Which means, that the replace() method goes line by line and if there's no match in that line, it returns just the whole line... Even if it has the "m" (multiline) modifier...

  Read the article

• Catch $.getJSON error

  - by Switz

  I've been trying to figure this out for hours. I have a DYNAMIC youtube search, which I use Youtube's JSON api for. It works usually, but there are times that it won't find anything. Is there a way to figure out if it finds nothing, and then end the function because otherwise it stops the entire code. I tried jsonp, but that didn't seem to be correct. Somewhere I read that error catching is built into the newest jQuery getJSON, but I couldn't find it. The code is really tedious so I'd rather not post it unless it comes to that. I'd appreciate any help! Thanks guys. error showing that json didn't return anything jquery-1.4.4.min.js:32 TypeError: Result of expression 'j' [undefined] is not an object.

  Read the article

• Is it possible to use DLR in a .NET 3.5 website project?

  - by Aplato

  I'm trying to evaluate an expression stored in a database i.e. "if (Q1 ==2) {result = 3.1;} elseif (Q1 ==3){result=4.1;} else result = 5.9;" Rather than parsing it myself I'm trying to use the DLR. I'm using version .92 from the Codeplex repository and my solution is a .NET 3.5 website; and I'm having conflicts between the System.Core and Microsoft.Scripting.ExtenstionAttribute .dll's. Error = { Description: "'ExtensionAttribute' is ambiguous in the namespace 'System.Runtime.CompilerServices'.", File: "InternalXmlHelper.vb" } At this time I cannot upgrade to .NET 4.0 and make significant use of the .net 3.5 features (so downgrading is not an option). Any help greatly appreciated.

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Weird splitter behaviour when moving it

  - by tomo

  My demo app displays two rectangles which should fill whole browser's screen. There is a vertical splitter between them. This looks like a basic scenario but I have no idea how to implement this in xaml. I cannot force this to fill whole screen and when moving splitter then whole screen grows. Can anybody help? <UserControl xmlns:controls="clr-namespace:System.Windows.Controls;assembly=System.Windows.Controls" x:Class="SilverlightApplication1.MainPage" xmlns="http://schemas.microsoft.com/winfx/2006/xaml/presentation" xmlns:x="http://schemas.microsoft.com/winfx/2006/xaml" xmlns:d="http://schemas.microsoft.com/expression/blend/2008" xmlns:mc="http://schemas.openxmlformats.org/markup-compatibility/2006" mc:Ignorable="d" d:DesignWidth="640" d:DesignHeight="480"> <Grid x:Name="LayoutRoot" VerticalAlignment="Stretch" HorizontalAlignment="Stretch"> <Grid.ColumnDefinitions> <ColumnDefinition Width="Auto"/> <ColumnDefinition Width="Auto"/> <ColumnDefinition Width="Auto"/> </Grid.ColumnDefinitions> <Border BorderBrush="Black" BorderThickness="1" VerticalAlignment="Stretch" HorizontalAlignment="Stretch" MinWidth="50"> </Border> <controls:GridSplitter Grid.Column="1" VerticalAlignment="Stretch" Width="Auto" ></controls:GridSplitter> <Border BorderBrush="Blue" BorderThickness="1" VerticalAlignment="Stretch" HorizontalAlignment="Stretch" Grid.Column="2" MinWidth="50"></Border> </Grid> </UserControl>

  Read the article

• Tentative date casting in tsql

  - by Tewr

  I am looking for something like TRYCAST in TSQL or an equivalent method / hack. In my case I am extracting some date data from an xml column. The following query throws "Arithmetic overflow error converting expression to data type datetime." if the piece of data found in the xml cannot be converted to datetime (in this specific case, the date is "0001-01-01" in some cases). Is there a way to detect this exception before it occurs? select [CustomerInfo].value('(//*:InceptionDate/text())[1]', 'datetime') FROM Customers An example of what I am trying to achieve in pseudocode with an imagined tsql function TRYCAST(expr, totype, defaultvalue): select TRYCAST( [CustomerInfo].value('(//*:InceptionDate/text())[1]', 'nvarchar(100)'), datetime, null) FROM Customers

  Read the article

• Delphi component or library to display mathematical expressions

  - by Svein Bringsli

  I'm looking for a simple component that displays mathematical expressions in Delphi. When I started out I thought it would be easy to find something on the net, but it turns out it was harder than anticipated. There are lots and lots of components that will parse mathematical expressions, but few (none?) that will display them. Ideally I would like a component as simple as a TLabel, where I could set the caption to some expression and it would be displayed correctly, but some sort of library that let's me draw expressions to a canvas would also be sufficient for my needs. Update: I'm not talking about plotting graphs of functions or something like that. I want to display (for instance) (X^2+3)/X like this:

  Read the article

• Capturing the contents of <select>

  - by joey mueller

  I'm trying to use a regular expression to capture the contents of all option values inside an HTML select element For example, in: <select name="test"> <option value="blah">one</option> <option value="mehh">two</option> <option value="rawr">three</option> </select> I'd like to capture one two and three into an array. My current code is var pages = responseDetails.responseText.match(/<select name="page" .+?>(?:\s*<option .+?>([^<]+)<\/option>)+\s*<\/select>/); for (var c = 0; c<pages.length; c++) { alert(pages[c]); } But it only captures the last value, in this case, "three". How can I modify this to capture all of them? Thanks!

  Read the article

• Cache Wrapper with expressions

  - by Fujiy

  I dont know if is possible. I want a class to encapsulate all Cache of my site. I thinking about the best way to do this to avoid conflict with keys. My first idea is something like this: public static TResult Cachear<TResult>(this Cache cache, Expression<Func<TResult>> funcao) { string chave = funcao.ToString(); if (!(cache[chave] is TResult)) { cache[chave] = funcao.Compile()(); } return (TResult)cache[chave]; } Is the best way? Ty

  Read the article

• Criteria hibernate

  - by apb

  my code session.createCriteria(Input.class); DateFormat format = new SimpleDateFormat("yyyy-MM-dd hh:mm:ss"); Date startDate = (Date)format.parse("2005-01-01 00:00:00"); Date endDate = (Date)format.parse("2005-03-03 00:00:00"); crit.add(Expression.between ("inputDate", new Date(startDate.getTime()), new Date(endDate.getTime()))); This code return a list, but there is no element present in it. i think it doesn't match the condition. Anybody help.

  Read the article

• JavaScript lazy regex for matching HTML tags

  - by Grnbeagle

  Hi, I'm having a problem writing a regular expression for matching HTML tags. I found a similar entry here, but this didn't quite work in my case. Here's my test string: <div id="div0" class="myclass">here's some text that may include whitespace</div><div id="div1" class="myclass"> and some more here </div> And here's my regex based on the aforementioned entry: <div[^>]*class="myclass">[^~]*?<\/div> Note that I need to match the first instance of <div /> with class of "myclass." The content may have carriage returns. These <div> tags won't be nested. Here's a rubular page for testing: http://rubular.com/r/vlfcikKMXk

  Read the article

• Why won't this SQL CAST work?

  - by Kev

  I have a nvarchar(50) column in a SQL Server 2000 table defined as follows: TaskID nvarchar(50) NULL I need to fill this column with some random SQL Unique Identifiers (I am unable to change the column type to uniqueidentifier). I tried this: UPDATE TaskData SET TaskID = CAST(NEWID() AS nvarchar) but I got the following error: Msg 8115, Level 16, State 2, Line 1 Arithmetic overflow error converting expression to data type nvarchar. I also tried: UPDATE TaskData SET TaskID = CAST(NEWID() AS nvarchar(50)) but then got this error: Msg 8152, Level 16, State 6, Line 1 String or binary data would be truncated. I don't understand why this doesn't work but this does: DECLARE @TaskID nvarchar(50) SET @TaskID = CAST(NEW() AS nvarchar(50)) I also tried CONVERT(nvarchar, NEWID()) and CONVERT(nvarchar(50), NEWID()) but got the same errors.

  Read the article

• How can I change the VisualState in a View from the ViewModel?

  - by Decker

  I'm new to WPF and MVVM. I think this is a simple question. My ViewModel is performing an asynch call to obtain data for a DataGrid which is bound to an ObservableCollection in the ViewModel. When the data is loaded, I set the proper ViewModel property and the DataGrid displays the data with no problem. However, I want to introduce a visual cue for the user that the data is loading. So, using Blend, I added this to my markup: <VisualStateManager.VisualStateGroups> <VisualStateGroup x:Name="LoadingStateGroup"> <VisualState x:Name="HistoryLoading"> <Storyboard> <ObjectAnimationUsingKeyFrames Storyboard.TargetProperty="(UIElement.Visibility)" Storyboard.TargetName="HistoryGrid"> <DiscreteObjectKeyFrame KeyTime="0" Value="{x:Static Visibility.Hidden}"/> </ObjectAnimationUsingKeyFrames> </Storyboard> </VisualState> <VisualState x:Name="HistoryLoaded"> <Storyboard> <ObjectAnimationUsingKeyFrames Storyboard.TargetProperty="(UIElement.Visibility)" Storyboard.TargetName="WorkingStackPanel"> <DiscreteObjectKeyFrame KeyTime="0" Value="{x:Static Visibility.Hidden}"/> </ObjectAnimationUsingKeyFrames> </Storyboard> </VisualState> </VisualStateGroup> </VisualStateManager.VisualStateGroups> I think I know how to change the state in my code-behind (something similar to this): VisualStateManager.GoToElementState(LayoutRoot, "HistoryLoaded", true); However, the place where I want to do this is in the I/O completion method of my ViewModel which does not have a reference to it's corresponding View. How would I accomplish this using the MVVM pattern?

  Read the article

• Assigning an @Annotation enum a value

  - by h2g2java

  I created enum Restrictions{ none, enumeration, fractionDigits, length, maxExclusive, maxInclusive, maxLength, minExclusive, minInclusive, minLength, pattern, totalDigits, whiteSpace; public Restrictions setValue(int value){ this.value = value; return this; } public int value; } So that I could happily do something like this, which is perfectly legal syntax. Restrictions r1 = Restrictions.maxLength.setValue(64); The reason being is, I am using enum to restrict the type of restriction that could be used, and be able to assign a value to that restriction. However, my actual motivation is to use that restriction in an @annotation. @Retention(RetentionPolicy.RUNTIME) @Target({ElementType.TYPE, ElementType.FIELD, ElementType.METHOD}) public @interface Presentable { Restrictions[] restrictions() default Restrictions.none; } So that, I intended to do this: @Presentable(restrictions=Restrictions.maxLength.setValue(64)) public String userName; to which, the compiler croaks The value for annotation enum attribute must be an enum constant expression. Is there a way to accomplish what I wish to accomplish

  Read the article

• LINQ query needs either ascending or descending in the same query

  - by Sir Psycho

  Is there anyway this code can be refactored? The only difference is the order by part. Idealy I'd like to use a delegate/lamda expression so the code is reusable but I don't know how to conditionally add and remove the query operators OrderBy and OrderByDescending var linq = new NorthwindDataContext(); var query1 = linq.Customers .Where(c => c.ContactName.StartsWith("a")) .SelectMany(cus=>cus.Orders) .OrderBy(ord => ord.OrderDate) .Select(ord => ord.CustomerID); var query2 = linq.Customers .Where(c => c.ContactName.StartsWith("a")) .SelectMany(cus => cus.Orders) .OrderByDescending(ord => ord.OrderDate) .Select(ord => ord.CustomerID);

  Read the article

< Previous Page | 136 137 138 139 140 141 142 143 144 145 146 147  | Next Page >