Search Results

Search found 3773 results on 151 pages for 'args'.

Page 145/151 | < Previous Page | 141 142 143 144 145 146 147 148 149 150 151  | Next Page >

  • java: how to get a string representation of a compressed byte array ?

    - by Guillaume
    I want to put some compressed data into a remote repository. To put data on this repository I can only use a method that take the name of the resource and its content as a String. (like data.txt + "hello world"). The repository is moking a filesystem but is not, so I can not use File directly. I want to be able to do the following: client send to server a file 'data.txt' server compress 'data.txt' into a compressed file 'data.zip' server send a string representation of data.zip to the repository repository store data.zip client download from repository data.zip and his able to open it with its favorite zip tool The problem arise at step 3 when I try to get a string representation of my compressed file. Here is a sample class, using the zip*stream and that emulate the repository showcasing my problem. The created zip file is working, but after its 'serialization' it's get corrupted. (the sample class use jakarta commons.io ) Many thanks for your help. package zip; import java.io.File; import java.io.FileInputStream; import java.io.FileOutputStream; import java.io.IOException; import java.io.InputStream; import java.util.zip.ZipEntry; import java.util.zip.ZipInputStream; import java.util.zip.ZipOutputStream; import org.apache.commons.io.FileUtils; /** * Date: May 19, 2010 - 6:13:07 PM * * @author Guillaume AME. */ public class ZipMe { public static void addOrUpdate(File zipFile, File ... files) throws IOException { File tempFile = File.createTempFile(zipFile.getName(), null); // delete it, otherwise you cannot rename your existing zip to it. tempFile.delete(); boolean renameOk = zipFile.renameTo(tempFile); if (!renameOk) { throw new RuntimeException("could not rename the file " + zipFile.getAbsolutePath() + " to " + tempFile.getAbsolutePath()); } byte[] buf = new byte[1024]; ZipInputStream zin = new ZipInputStream(new FileInputStream(tempFile)); ZipOutputStream out = new ZipOutputStream(new FileOutputStream(zipFile)); ZipEntry entry = zin.getNextEntry(); while (entry != null) { String name = entry.getName(); boolean notInFiles = true; for (File f : files) { if (f.getName().equals(name)) { notInFiles = false; break; } } if (notInFiles) { // Add ZIP entry to output stream. out.putNextEntry(new ZipEntry(name)); // Transfer bytes from the ZIP file to the output file int len; while ((len = zin.read(buf)) > 0) { out.write(buf, 0, len); } } entry = zin.getNextEntry(); } // Close the streams zin.close(); // Compress the files if (files != null) { for (File file : files) { InputStream in = new FileInputStream(file); // Add ZIP entry to output stream. out.putNextEntry(new ZipEntry(file.getName())); // Transfer bytes from the file to the ZIP file int len; while ((len = in.read(buf)) > 0) { out.write(buf, 0, len); } // Complete the entry out.closeEntry(); in.close(); } // Complete the ZIP file } tempFile.delete(); out.close(); } public static void main(String[] args) throws IOException { final String zipArchivePath = "c:/temp/archive.zip"; final String tempFilePath = "c:/temp/data.txt"; final String resultZipFile = "c:/temp/resultingArchive.zip"; File zipArchive = new File(zipArchivePath); FileUtils.touch(zipArchive); File tempFile = new File(tempFilePath); FileUtils.writeStringToFile(tempFile, "hello world"); addOrUpdate(zipArchive, tempFile); //archive.zip exists and contains a compressed data.txt that can be read using winrar //now simulate writing of the zip into a in memory cache String archiveText = FileUtils.readFileToString(zipArchive); FileUtils.writeStringToFile(new File(resultZipFile), archiveText); //resultingArchive.zip exists, contains a compressed data.txt, but it can not //be read using winrar: CRC failed in data.txt. The file is corrupt } }

    Read the article

  • capturing video from ip camera

    - by Ruby
    I am trying to capture video from ip camera into my application , its giving exception com.sun.image.codec.jpeg.ImageFormatException: Not a JPEG file: starts with 0x0d 0x0a at sun.awt.image.codec.JPEGImageDecoderImpl.readJPEGStream(Native Method) at sun.awt.image.codec.JPEGImageDecoderImpl.decodeAsBufferedImage(Unknown Source) at test.AxisCamera1.readJPG(AxisCamera1.java:130) at test.AxisCamera1.readMJPGStream(AxisCamera1.java:121) at test.AxisCamera1.readStream(AxisCamera1.java:100) at test.AxisCamera1.run(AxisCamera1.java:171) at java.lang.Thread.run(Unknown Source) its giving exception at image = decoder.decodeAsBufferedImage(); Here is the code i am trying private static final long serialVersionUID = 1L; public boolean useMJPGStream = true; public String jpgURL = "http://ip here/video.cgi/jpg/image.cgi?resolution=640×480"; public String mjpgURL = "http://ip here /video.cgi/mjpg/video.cgi?resolution=640×480"; DataInputStream dis; private BufferedImage image = null; public Dimension imageSize = null; public boolean connected = false; private boolean initCompleted = false; HttpURLConnection huc = null; Component parent; /** Creates a new instance of AxisCamera */ public AxisCamera1(Component parent_) { parent = parent_; } public void connect() { try { URL u = new URL(useMJPGStream ? mjpgURL : jpgURL); huc = (HttpURLConnection) u.openConnection(); // System.out.println(huc.getContentType()); InputStream is = huc.getInputStream(); connected = true; BufferedInputStream bis = new BufferedInputStream(is); dis = new DataInputStream(bis); if (!initCompleted) initDisplay(); } catch (IOException e) { // incase no connection exists wait and try // again, instead of printing the error try { huc.disconnect(); Thread.sleep(60); } catch (InterruptedException ie) { huc.disconnect(); connect(); } connect(); } catch (Exception e) { ; } } public void initDisplay() { // setup the display if (useMJPGStream) readMJPGStream(); else { readJPG(); disconnect(); } imageSize = new Dimension(image.getWidth(this), image.getHeight(this)); setPreferredSize(imageSize); parent.setSize(imageSize); parent.validate(); initCompleted = true; } public void disconnect() { try { if (connected) { dis.close(); connected = false; } } catch (Exception e) { ; } } public void paint(Graphics g) { // used to set the image on the panel if (image != null) g.drawImage(image, 0, 0, this); } public void readStream() { // the basic method to continuously read the // stream try { if (useMJPGStream) { while (true) { readMJPGStream(); parent.repaint(); } } else { while (true) { connect(); readJPG(); parent.repaint(); disconnect(); } } } catch (Exception e) { ; } } public void readMJPGStream() { // preprocess the mjpg stream to remove the // mjpg encapsulation readLine(3, dis); // discard the first 3 lines readJPG(); readLine(2, dis); // discard the last two lines } public void readJPG() { // read the embedded jpeg image try { JPEGImageDecoder decoder = JPEGCodec.createJPEGDecoder(dis); image = decoder.decodeAsBufferedImage(); } catch (Exception e) { e.printStackTrace(); disconnect(); } } public void readLine(int n, DataInputStream dis) { // used to strip out the // header lines for (int i = 0; i < n; i++) { readLine(dis); } } public void readLine(DataInputStream dis) { try { boolean end = false; String lineEnd = "\n"; // assumes that the end of the line is marked // with this byte[] lineEndBytes = lineEnd.getBytes(); byte[] byteBuf = new byte[lineEndBytes.length]; while (!end) { dis.read(byteBuf, 0, lineEndBytes.length); String t = new String(byteBuf); System.out.print(t); // uncomment if you want to see what the // lines actually look like if (t.equals(lineEnd)) end = true; } } catch (Exception e) { e.printStackTrace(); } } public void run() { System.out.println("in Run..................."); connect(); readStream(); } @SuppressWarnings("deprecation") public static void main(String[] args) { JFrame jframe = new JFrame(); jframe.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); AxisCamera1 axPanel = new AxisCamera1(jframe); new Thread(axPanel).start(); jframe.getContentPane().add(axPanel); jframe.pack(); jframe.show(); } } Any suggestions what I am doing wrong here??

    Read the article

  • Intellij Idea 13.x and ASM 5.x library incompatible?

    - by Jarrod Roberson
    I can't get Intellij Idea 13.0 to compile my code against ASM 5.0.3 I have a multi-module Maven project. It compiles and installs successfully. Apparently com.google.findbugs:findbugs has a dependency on asm:asm:3.3 and I want to use org.ow2.asm:asm:5.0.3 to manipulate some bytecode. So in the parent pom.xml I exclude the asm:asm:3.3 dependencies from the classpath. This works fine when I run mvn install from the command line. I can't get the Build - Make Project menu selection to work in Intellij Idea. Here is the relevant parts of my pom.xml files. parent.pom <dependency> <groupId>org.ow2.asm</groupId> <artifactId>asm</artifactId> <version>5.0.3</version> </dependency> <dependency> <groupId>org.ow2.asm</groupId> <artifactId>asm-tree</artifactId> <version>5.0.3</version> </dependency> <dependency> <groupId>org.ow2.asm</groupId> <artifactId>asm-util</artifactId> <version>5.0.3</version> </dependency> <dependency> <groupId>org.ow2.asm</groupId> <artifactId>asm-commons</artifactId> <version>5.0.3</version> </dependency> <dependency> <groupId>com.google.code.findbugs</groupId> <artifactId>findbugs</artifactId> <version>2.0.3</version> <exclusions> <exclusion> <groupId>asm</groupId> <artifactId>asm</artifactId> </exclusion> <exclusion> <groupId>asm</groupId> <artifactId>asm-commons</artifactId> </exclusion> <exclusion> <groupId>asm</groupId> <artifactId>asm-tree</artifactId> </exclusion> </exclusions> </dependency> Here is the code that is failing 18 public static void main(final String[] args) throws IOException 19 { 20 final InputStream is = NotEmptyTest.class.getResourceAsStream("/com/vertigrated/annotation/NotEmptyTest.class"); 21 final ClassReader cr = new ClassReader(is); 22 final ClassNode cn = new ClassNode(); 23 cr.accept(cn, 0); 24 for (final MethodNode mn : cn.methods) 25 { 26 - 38 snipped for brevity 39 } 40 } 41 } Here is the error message: Information:Using javac 1.7.0_25 to compile java sources Information:java: Errors occurred while compiling module 'tests' Information:Compilation completed with 1 error and 2 warnings in 2 sec Information:1 error Information:2 warnings /<path to my source code>/NotEmptyTest.java Error:Error:line (24)java: incompatible types required: org.objectweb.asm.tree.MethodNode found: java.lang.Object Warning:Warning:java: /<path to my project>//NotEmptyTest.java uses unchecked or unsafe operations. Warning:Warning:java: Recompile with -Xlint:unchecked for details. As you can see in the screen capture, it reports the correct version of the libraries in the Javadoc but the AutoComplete shows the old 3.3 non-typesafe return value of List instead of List<MethodNode>: Here is what Maven knows, which is correct: [INFO] --- maven-dependency-plugin:2.8:list (default-cli) @ tests --- [INFO] [INFO] The following files have been resolved: [INFO] com.google.code.findbugs:bcel:jar:2.0.1:compile [INFO] junit:junit:jar:4.11:test [INFO] xml-apis:xml-apis:jar:1.0.b2:compile [INFO] com.apple:AppleJavaExtensions:jar:1.4:compile [INFO] javax.inject:javax.inject:jar:1:compile [INFO] jaxen:jaxen:jar:1.1.6:compile [INFO] org.ow2.asm:asm-util:jar:5.0.3:compile [INFO] com.google.inject:guice:jar:3.0:compile [INFO] dom4j:dom4j:jar:1.6.1:compile [INFO] com.google.code.findbugs:jFormatString:jar:2.0.1:compile [INFO] net.jcip:jcip-annotations:jar:1.0:compile [INFO] org.ow2.asm:asm-tree:jar:5.0.3:compile [INFO] commons-lang:commons-lang:jar:2.6:compile [INFO] com.google.code.findbugs:jsr305:jar:2.0.1:compile [INFO] org.hamcrest:hamcrest-core:jar:1.3:test [INFO] aopalliance:aopalliance:jar:1.0:compile [INFO] com.google.code.findbugs:findbugs:jar:2.0.3:compile [INFO] org.ow2.asm:asm-commons:jar:5.0.3:compile [INFO] org.ow2.asm:asm:jar:5.0.3:compile How do I get Intellij Idea to use the correct dependency internally?

    Read the article

  • improving conversions to binary and back in C#

    - by Saad Imran.
    I'm trying to write a general purpose socket server for a game I'm working on. I know I could very well use already built servers like SmartFox and Photon, but I wan't to go through the pain of creating one myself for learning purposes. I've come up with a BSON inspired protocol to convert the the basic data types, their arrays, and a special GSObject to binary and arrange them in a way so that it can be put back together into object form on the client end. At the core, the conversion methods utilize the .Net BitConverter class to convert the basic data types to binary. Anyways, the problem is performance, if I loop 50,000 times and convert my GSObject to binary each time it takes about 5500ms (the resulting byte[] is just 192 bytes per conversion). I think think this would be way too slow for an MMO that sends 5-10 position updates per second with a 1000 concurrent users. Yes, I know it's unlikely that a game will have a 1000 users on at the same time, but like I said earlier this is supposed to be a learning process for me, I want to go out of my way and build something that scales well and can handle at least a few thousand users. So yea, if anyone's aware of other conversion techniques or sees where I'm loosing performance I would appreciate the help. GSBitConverter.cs This is the main conversion class, it adds extension methods to main datatypes to convert to the binary format. It uses the BitConverter class to convert the base types. I've shown only the code to convert integer and integer arrays, but the rest of the method are pretty much replicas of those two, they just overload the type. public static class GSBitConverter { public static byte[] ToGSBinary(this short value) { return BitConverter.GetBytes(value); } public static byte[] ToGSBinary(this IEnumerable<short> value) { List<byte> bytes = new List<byte>(); short length = (short)value.Count(); bytes.AddRange(length.ToGSBinary()); for (int i = 0; i < length; i++) bytes.AddRange(value.ElementAt(i).ToGSBinary()); return bytes.ToArray(); } public static byte[] ToGSBinary(this bool value); public static byte[] ToGSBinary(this IEnumerable<bool> value); public static byte[] ToGSBinary(this IEnumerable<byte> value); public static byte[] ToGSBinary(this int value); public static byte[] ToGSBinary(this IEnumerable<int> value); public static byte[] ToGSBinary(this long value); public static byte[] ToGSBinary(this IEnumerable<long> value); public static byte[] ToGSBinary(this float value); public static byte[] ToGSBinary(this IEnumerable<float> value); public static byte[] ToGSBinary(this double value); public static byte[] ToGSBinary(this IEnumerable<double> value); public static byte[] ToGSBinary(this string value); public static byte[] ToGSBinary(this IEnumerable<string> value); public static string GetHexDump(this IEnumerable<byte> value); } Program.cs Here's the the object that I'm converting to binary in a loop. class Program { static void Main(string[] args) { GSObject obj = new GSObject(); obj.AttachShort("smallInt", 15); obj.AttachInt("medInt", 120700); obj.AttachLong("bigInt", 10900800700); obj.AttachDouble("doubleVal", Math.PI); obj.AttachStringArray("muppetNames", new string[] { "Kermit", "Fozzy", "Piggy", "Animal", "Gonzo" }); GSObject apple = new GSObject(); apple.AttachString("name", "Apple"); apple.AttachString("color", "red"); apple.AttachBool("inStock", true); apple.AttachFloat("price", (float)1.5); GSObject lemon = new GSObject(); apple.AttachString("name", "Lemon"); apple.AttachString("color", "yellow"); apple.AttachBool("inStock", false); apple.AttachFloat("price", (float)0.8); GSObject apricoat = new GSObject(); apple.AttachString("name", "Apricoat"); apple.AttachString("color", "orange"); apple.AttachBool("inStock", true); apple.AttachFloat("price", (float)1.9); GSObject kiwi = new GSObject(); apple.AttachString("name", "Kiwi"); apple.AttachString("color", "green"); apple.AttachBool("inStock", true); apple.AttachFloat("price", (float)2.3); GSArray fruits = new GSArray(); fruits.AddGSObject(apple); fruits.AddGSObject(lemon); fruits.AddGSObject(apricoat); fruits.AddGSObject(kiwi); obj.AttachGSArray("fruits", fruits); Stopwatch w1 = Stopwatch.StartNew(); for (int i = 0; i < 50000; i++) { byte[] b = obj.ToGSBinary(); } w1.Stop(); Console.WriteLine(BitConverter.IsLittleEndian ? "Little Endian" : "Big Endian"); Console.WriteLine(w1.ElapsedMilliseconds + "ms"); } Here's the code for some of my other classes that are used in the code above. Most of it is repetitive. GSObject GSArray GSWrappedObject

    Read the article

  • Why cant i draw an elipse in with code?

    - by bvivek88
    package test; import java.awt.*; import java.awt.event.*; import java.awt.geom.Ellipse2D; import java.awt.image.BufferedImage; import javax.swing.*; public class test_bmp extends JPanel implements MouseListener,MouseMotionListener,ActionListener { static BufferedImage image; Color color; Point start=new Point(); Point end =new Point(); JButton elipse=new JButton("Elipse"); JButton rectangle=new JButton("Rectangle"); JButton line=new JButton("Line"); String selected; public test_bmp() { color = Color.black; setBorder(BorderFactory.createLineBorder(Color.black)); addMouseListener(this); addMouseMotionListener(this); } public void paintComponent(Graphics g) { //super.paintComponent(g); g.drawImage(image, 0, 0, this); Graphics2D g2 = (Graphics2D)g; g2.setPaint(Color.black); if(selected=="elipse") { g2.drawOval(start.x, start.y, (end.x-start.x),(end.y-start.y)); System.out.println("Start : "+start.x+","+start.y); System.out.println("End : "+end.x+","+end.y); } if(selected=="line") g2.drawLine(start.x,start.y,end.x,end.y); } //Draw on Buffered image public void draw() { Graphics2D g2 = image.createGraphics(); g2.setPaint(color); System.out.println("draw"); if(selected=="line") g2.drawLine(start.x, start.y, end.x, end.y); if(selected=="elipse") { g2.drawOval(start.x, start.y, (end.x-start.x),(end.y-start.y)); System.out.println("Start : "+start.x+","+start.y); System.out.println("End : "+end.x+","+end.y); } repaint(); g2.dispose(); } public JPanel addButtons() { JPanel buttonpanel=new JPanel(); buttonpanel.setBackground(color.lightGray); buttonpanel.setLayout(new BoxLayout(buttonpanel,BoxLayout.Y_AXIS)); elipse.addActionListener(this); rectangle.addActionListener(this); line.addActionListener(this); buttonpanel.add(elipse); buttonpanel.add(Box.createRigidArea(new Dimension(15,15))); buttonpanel.add(rectangle); buttonpanel.add(Box.createRigidArea(new Dimension(15,15))); buttonpanel.add(line); return buttonpanel; } public static void main(String args[]) { test_bmp application=new test_bmp(); //Main window JFrame frame=new JFrame("Whiteboard"); frame.setLayout(new BorderLayout()); frame.add(application.addButtons(),BorderLayout.WEST); frame.add(application); //size of the window frame.setSize(600,400); frame.setLocation(0,0); frame.setVisible(true); int w = frame.getWidth(); int h = frame.getHeight(); image = new BufferedImage(w, h, BufferedImage.TYPE_INT_RGB); Graphics2D g2 = image.createGraphics(); g2.setPaint(Color.white); g2.fillRect(0,0,w,h); g2.dispose(); frame.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); } @Override public void mouseClicked(MouseEvent arg0) { // TODO Auto-generated method stub } @Override public void mouseEntered(MouseEvent arg0) { // TODO Auto-generated method stub } @Override public void mouseExited(MouseEvent arg0) { // TODO Auto-generated method stub } @Override public void mousePressed(MouseEvent event) { start = event.getPoint(); } @Override public void mouseReleased(MouseEvent event) { end = event.getPoint(); draw(); } @Override public void mouseDragged(MouseEvent e) { end=e.getPoint(); repaint(); } @Override public void mouseMoved(MouseEvent arg0) { // TODO Auto-generated method stub } @Override public void actionPerformed(ActionEvent e) { if(e.getSource()==elipse) selected="elipse"; if(e.getSource()==line) selected="line"; draw(); } } I need to create a paint application, when i draw elipse by dragging mouse from left to right it displays nothing, why?? should i use any other function here?

    Read the article

  • No persister for: <ClassName> issue with Fluent NHibernate

    - by Amit
    I have following code: //AutoMapConfig.cs using System; using FluentNHibernate.Automapping; namespace SimpleFNH.AutoMap { public class AutoMapConfig : DefaultAutomappingConfiguration { public override bool ShouldMap(Type type) { return type.Namespace == "Examples.FirstAutomappedProject.Entities"; } } } //CascadeConvention.cs using FluentNHibernate.Conventions; using FluentNHibernate.Conventions.Instances; namespace SimpleFNH.AutoMap { public class CascadeConvention : IReferenceConvention, IHasManyConvention, IHasManyToManyConvention { public void Apply(IManyToOneInstance instance) { instance.Cascade.All(); } public void Apply(IOneToManyCollectionInstance instance) { instance.Cascade.All(); } public void Apply(IManyToManyCollectionInstance instance) { instance.Cascade.All(); } } } //Item.cs namespace SimpleFNH.Entities { public class Item { public virtual long ID { get; set; } public virtual string ItemName { get; set; } public virtual string Description { get; set; } public virtual OrderItem OrderItem { get; set; } } } //OrderItem.cs namespace SimpleFNH.Entities { public class OrderItem { public virtual long ID { get; set; } public virtual int Quantity { get; set; } public virtual Item Item { get; set; } public virtual ProductOrder ProductOrder { get; set; } public virtual void AddItem(Item item) { item.OrderItem = this; } } } using System; using System.Collections.Generic; //ProductOrder.cs namespace SimpleFNH.Entities { public class ProductOrder { public virtual long ID { get; set; } public virtual DateTime OrderDate { get; set; } public virtual string CustomerName { get; set; } public virtual IList<OrderItem> OrderItems { get; set; } public ProductOrder() { OrderItems = new List<OrderItem>(); } public virtual void AddOrderItems(params OrderItem[] items) { foreach (var item in items) { OrderItems.Add(item); item.ProductOrder = this; } } } } //NHibernateRepo.cs using FluentNHibernate.Cfg; using FluentNHibernate.Cfg.Db; using NHibernate; using NHibernate.Criterion; using NHibernate.Tool.hbm2ddl; namespace SimpleFNH.Repository { public class NHibernateRepo { private static ISessionFactory _sessionFactory; private static ISessionFactory SessionFactory { get { if (_sessionFactory == null) InitializeSessionFactory(); return _sessionFactory; } } private static void InitializeSessionFactory() { _sessionFactory = Fluently.Configure().Database( MsSqlConfiguration.MsSql2008.ConnectionString( @"server=Amit-PC\SQLEXPRESS;database=SimpleFNH;Trusted_Connection=True;").ShowSql()). Mappings(m => m.FluentMappings.AddFromAssemblyOf<Order>()).ExposeConfiguration( cfg => new SchemaExport(cfg).Create(true, true)).BuildSessionFactory(); } public static ISession OpenSession() { return SessionFactory.OpenSession(); } } } //Program.cs using System; using System.Collections.Generic; using System.Linq; using SimpleFNH.Entities; using SimpleFNH.Repository; namespace SimpleFNH { class Program { static void Main(string[] args) { using (var session = NHibernateRepo.OpenSession()) { using (var transaction = session.BeginTransaction()) { var item1 = new Item { ItemName = "item 1", Description = "test 1" }; var item2 = new Item { ItemName = "item 2", Description = "test 2" }; var item3 = new Item { ItemName = "item 3", Description = "test 3" }; var orderItem1 = new OrderItem { Item = item1, Quantity = 2 }; var orderItem2 = new OrderItem { Item = item2, Quantity = 4 }; var orderItem3 = new OrderItem { Item = item3, Quantity = 5 }; var productOrder = new ProductOrder { CustomerName = "Amit", OrderDate = DateTime.Now, OrderItems = new List<OrderItem> { orderItem1, orderItem2, orderItem3 } }; productOrder.AddOrderItems(orderItem1, orderItem2, orderItem3); session.Save(productOrder); transaction.Commit(); } } using (var session = NHibernateRepo.OpenSession()) { // retreive all stores and display them using (session.BeginTransaction()) { var orders = session.CreateCriteria(typeof(ProductOrder)) .List<ProductOrder>(); foreach (var item in orders) { Console.WriteLine(item.OrderItems.First().Quantity); } } } } } } I tried many variations to get it working but i get an error saying No persister for: SimpleFNH.Entities.ProductOrder Can someone help me get it working? I wanted to create a simple program which will set a pattern for my bigger project but it is taking quite a lot of time than expected. It would be rally helpful if you can explain in simple terms on any template/pattern that i can use to get fluent nHibernate working. The above code uses auto mapping, which i tried after i tried with fluent mapping.

    Read the article

  • Hibernate error: cannot resolve table

    - by Roman
    I'm trying to make work the example from hibernate reference. I've got simple table Pupil with id, name and age fields. I've created correct (as I think) java-class for it according to all java-beans rules. I've created configuration file - hibernate.cfg.xml, just like in the example from reference. I've created hibernate mapping for one class Pupil, and here is the error occured. <hibernate-mapping> <class name="Pupil" table="pupils"> ... </class> </hibernate-mapping> table="pupils" is red in my IDE and I see message "cannot resolve table pupils". I've also founded very strange note in reference which says that most users fail with the same problem trying to run the example. Ah.. I'm very angry with this example.. IMHO if authors know that there is such problem they should add some information about it. But, how should I fix it? I don't want to deal with Ant here and with other instruments used in example. I'm using MySql 5.0, but I think it doesn't matter. UPD: source code Pupil.java - my persistent class package domain; public class Pupil { private Integer id; private String name; private Integer age; protected Pupil () { } public Pupil (String name, int age) { this.age = age; this.name = name; } public Integer getId () { return id; } public void setId (Integer id) { this.id = id; } public String getName () { return name; } public void setName (String name) { this.name = name; } public Integer getAge () { return age; } public void setAge (Integer age) { this.age = age; } public String toString () { return "Pupil [ name = " + name + ", age = " + age + " ]"; } } Pupil.hbm.xml is mapping for this class <?xml version="1.0"?> <!DOCTYPE hibernate-mapping PUBLIC "-//Hibernate/Hibernate Mapping DTD 3.0//EN" "http://hibernate.sourceforge.net/hibernate-mapping-3.0.dtd"> <hibernate-mapping package="domain" > <class name="Pupil" table="pupils"> <id name="id"> <generator class="native" /> </id> <property name="name" not-null="true"/> <property name="age"/> </class> </hibernate-mapping> hibernate.cfg.xml - configuration for hibernate <hibernate-configuration> <session-factory> <!-- Database connection settings --> <property name="connection.driver_class">com.mysql.jdbc.Driver</property> <property name="connection.url">jdbc:mysql://localhost/hbm_test</property> <property name="connection.username">root</property> <property name="connection.password">root</property> <property name="connection.pool_size">1</property> <property name="dialect">org.hibernate.dialect.MySQL5Dialect</property> <property name="current_session_context_class">thread</property> <property name="show_sql">true</property> <mapping resource="domain/Pupil.hbm.xml"/> </session-factory> </hibernate-configuration> HibernateUtils.java package utils; import org.hibernate.SessionFactory; import org.hibernate.HibernateException; import org.hibernate.cfg.Configuration; public class HibernateUtils { private static final SessionFactory sessionFactory; static { try { sessionFactory = new Configuration ().configure ().buildSessionFactory (); } catch (HibernateException he) { System.err.println (he); throw new ExceptionInInitializerError (he); } } public static SessionFactory getSessionFactory () { return sessionFactory; } } Runner.java - class for testing hibernate import org.hibernate.Session; import java.util.*; import utils.HibernateUtils; import domain.Pupil; public class Runner { public static void main (String[] args) { Session s = HibernateUtils.getSessionFactory ().getCurrentSession (); s.beginTransaction (); List pups = s.createQuery ("from Pupil").list (); for (Object obj : pups) { System.out.println (obj); } s.getTransaction ().commit (); HibernateUtils.getSessionFactory ().close (); } } My libs: antlr-2.7.6.jar, asm.jar, asm-attrs.jar, cglib-2.1.3.jar, commons-collections-2.1.1.jar, commons-logging-1.0.4.jar, dom4j-1.6.1.jar, hibernate3.jar, jta.jar, log4j-1.2.11.jar, mysql-connector-java-5.1.7-bin.jar Compile error: cannot resolve table pupils

    Read the article

  • Passing a comparator syntax help in Java

    - by Crystal
    I've tried this a couple ways, the first is have a class that implements comparator at the bottom of the following code. When I try to pass the comparat in sortListByLastName, I get a constructor not found error and I am not sure why import java.util.*; public class OrganizeThis implements WhoDoneIt { /** Add a person to the organizer @param p A person object */ public void add(Person p) { staff.put(p.getEmail(), p); //System.out.println("Person " + p + "added"); } /** * Remove a Person from the organizer. * * @param email The email of the person to be removed. */ public void remove(String email) { staff.remove(email); } /** * Remove all contacts from the organizer. * */ public void empty() { staff.clear(); } /** * Find the person stored in the organizer with the email address. * Note, each person will have a unique email address. * * @param email The person email address you are looking for. * */ public Person findByEmail(String email) { Person aPerson = staff.get(email); return aPerson; } /** * Find all persons stored in the organizer with the same last name. * Note, there can be multiple persons with the same last name. * * @param lastName The last name of the persons your are looking for. * */ public Person[] find(String lastName) { ArrayList<Person> names = new ArrayList<Person>(); for (Person s : staff.values()) { if (s.getLastName() == lastName) { names.add(s); } } // Convert ArrayList back to Array Person nameArray[] = new Person[names.size()]; names.toArray(nameArray); return nameArray; } /** * Return all the contact from the orgnizer in * an array sorted by last name. * * @return An array of Person objects. * */ public Person[] getSortedListByLastName() { PersonLastNameComparator comp = new PersonLastNameComparator(); Map<String, Person> sorted = new TreeMap<String, Person>(comp); ArrayList<Person> sortedArrayList = new ArrayList<Person>(); for (Person s: sorted.values()) { sortedArrayList.add(s); } Person sortedArray[] = new Person[sortedArrayList.size()]; sortedArrayList.toArray(sortedArray); return sortedArray; } private Map<String, Person> staff = new HashMap<String, Person>(); public static void main(String[] args) { OrganizeThis testObj = new OrganizeThis(); Person person1 = new Person("J", "W", "111-222-3333", "[email protected]"); Person person2 = new Person("K", "W", "345-678-9999", "[email protected]"); Person person3 = new Person("Phoebe", "Wang", "322-111-3333", "[email protected]"); Person person4 = new Person("Nermal", "Johnson", "322-342-5555", "[email protected]"); Person person5 = new Person("Apple", "Banana", "123-456-1111", "[email protected]"); testObj.add(person1); testObj.add(person2); testObj.add(person3); testObj.add(person4); testObj.add(person5); System.out.println(testObj.findByEmail("[email protected]")); System.out.println("------------" + '\n'); Person a[] = testObj.find("W"); for (Person p : a) System.out.println(p); System.out.println("------------" + '\n'); a = testObj.find("W"); for (Person p : a) System.out.println(p); System.out.println("SORTED" + '\n'); a = testObj.getSortedListByLastName(); for (Person b : a) { System.out.println(b); } System.out.println(testObj.getAuthor()); } } class PersonLastNameComparator implements Comparator<Person> { public int compare(Person a, Person b) { return a.getLastName().compareTo(b.getLastName()); } } And then when I tried doing it by creating an anonymous inner class, I also get a constructor TreeMap cannot find symbol error. Any thoughts? inner class method: public Person[] getSortedListByLastName() { //PersonLastNameComparator comp = new PersonLastNameComparator(); Map<String, Person> sorted = new TreeMap<String, Person>(new Comparator<Person>() { public int compare(Person a, Person b) { return a.getLastName().compareTo(b.getLastName()); } }); ArrayList<Person> sortedArrayList = new ArrayList<Person>(); for (Person s: sorted.values()) { sortedArrayList.add(s); } Person sortedArray[] = new Person[sortedArrayList.size()]; sortedArrayList.toArray(sortedArray); return sortedArray; }

    Read the article

  • Performance of delegate and method group

    - by BlueFox
    Hi I was investigating the performance hit of creating Cachedependency objects, so I wrote a very simple test program as follows: using System; using System.Collections.Generic; using System.Diagnostics; using System.Web.Caching; namespace Test { internal class Program { private static readonly string[] keys = new[] {"Abc"}; private static readonly int MaxIteration = 10000000; private static void Main(string[] args) { Debug.Print("first set"); test7(); test6(); test5(); test4(); test3(); test2(); Debug.Print("second set"); test2(); test3(); test4(); test5(); test6(); test7(); } private static void test2() { DateTime start = DateTime.Now; var list = new List<CacheDependency>(); for (int i = 0; i < MaxIteration; i++) { list.Add(new CacheDependency(null, keys)); } Debug.Print("test2 Time: " + (DateTime.Now - start)); } private static void test3() { DateTime start = DateTime.Now; var list = new List<Func<CacheDependency>>(); for (int i = 0; i < MaxIteration; i++) { list.Add(() => new CacheDependency(null, keys)); } Debug.Print("test3 Time: " + (DateTime.Now - start)); } private static void test4() { var p = new Program(); DateTime start = DateTime.Now; var list = new List<Func<CacheDependency>>(); for (int i = 0; i < MaxIteration; i++) { list.Add(p.GetDep); } Debug.Print("test4 Time: " + (DateTime.Now - start)); } private static void test5() { var p = new Program(); DateTime start = DateTime.Now; var list = new List<Func<CacheDependency>>(); for (int i = 0; i < MaxIteration; i++) { list.Add(() => { return p.GetDep(); }); } Debug.Print("test5 Time: " + (DateTime.Now - start)); } private static void test6() { DateTime start = DateTime.Now; var list = new List<Func<CacheDependency>>(); for (int i = 0; i < MaxIteration; i++) { list.Add(GetDepSatic); } Debug.Print("test6 Time: " + (DateTime.Now - start)); } private static void test7() { DateTime start = DateTime.Now; var list = new List<Func<CacheDependency>>(); for (int i = 0; i < MaxIteration; i++) { list.Add(() => { return GetDepSatic(); }); } Debug.Print("test7 Time: " + (DateTime.Now - start)); } private CacheDependency GetDep() { return new CacheDependency(null, keys); } private static CacheDependency GetDepSatic() { return new CacheDependency(null, keys); } } } But I can't understand why these result looks like this: first set test7 Time: 00:00:00.4840277 test6 Time: 00:00:02.2041261 test5 Time: 00:00:00.1910109 test4 Time: 00:00:03.1401796 test3 Time: 00:00:00.1820105 test2 Time: 00:00:08.5394884 second set test2 Time: 00:00:07.7324423 test3 Time: 00:00:00.1830105 test4 Time: 00:00:02.3561347 test5 Time: 00:00:00.1750100 test6 Time: 00:00:03.2941884 test7 Time: 00:00:00.1850106 In particular: 1. Why is test4 and test6 much slower than their delegate version? I also noticed that Resharper specifically has a comment on the delegate version suggesting change test5 and test7 to "Covert to method group". Which is the same as test4 and test6 but they're actually slower? 2. I don't seem a consistent performance difference when calling test4 and test6, shouldn't static calls to be always faster?

    Read the article

  • adjust selected File to FileFilter in a JFileChooser

    - by amarillion
    I'm writing a diagram editor in java. This app has the option to export to various standard image formats such as .jpg, .png etc. When the user clicks File-Export, you get a JFileChooser which has a number of FileFilters in it, for .jpg, .png etc. Now here is my question: Is there a way to have the extension of the default adjust to the selected file filter? E.g. if the document is named "lolcat" then the default option should be "lolcat.png" when the png filter is selected, and when the user selects the jpg file filter, the default should change to "lolcat.jpg" automatically. Is this possible? How can I do it? edit: Based on the answer below, I wrote some code. But it doesn't quite work yet. I've added a propertyChangeListener to the FILE_FILTER_CHANGED_PROPERTY, but it seems that within this method getSelectedFile() returns null. Here is the code. package nl.helixsoft; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.beans.PropertyChangeEvent; import java.beans.PropertyChangeListener; import java.io.File; import java.util.ArrayList; import java.util.List; import javax.swing.JButton; import javax.swing.JFileChooser; import javax.swing.JFrame; import javax.swing.filechooser.FileFilter; public class JFileChooserTest { public class SimpleFileFilter extends FileFilter { private String desc; private List<String> extensions; private boolean showDirectories; /** * @param name example: "Data files" * @param glob example: "*.txt|*.csv" */ public SimpleFileFilter (String name, String globs) { extensions = new ArrayList<String>(); for (String glob : globs.split("\\|")) { if (!glob.startsWith("*.")) throw new IllegalArgumentException("expected list of globs like \"*.txt|*.csv\""); // cut off "*" // store only lower case (make comparison case insensitive) extensions.add (glob.substring(1).toLowerCase()); } desc = name + " (" + globs + ")"; } public SimpleFileFilter(String name, String globs, boolean showDirectories) { this(name, globs); this.showDirectories = showDirectories; } @Override public boolean accept(File file) { if(showDirectories && file.isDirectory()) { return true; } String fileName = file.toString().toLowerCase(); for (String extension : extensions) { if (fileName.endsWith (extension)) { return true; } } return false; } @Override public String getDescription() { return desc; } /** * @return includes '.' */ public String getFirstExtension() { return extensions.get(0); } } void export() { String documentTitle = "lolcat"; final JFileChooser jfc = new JFileChooser(); jfc.setDialogTitle("Export"); jfc.setDialogType(JFileChooser.SAVE_DIALOG); jfc.setSelectedFile(new File (documentTitle)); jfc.addChoosableFileFilter(new SimpleFileFilter("JPEG", "*.jpg")); jfc.addChoosableFileFilter(new SimpleFileFilter("PNG", "*.png")); jfc.addPropertyChangeListener(JFileChooser.FILE_FILTER_CHANGED_PROPERTY, new PropertyChangeListener() { public void propertyChange(PropertyChangeEvent arg0) { System.out.println ("Property changed"); String extold = null; String extnew = null; if (arg0.getOldValue() == null || !(arg0.getOldValue() instanceof SimpleFileFilter)) return; if (arg0.getNewValue() == null || !(arg0.getNewValue() instanceof SimpleFileFilter)) return; SimpleFileFilter oldValue = ((SimpleFileFilter)arg0.getOldValue()); SimpleFileFilter newValue = ((SimpleFileFilter)arg0.getNewValue()); extold = oldValue.getFirstExtension(); extnew = newValue.getFirstExtension(); String filename = "" + jfc.getSelectedFile(); System.out.println ("file: " + filename + " old: " + extold + ", new: " + extnew); if (filename.endsWith(extold)) { filename.replace(extold, extnew); } else { filename += extnew; } jfc.setSelectedFile(new File (filename)); } }); jfc.showDialog(frame, "export"); } JFrame frame; void run() { frame = new JFrame(); JButton btn = new JButton ("export"); frame.add (btn); btn.addActionListener (new ActionListener() { public void actionPerformed(ActionEvent ae) { export(); } }); frame.setSize (300, 300); frame.pack(); frame.setVisible(true); } public static void main(String[] args) { javax.swing.SwingUtilities.invokeLater(new Runnable() { public void run() { JFileChooserTest x = new JFileChooserTest(); x.run(); } }); } }

    Read the article

  • Why can't my main class see the array in my calender class

    - by Rocky Celltick Eadie
    This is a homework problem. I'm already 5 days late and can't figure out what I'm doing wrong.. this is my 1st semester in Java and my first post on this site Here is the assignment.. Create a class called Calendar. The class should contain a variable called events that is a String array. The array should be created to hold 5 elements. Use a constant value to specify the array size. Do not hard code the array size. Initialize the array in the class constructor so that each element contains the string “ – No event planned – “. The class should contain a method called CreateEvent. This method should accept a String argument that contains a one-word user event and an integer argument that represents the day of the week. Monday should be represented by the number 1 and Friday should be represented by the number 5. Populate the events array with the event info passed into the method. Although the user will input one-word events, each event string should prepend the following string to each event: event_dayAppoinment: (where event_day is the day of the week) For example, if the user enters 1 and “doctor” , the first array element should read: Monday Appointment: doctor If the user enters 2 and “PTA” , the second array element should read: Tuesday Appointment: PTA Write a driver program (in a separate class) that creates and calls your Calendar class. Then use a loop to gather user input. Ask for the day (as an integer) and then ask for the event (as a one word string). Pass the integer and string to the Calendar object’s CreateEvent method. The user should be able enter 0 – 5 events. If the user enters -1, the loop should exit and your application should print out all the events in a tabular format. Your program should not allow the user to enter invalid values for the day of the week. Any input other than 1 – 5 or -1 for the day of the week would be considered invalid. Notes: When obtaining an integer from the user, you will need to use the nextInt() method on your Scanner object. When obtaining a string from a user, you will need to use the next() method on your Scanner object. Here is my code so far.. //DRIVER CLASS /** * * @author Rocky */ //imports scanner import java.util.Scanner; //begin class driver public class driver { /** * @paramargs the command line arguments */ //begin main method public static void main(String[] args) { //initiates scanner Scanner userInput = new Scanner (System.in); //declare variables int dayOfWeek; String userEvent; //creates object for calender class calendercalenderObject = new calender(); //user prompt System.out.println("Enter day of week for your event in the following format:"); System.out.println("Enter 1 for Monday"); System.out.println("Enter 2 for Tuesday"); System.out.println("Enter 3 for Wednsday"); System.out.println("Enter 4 for Thursday"); System.out.println("Enter 5 for Friday"); System.out.println("Enter -1 to quit"); //collect user input dayOfWeek = userInput.nextInt(); //user prompt System.out.println("Please type in the name of your event"); //collect user input userEvent = userInput.next(); //begin while loop while (dayOfWeek != -1) { //test for valid day of week if ((dayOfWeek>=1) && (dayOfWeek<=5)){ //calls createEvent method in calender class and passes 2 variables calenderObject.createEvent(userEvent,dayOfWeek); } else { //error message System.out.println("You have entered an invalid number"); //user prompts System.out.println("Press -1 to quit or enter another day"); System.out.println("Enter 1 for Monday"); System.out.println("Enter 2 for Tuesday"); System.out.println("Enter 3 for Wednsday"); System.out.println("Enter 4 for Thursday"); System.out.println("Enter 5 for Friday"); System.out.println("Enter -1 to quit"); //collect user input dayOfWeek = userInput.nextInt(); //end data validity test } //end while loop } //prints array to screen int i=0; for (i=0;i<events.length;i++){ System.out.println(events[i]); } //end main method } } /** * * @author Rocky */ //imports scanner import java.util.Scanner; //begin calender class public class calender { //creates events array String[] events = new String[5]; //begin calender class constructor public calender() { //Initializes array String[] events = {"-No event planned-","-No event planned-","-No event planned-","-No event planned-","-No event planned-"}; //end calender class constructor } //begin createEvent method public String[] createEvent (String userEvent, int dayOfWeek){ //Start switch test switch (dayOfWeek){ case 1: events[0] = ("Monday Appoinment:") + userEvent; break; case 2: events[1] = ("Tuesday Appoinment:") + userEvent; break; case 3: events[2] = ("WednsdayAppoinment:") + userEvent; break; case 4: events[3] = ("Thursday Appoinment:") + userEvent; break; case 5: events[4] = ("Friday Appoinment:") + userEvent; break; default: break; //End switch test } //returns events array return events; //end create event method } //end calender class }

    Read the article

  • Why is insertion into my tree faster on sorted input than random input?

    - by Juliet
    Now I've always heard binary search trees are faster to build from randomly selected data than ordered data, simply because ordered data requires explicit rebalancing to keep the tree height at a minimum. Recently I implemented an immutable treap, a special kind of binary search tree which uses randomization to keep itself relatively balanced. In contrast to what I expected, I found I can consistently build a treap about 2x faster and generally better balanced from ordered data than unordered data -- and I have no idea why. Here's my treap implementation: http://pastebin.com/VAfSJRwZ And here's a test program: using System; using System.Collections.Generic; using System.Linq; using System.Diagnostics; namespace ConsoleApplication1 { class Program { static Random rnd = new Random(); const int ITERATION_COUNT = 20; static void Main(string[] args) { List<double> rndTimes = new List<double>(); List<double> orderedTimes = new List<double>(); rndTimes.Add(TimeIt(50, RandomInsert)); rndTimes.Add(TimeIt(100, RandomInsert)); rndTimes.Add(TimeIt(200, RandomInsert)); rndTimes.Add(TimeIt(400, RandomInsert)); rndTimes.Add(TimeIt(800, RandomInsert)); rndTimes.Add(TimeIt(1000, RandomInsert)); rndTimes.Add(TimeIt(2000, RandomInsert)); rndTimes.Add(TimeIt(4000, RandomInsert)); rndTimes.Add(TimeIt(8000, RandomInsert)); rndTimes.Add(TimeIt(16000, RandomInsert)); rndTimes.Add(TimeIt(32000, RandomInsert)); rndTimes.Add(TimeIt(64000, RandomInsert)); rndTimes.Add(TimeIt(128000, RandomInsert)); string rndTimesAsString = string.Join("\n", rndTimes.Select(x => x.ToString()).ToArray()); orderedTimes.Add(TimeIt(50, OrderedInsert)); orderedTimes.Add(TimeIt(100, OrderedInsert)); orderedTimes.Add(TimeIt(200, OrderedInsert)); orderedTimes.Add(TimeIt(400, OrderedInsert)); orderedTimes.Add(TimeIt(800, OrderedInsert)); orderedTimes.Add(TimeIt(1000, OrderedInsert)); orderedTimes.Add(TimeIt(2000, OrderedInsert)); orderedTimes.Add(TimeIt(4000, OrderedInsert)); orderedTimes.Add(TimeIt(8000, OrderedInsert)); orderedTimes.Add(TimeIt(16000, OrderedInsert)); orderedTimes.Add(TimeIt(32000, OrderedInsert)); orderedTimes.Add(TimeIt(64000, OrderedInsert)); orderedTimes.Add(TimeIt(128000, OrderedInsert)); string orderedTimesAsString = string.Join("\n", orderedTimes.Select(x => x.ToString()).ToArray()); Console.WriteLine("Done"); } static double TimeIt(int insertCount, Action<int> f) { Console.WriteLine("TimeIt({0}, {1})", insertCount, f.Method.Name); List<double> times = new List<double>(); for (int i = 0; i < ITERATION_COUNT; i++) { Stopwatch sw = Stopwatch.StartNew(); f(insertCount); sw.Stop(); times.Add(sw.Elapsed.TotalMilliseconds); } return times.Average(); } static void RandomInsert(int insertCount) { Treap<double> tree = new Treap<double>((x, y) => x.CompareTo(y)); for (int i = 0; i < insertCount; i++) { tree = tree.Insert(rnd.NextDouble()); } } static void OrderedInsert(int insertCount) { Treap<double> tree = new Treap<double>((x, y) => x.CompareTo(y)); for(int i = 0; i < insertCount; i++) { tree = tree.Insert(i + rnd.NextDouble()); } } } } And here's a chart comparing random and ordered insertion times in milliseconds: Insertions Random Ordered RandomTime / OrderedTime 50 1.031665 0.261585 3.94 100 0.544345 1.377155 0.4 200 1.268320 0.734570 1.73 400 2.765555 1.639150 1.69 800 6.089700 3.558350 1.71 1000 7.855150 4.704190 1.67 2000 17.852000 12.554065 1.42 4000 40.157340 22.474445 1.79 8000 88.375430 48.364265 1.83 16000 197.524000 109.082200 1.81 32000 459.277050 238.154405 1.93 64000 1055.508875 512.020310 2.06 128000 2481.694230 1107.980425 2.24 I don't see anything in the code which makes ordered input asymptotically faster than unordered input, so I'm at a loss to explain the difference. Why is it so much faster to build a treap from ordered input than random input?

    Read the article

  • Embedding generic sql queries into c# program

    - by Pooja Balkundi
    Okay referring to my first question code in the main, I want the user to enter employee name at runtime and then i take this name which user has entered and compare it with the e_name of my emp table , if it exists i want to display all information of that employee , how can I achieve this ? using System; using System.Collections.Generic; using System.Linq; using System.Windows.Forms; using MySql.Data.MySqlClient; namespace ConnectCsharppToMySQL { public class DBConnect { private MySqlConnection connection; private string server; private string database; private string uid; private string password; string name; //Constructor public DBConnect() { Initialize(); } //Initialize values private void Initialize() { server = "localhost"; database = "test"; uid = "root"; password = ""; string connectionString; connectionString = "SERVER=" + server + ";" + "DATABASE=" + database + ";" + "UID=" + uid + ";" + "PASSWORD=" + password + ";"; connection = new MySqlConnection(connectionString); } //open connection to database private bool OpenConnection() { try { connection.Open(); return true; } catch (MySqlException ex) { //When handling errors, you can your application's response based //on the error number. //The two most common error numbers when connecting are as follows: //0: Cannot connect to server. //1045: Invalid user name and/or password. switch (ex.Number) { case 0: MessageBox.Show("Cannot connect to server. Contact administrator"); break; case 1045: MessageBox.Show("Invalid username/password, please try again"); break; } return false; } } //Close connection private bool CloseConnection() { try { connection.Close(); return true; } catch (MySqlException ex) { MessageBox.Show(ex.Message); return false; } } //Insert statement public void Insert() { string query = "INSERT INTO emp (e_name, age) VALUES('Pooja R', '21')"; //open connection if (this.OpenConnection() == true) { //create command and assign the query and connection from the constructor MySqlCommand cmd = new MySqlCommand(query, connection); //Execute command cmd.ExecuteNonQuery(); //close connection this.CloseConnection(); } } //Update statement public void Update() { string query = "UPDATE emp SET e_name='Peachy', age='22' WHERE e_name='Pooja R'"; //Open connection if (this.OpenConnection() == true) { //create mysql command MySqlCommand cmd = new MySqlCommand(); //Assign the query using CommandText cmd.CommandText = query; //Assign the connection using Connection cmd.Connection = connection; //Execute query cmd.ExecuteNonQuery(); //close connection this.CloseConnection(); } } //Select statement public List<string>[] Select() { string query = "SELECT * FROM emp where e_name=(/*I WANT USER ENTERED NAME TO GET INSERTED HERE*/)"; //Create a list to store the result List<string>[] list = new List<string>[3]; list[0] = new List<string>(); list[1] = new List<string>(); list[2] = new List<string>(); //Open connection if (this.OpenConnection() == true) { //Create Command MySqlCommand cmd = new MySqlCommand(query, connection); //Create a data reader and Execute the command MySqlDataReader dataReader = cmd.ExecuteReader(); //Read the data and store them in the list while (dataReader.Read()) { list[0].Add(dataReader["e_id"] + ""); list[1].Add(dataReader["e_name"] + ""); list[2].Add(dataReader["age"] + ""); } //close Data Reader dataReader.Close(); //close Connection this.CloseConnection(); //return list to be displayed return list; } else { return list; } } public static void Main(String[] args) { DBConnect db1 = new DBConnect(); Console.WriteLine("Initializing"); db1.Initialize(); Console.WriteLine("Search :"); Console.WriteLine("Enter the employee name"); db1.name = Console.ReadLine(); db1.Select(); Console.ReadLine(); } } }

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • login form whith java/sqlite

    - by tuxou
    hi I would like to create a login form for my application with the possibility to add or remove users for an sqlite database, i have created the table users(nam, pass) but i can't unclud it in my login form, it someone could help me this is my login code: import java.awt.*; import java.awt.event.*; import javax.swing.*; public class login extends JFrame { // Variables declaration private JLabel jLabel1; private JLabel jLabel2; private JTextField jTextField1; private JPasswordField jPasswordField1; private JButton jButton1; private JPanel contentPane; // End of variables declaration public login() { super(); create(); this.setVisible(true); } private void create() { jLabel1 = new JLabel(); jLabel2 = new JLabel(); jTextField1 = new JTextField(); jPasswordField1 = new JPasswordField(); jButton1 = new JButton(); contentPane = (JPanel)this.getContentPane(); // // jLabel1 // jLabel1.setHorizontalAlignment(SwingConstants.LEFT); jLabel1.setForeground(new Color(0, 0, 255)); jLabel1.setText("username:"); // // jLabel2 // jLabel2.setHorizontalAlignment(SwingConstants.LEFT); jLabel2.setForeground(new Color(0, 0, 255)); jLabel2.setText("password:"); // // jTextField1 // jTextField1.setForeground(new Color(0, 0, 255)); jTextField1.setSelectedTextColor(new Color(0, 0, 255)); jTextField1.setToolTipText("Enter your username"); jTextField1.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { jTextField1_actionPerformed(e); } }); // // jPasswordField1 // jPasswordField1.setForeground(new Color(0, 0, 255)); jPasswordField1.setToolTipText("Enter your password"); jPasswordField1.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { jPasswordField1_actionPerformed(e); } }); // // jButton1 // jButton1.setBackground(new Color(204, 204, 204)); jButton1.setForeground(new Color(0, 0, 255)); jButton1.setText("Login"); jButton1.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { jButton1_actionPerformed(e); } }); // // contentPane // contentPane.setLayout(null); contentPane.setBorder(BorderFactory.createEtchedBorder()); contentPane.setBackground(new Color(204, 204, 204)); addComponent(contentPane, jLabel1, 5,10,106,18); addComponent(contentPane, jLabel2, 5,47,97,18); addComponent(contentPane, jTextField1, 110,10,183,22); addComponent(contentPane, jPasswordField1, 110,45,183,22); addComponent(contentPane, jButton1, 150,75,83,28); // // login // this.setTitle("Login To Members Area"); this.setLocation(new Point(76, 182)); this.setSize(new Dimension(335, 141)); this.setDefaultCloseOperation(WindowConstants.EXIT_ON_CLOSE); this.setResizable(false); } /** Add Component Without a Layout Manager (Absolute Positioning) */ private void addComponent(Container container,Component c,int x,int y,int width,int height) { c.setBounds(x,y,width,height); container.add(c); } private void jTextField1_actionPerformed(ActionEvent e) { } private void jPasswordField1_actionPerformed(ActionEvent e) { } private void jButton1_actionPerformed(ActionEvent e) { System.out.println("\njButton1_actionPerformed(ActionEvent e) called."); String username = new String(jTextField1.getText()); String password = new String(jPasswordField1.getText()); if(username.equals("") || password.equals("")) // If password and username is empty Do this { jButton1.setEnabled(false); JLabel errorFields = new JLabel("You must enter a username and password to login."); JOptionPane.showMessageDialog(null,errorFields); jTextField1.setText(""); jPasswordField1.setText(""); jButton1.setEnabled(true); this.setVisible(true); } else { JLabel optionLabel = new JLabel("You entered "+username+" as your username. Is this correct?"); int confirm =JOptionPane.showConfirmDialog(null,optionLabel); switch(confirm){ // Switch Case case JOptionPane.YES_OPTION: // Attempt to Login user jButton1.setEnabled(false); // Set button enable to false to prevent 2 login attempts break; case JOptionPane.NO_OPTION: // No Case.(Go back. Set text to 0) jButton1.setEnabled(false); jTextField1.setText(""); jPasswordField1.setText(""); jButton1.setEnabled(true); break; case JOptionPane.CANCEL_OPTION: // Cancel Case.(Go back. Set text to 0) jButton1.setEnabled(false); jTextField1.setText(""); jPasswordField1.setText(""); jButton1.setEnabled(true); break; } // End Switch Case } } public static void main(String[] args) { JFrame.setDefaultLookAndFeelDecorated(true); JDialog.setDefaultLookAndFeelDecorated(true); try { UIManager.setLookAndFeel("com.sun.java.swing.plaf.windows.WindowsLookAndFeel"); } catch (Exception ex) { System.out.println("Failed loading L&F: "); System.out.println(ex); } new login(); }; }

    Read the article

  • Why is .NET faster than C++ in this case?

    - by acidzombie24
    -edit- I LOVE SLaks comment. "The amount of misinformation in these answers is staggering." :D Calm down guys. Pretty much all of you were wrong. I DID make optimizations. It turns out whatever optimizations I made wasn't good enough. I ran the code in GCC using gettimeofday (I'll paste code below) and used g++ -O2 file.cpp and got slightly faster results then C#. Maybe MS didn't create the optimizations needed in this specific case but after downloading and installing mingw I was tested and found the speed to be near identical. Justicle Seems to be right. I could have sworn I use clock on my PC and used that to count and found it was slower but problem solved. C++ speed isn't almost twice as slower in the MS compiler. When my friend informed me of this I couldn't believe it. So I took his code and put some timers onto it. Instead of Boo I used C#. I constantly got faster results in C#. Why? The .NET version was nearly half the time no matter what number I used. C++ version: #include <iostream> #include <stdio.h> #include <intrin.h> #include <windows.h> using namespace std; int fib(int n) { if (n < 2) return n; return fib(n - 1) + fib(n - 2); } int main() { __int64 time = 0xFFFFFFFF; while (1) { int n; //cin >> n; n = 41; if (n < 0) break; __int64 start = __rdtsc(); int res = fib(n); __int64 end = __rdtsc(); cout << res << endl; cout << (float)(end-start)/1000000<<endl; break; } return 0; } C# version: using System; using System.Collections.Generic; using System.Linq; using System.Text; using System.Runtime.InteropServices; using System.ComponentModel; using System.Threading; using System.IO; using System.Diagnostics; namespace fibCSTest { class Program { static int fib(int n) { if (n < 2)return n; return fib(n - 1) + fib(n - 2); } static void Main(string[] args) { //var sw = new Stopwatch(); //var timer = new PAB.HiPerfTimer(); var timer = new Stopwatch(); while (true) { int n; //cin >> n; n = 41; if (n < 0) break; timer.Start(); int res = fib(n); timer.Stop(); Console.WriteLine(res); Console.WriteLine(timer.ElapsedMilliseconds); break; } } } } GCC version: #include <iostream> #include <stdio.h> #include <sys/time.h> using namespace std; int fib(int n) { if (n < 2) return n; return fib(n - 1) + fib(n - 2); } int main() { timeval start, end; while (1) { int n; //cin >> n; n = 41; if (n < 0) break; gettimeofday(&start, 0); int res = fib(n); gettimeofday(&end, 0); int sec = end.tv_sec - start.tv_sec; int usec = end.tv_usec - start.tv_usec; cout << res << endl; cout << sec << " " << usec <<endl; break; } return 0; }

    Read the article

  • ArrayList access

    - by Ricky McQuesten
    So once again I have a question about this program. I want to store transactions that are made in an arraylist and then have an option in the case menu where I can print out those that are stored. I have been researching online and have been unable to find a solution to this, so is this possible and how would I go about doing this? I also want to attach a timestamp to each transaction as well. Here is the code I have so far. So my question is how would I add a timestamp to each withdrawal or deposit, and how would I store each transaction in array list? import java.util.*; public class BankAccount extends Money { //inheritence static String name; public static int acctNum; public static double balance, amount; BankAccount(String name, int accNo, double bal) { this.name = name; this.acctNum = accNo; this.balance = bal; } void display() { System.out.println("Your Name:" + name); System.out.println("Your Account Number:" + acctNum); System.out.println("Your Current Account Balance:" + Money.getBalance()); } void displayBalance() { System.out.println("Balance:" + balance); } } import java.util.Scanner; /** * * @author Ricky */ public class Money { public static int accountNumber; public static double balance; static double amount; static String name; public void setDeposit(double amount) { balance = balance + amount; if (amount < 0) { System.out.println("Invalid"); } } public double getDeposit() { return 1; } public void setBalance(double b) { balance = b; } public static double getBalance() { return balance; } public void setWithdraw(double amount) { if (balance < amount) { System.out.println("Not enough funds."); } else if(amount < 0) { System.out.println("Invalid"); } else { balance = balance - amount; } } public double getWithdraw() { return 1; } } import java.util.*; public class Client { public static void main(String args[]) { int n = 0; int count; String trans; ArrayList<String> transaction= new ArrayList<String>(n); Scanner input = new Scanner(System.in); System.out.println("Welcome to First National Bank"); System.out.println("Please enter your name: "); String cusName = input.nextLine(); System.out.println("You will now be assigned an account number."); Random randomGenerator = new Random(); int accNo = randomGenerator.nextInt(100000); //random number System.out.println("Your account number is: " + accNo); System.out.println("Please enter your initial account balance: "); Double balance = input.nextDouble(); BankAccount b1 = new BankAccount(cusName, accNo, balance); b1.setBalance(balance); int menu; /*System.out.println("Menu"); System.out.println("1. Deposit Amount"); System.out.println("2. Withdraw Amount"); System.out.println("3. Display Information"); System.out.println("4. Exit");*/ boolean quit = false; do { System.out.println("*******Menu*******"); System.out.println("1. Deposit Amount"); // menu to take input from user System.out.println("2. Withdraw Amount"); System.out.println("3. Display Information"); System.out.println("4. Exit"); System.out.print("Please enter your choice: "); menu = input.nextInt(); switch (menu) { case 1: System.out.print("Enter depost amount:"); b1.setDeposit(input.nextDouble()); b1.getDeposit(); transaction.add(trans); break; case 2: System.out.println("Current Account Balance=" + b1.getBalance()); System.out.print("Enter withdrawal amount:"); b1.setWithdraw(input.nextDouble()); b1.getWithdraw(); transaction.add(trans); break; // switch statments to do a loop case 3: b1.display(); break; case 4: quit = true; break; } } while (!quit); } } public class Date { static Date time = new Date(); }

    Read the article

  • Help needed on an SQL configuration problem.

    - by user321048
    I have been banging my head with this one more the two weeks, and still don't know what the problem is ( I can't narrow it down). The problem is the following. I have a solution with 3 project in it all written in c# and I with LINQ. One project is the main web site, the other is the data layer (communication with the database) and the third one is a custom little CMS. The problem is the following: On a hosting provider when I publish the site it all works perfectly, but this site was needed to be hosted on the client server so I needed to do that. But the problem is that I also needed to configure the client server, because they don't have an Administrator employed (I know, I know ;) ). For the first time I some how managed, to set it up but a problem appear. My main web site is working just as it suppose to be - it reads (communicates with) the database, but My CMS is not. It shows the first log in page, but after that when I try to log in it throws the following error: A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.) Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.Data.SqlClient.SqlException: A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.) Source Error: An unhandled exception was generated during the execution of the current web request. Information regarding the origin and location of the exception can be identified using the exception stack trace below. Stack Trace: [SqlException (0x80131904): A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.)] System.Data.SqlClient.SqlInternalConnection.OnError(SqlException exception, Boolean breakConnection) +4846887 System.Data.SqlClient.TdsParser.ThrowExceptionAndWarning(TdsParserStateObject stateObj) +194 System.Data.SqlClient.TdsParser.Connect(ServerInfo serverInfo, SqlInternalConnectionTds connHandler, Boolean ignoreSniOpenTimeout, Int64 timerExpire, Boolean encrypt, Boolean trustServerCert, Boolean integratedSecurity, SqlConnection owningObject) +4860189 System.Data.SqlClient.SqlInternalConnectionTds.AttemptOneLogin(ServerInfo serverInfo, String newPassword, Boolean ignoreSniOpenTimeout, Int64 timerExpire, SqlConnection owningObject) +90 System.Data.SqlClient.SqlInternalConnectionTds.LoginNoFailover(String host, String newPassword, Boolean redirectedUserInstance, SqlConnection owningObject, SqlConnectionString connectionOptions, Int64 timerStart) +342 System.Data.SqlClient.SqlInternalConnectionTds.OpenLoginEnlist(SqlConnection owningObject, SqlConnectionString connectionOptions, String newPassword, Boolean redirectedUserInstance) +221 System.Data.SqlClient.SqlInternalConnectionTds..ctor(DbConnectionPoolIdentity identity, SqlConnectionString connectionOptions, Object providerInfo, String newPassword, SqlConnection owningObject, Boolean redirectedUserInstance) +189 System.Data.SqlClient.SqlConnectionFactory.CreateConnection(DbConnectionOptions options, Object poolGroupProviderInfo, DbConnectionPool pool, DbConnection owningConnection) +185 System.Data.ProviderBase.DbConnectionFactory.CreatePooledConnection(DbConnection owningConnection, DbConnectionPool pool, DbConnectionOptions options) +31 System.Data.ProviderBase.DbConnectionPool.CreateObject(DbConnection owningObject) +433 System.Data.ProviderBase.DbConnectionPool.UserCreateRequest(DbConnection owningObject) +66 System.Data.ProviderBase.DbConnectionPool.GetConnection(DbConnection owningObject) +499 System.Data.ProviderBase.DbConnectionFactory.GetConnection(DbConnection owningConnection) +65 System.Data.ProviderBase.DbConnectionClosed.OpenConnection(DbConnection outerConnection, DbConnectionFactory connectionFactory) +117 System.Data.SqlClient.SqlConnection.Open() +122 System.Data.Linq.SqlClient.SqlConnectionManager.UseConnection(IConnectionUser user) +44 System.Data.Linq.SqlClient.SqlProvider.get_IsSqlCe() +45 System.Data.Linq.SqlClient.SqlProvider.InitializeProviderMode() +20 System.Data.Linq.SqlClient.SqlProvider.System.Data.Linq.Provider.IProvider.Execute(Expression query) +57 System.Data.Linq.DataQuery`1.System.Linq.IQueryProvider.Execute(Expression expression) +23 System.Linq.Queryable.Count(IQueryable`1 source) +240 CMS.Security.UserProfile.LoginUser() in C:\Documents and Settings\Dimitar\Desktop\New Mepso Final 08_04\CMS\Classes\UserProfile.cs:132 CMS.Default.Login1_Authenticate(Object sender, AuthenticateEventArgs e) in C:\Documents and Settings\Dimitar\Desktop\New Mepso Final 08_04\CMS\Default.aspx.cs:37 System.Web.UI.WebControls.Login.OnAuthenticate(AuthenticateEventArgs e) +108 System.Web.UI.WebControls.Login.AttemptLogin() +115 System.Web.UI.WebControls.Login.OnBubbleEvent(Object source, EventArgs e) +101 System.Web.UI.Control.RaiseBubbleEvent(Object source, EventArgs args) +37 System.Web.UI.WebControls.Button.OnCommand(CommandEventArgs e) +118 System.Web.UI.WebControls.Button.RaisePostBackEvent(String eventArgument) +166 System.Web.UI.WebControls.Button.System.Web.UI.IPostBackEventHandler.RaisePostBackEvent(String eventArgument) +10 System.Web.UI.Page.RaisePostBackEvent(IPostBackEventHandler sourceControl, String eventArgument) +13 System.Web.UI.Page.RaisePostBackEvent(NameValueCollection postData) +36 System.Web.UI.Page.ProcessRequestMain(Boolean includeStagesBeforeAsyncPoint, Boolean includeStagesAfterAsyncPoint) +1565 Maybe this is a dumb question, but I cannot find the root of the problem, let alone the solution. So far I have tried the following: -setting time out on connection string to a higher value -configuration and after that turning off server firewall -checking the connection string over and over again (they are the same for all three projects and are saved in web.config) Important notes: I have tried executing the project from VS2008 with a connection string to the same database and the results are the same. That's why I think the problem is the SQL Server 2005 and not the IIS7. Any bit of information is more then welcomed.

    Read the article

  • Stuck with the first record while parsing an XML in Java

    - by Ritwik G
    I am parsing the following XML : <table ID="customer"> <T><C_CUSTKEY>1</C_CUSTKEY><C_NAME>Customer#000000001</C_NAME><C_ADDRESS>IVhzIApeRb ot,c,E</C_ADDRESS><C_NATIONKEY>15</C_NATIONKEY><C_PHONE>25-989-741-2988</C_PHONE><C_ACCTBAL>711.56</C_ACCTBAL><C_MKTSEGMENT>BUILDING</C_MKTSEGMENT><C_COMMENT>regular, regular platelets are fluffily according to the even attainments. blithely iron</C_COMMENT></T> <T><C_CUSTKEY>2</C_CUSTKEY><C_NAME>Customer#000000002</C_NAME><C_ADDRESS>XSTf4,NCwDVaWNe6tEgvwfmRchLXak</C_ADDRESS><C_NATIONKEY>13</C_NATIONKEY><C_PHONE>23-768-687-3665</C_PHONE><C_ACCTBAL>121.65</C_ACCTBAL><C_MKTSEGMENT>AUTOMOBILE</C_MKTSEGMENT><C_COMMENT>furiously special deposits solve slyly. furiously even foxes wake alongside of the furiously ironic ideas. pending</C_COMMENT></T> <T><C_CUSTKEY>3</C_CUSTKEY><C_NAME>Customer#000000003</C_NAME><C_ADDRESS>MG9kdTD2WBHm</C_ADDRESS><C_NATIONKEY>1</C_NATIONKEY><C_PHONE>11-719-748-3364</C_PHONE><C_ACCTBAL>7498.12</C_ACCTBAL><C_MKTSEGMENT>AUTOMOBILE</C_MKTSEGMENT><C_COMMENT>special packages wake. slyly reg</C_COMMENT></T> <T><C_CUSTKEY>4</C_CUSTKEY><C_NAME>Customer#000000004</C_NAME><C_ADDRESS>XxVSJsLAGtn</C_ADDRESS><C_NATIONKEY>4</C_NATIONKEY><C_PHONE>14-128-190-5944</C_PHONE><C_ACCTBAL>2866.83</C_ACCTBAL><C_MKTSEGMENT>MACHINERY</C_MKTSEGMENT><C_COMMENT>slyly final accounts sublate carefully. slyly ironic asymptotes nod across the quickly regular pack</C_COMMENT></T> <T><C_CUSTKEY>5</C_CUSTKEY><C_NAME>Customer#000000005</C_NAME><C_ADDRESS>KvpyuHCplrB84WgAiGV6sYpZq7Tj</C_ADDRESS><C_NATIONKEY>3</C_NATIONKEY><C_PHONE>13-750-942-6364</C_PHONE><C_ACCTBAL>794.47</C_ACCTBAL><C_MKTSEGMENT>HOUSEHOLD</C_MKTSEGMENT><C_COMMENT>blithely final instructions haggle; stealthy sauternes nod; carefully regu</C_COMMENT></T> </table> with the following java code: package xmlparserformining; import java.util.List; import java.util.Iterator; import org.dom4j.Document; import org.dom4j.DocumentException; import org.dom4j.Node; import org.dom4j.io.SAXReader; public class XmlParserForMining { public static Document getDocument( final String xmlFileName ) { Document document = null; SAXReader reader = new SAXReader(); try { document = reader.read( xmlFileName ); } catch (DocumentException e) { e.printStackTrace(); } return document; } public static void main(String[] args) { String xmlFileName = "/home/r/javaCodez/parsing in java/customer.xml"; String xPath = "//table/T/C_ADDRESS"; Document document = getDocument( xmlFileName ); List<Node> nodes = document.selectNodes( xPath ); System.out.println(nodes.size()); for (Node node : nodes) { String customer_address = node.valueOf(xPath); System.out.println( "Customer address: " + customer_address); } } } However, instead of getting all the various customer records, I am getting the following output: 1500 Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E Customer address: IVhzIApeRb ot,c,E and so on .. What is wrong here? Why is it printing only the first record ?

    Read the article

  • click buttons error

    - by sara
    I will retrieve student information (id -number- name) from a database (MySQL) as a list view, each student have 2 buttons (delete - alert ) and radio buttons Every thing is ok, but how can I make an onClickListener, for example for the delete button because I try lots of examples, I heard that I can use (custom list or get view or direct onClickListener as in my code (but it is not working ) or Simple Cursor Adapter) I do not know what to use, I looked around for examples that can help me, but in my case but I did not find any so I hope this be reference for anyone have the same problem. this is my code which I use direct onClick with Simple Adapter public class ManageSection extends ListActivity { //ProgresogressDialog pDialog; private ProgressDialog pDialog; // Creating JSON Parser object // Creating JSON Parser object JSONParser jParser = new JSONParser(); //class boolean x =true; Button delete; ArrayList<HashMap<String, String>> studentList; //url to get all products list private static String url_all_student = "http://10.0.2.2/SmsPhp/view_student_info.php"; String cl; // JSON Node names private static final String TAG_SUCCESS = "success"; private static final String TAG_student = "student"; private static final String TAG_StudentID = "StudentID"; private static final String TAG_StudentNo = "StudentNo"; private static final String TAG_FullName = "FullName"; private static final String TAG_Avatar="Avatar"; HashMap<String, String> selected_student; // course JSONArray JSONArray student = null; @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.manage_section); studentList = new ArrayList<HashMap<String, String>>(); ListView list1 = getListView(); list1.setAdapter(getListAdapter()); list1.setOnItemClickListener(new OnItemClickListener() { @Override public void onItemClick(AdapterView<?> adapterView, View view, int pos, long l) { selected_student =(HashMap<String, String>) studentList.get(pos); //member of your activity. delete =(Button)view.findViewById(R.id.DeleteStudent); cl=selected_student.get(TAG_StudentID); Toast.makeText(getBaseContext(),cl,Toast.LENGTH_LONG).show(); delete.setOnClickListener(new View.OnClickListener() { public void onClick(View v) { Log.d("id: ",cl); Toast.makeText(getBaseContext(),cl,Toast.LENGTH_LONG).show(); } }); } }); new LoadAllstudent().execute(); } /** * Background Async Task to Load all student by making HTTP Request * */ class LoadAllstudent extends AsyncTask<String, String, String> { /** * Before starting background thread Show Progress Dialog * */ @Override protected void onPreExecute() { super.onPreExecute(); pDialog = new ProgressDialog(ManageSection.this); pDialog.setMessage("Loading student. Please wait..."); pDialog.setIndeterminate(false); } /** * getting All student from u r l * */ @Override protected String doInBackground(String... args) { // Building Parameters List<NameValuePair> params = new ArrayList<NameValuePair>(); // getting JSON string from URL JSONObject json = jParser.makeHttpRequest(url_all_student, "GET", params); // Check your log cat for JSON response Log.d("All student : ", json.toString()); try { // Checking for SUCCESS TAG int success = json.getInt(TAG_SUCCESS); if (success == 1) { // student found // Getting Array of course student = json.getJSONArray(TAG_student); // looping through All courses for (int i = 0; i < student.length(); i++)//course JSONArray { JSONObject c = student.getJSONObject(i); // read first // Storing each json item in variable String StudentID = c.getString(TAG_StudentID); String StudentNo = c.getString(TAG_StudentNo); String FullName = c.getString(TAG_FullName); // String Avatar = c.getString(TAG_Avatar); // creating new HashMap HashMap<String, String> map = new HashMap<String, String>(); // adding each child node to HashMap key => value map.put(TAG_StudentID, StudentID); map.put(TAG_StudentNo, StudentNo); map.put(TAG_FullName, FullName); // adding HashList to ArrayList studentList.add(map); } } else { x=false; } } catch (JSONException e) { e.printStackTrace(); } return null; } /** * After completing background task Dismiss the progress dialog * **/ protected void onPostExecute(String file_url) { // dismiss the dialog after getting all products pDialog.dismiss(); if (x==false) Toast.makeText(getBaseContext(),"no student" ,Toast.LENGTH_LONG).show(); ListAdapter adapter = new SimpleAdapter( ManageSection.this, studentList, R.layout.list_student, new String[] { TAG_StudentID, TAG_StudentNo,TAG_FullName}, new int[] { R.id.StudentID, R.id.StudentNo,R.id.FullName}); setListAdapter(adapter); // Updating parsed JSON data into ListView } } } So what do you think, why doesn't the delete button work? There is no error in my log cat. What is the alternative way ?.. what should I do ?

    Read the article

  • c++ and c# speed compared

    - by Mack
    I was worried about C#'s speed when it deals with heavy calculations, when you need to use raw CPU power. I always thought that C++ is much faster than C# when it comes to calculations. So I did some quick tests. The first test computes prime numbers < an integer n, the second test computes some pandigital numbers. The idea for second test comes from here: Pandigital Numbers C# prime computation: using System; using System.Diagnostics; class Program { static int primes(int n) { uint i, j; int countprimes = 0; for (i = 1; i <= n; i++) { bool isprime = true; for (j = 2; j <= Math.Sqrt(i); j++) if ((i % j) == 0) { isprime = false; break; } if (isprime) countprimes++; } return countprimes; } static void Main(string[] args) { int n = int.Parse(Console.ReadLine()); Stopwatch sw = new Stopwatch(); sw.Start(); int res = primes(n); sw.Stop(); Console.WriteLine("I found {0} prime numbers between 0 and {1} in {2} msecs.", res, n, sw.ElapsedMilliseconds); Console.ReadKey(); } } C++ variant: #include <iostream> #include <ctime> int primes(unsigned long n) { unsigned long i, j; int countprimes = 0; for(i = 1; i <= n; i++) { int isprime = 1; for(j = 2; j < (i^(1/2)); j++) if(!(i%j)) { isprime = 0; break; } countprimes+= isprime; } return countprimes; } int main() { int n, res; cin>>n; unsigned int start = clock(); res = primes(n); int tprime = clock() - start; cout<<"\nI found "<<res<<" prime numbers between 1 and "<<n<<" in "<<tprime<<" msecs."; return 0; } When I ran the test trying to find primes < than 100,000, C# variant finished in 0.409 seconds and C++ variant in 5.553 seconds. When I ran them for 1,000,000 C# finished in 6.039 seconds and C++ in about 337 seconds. Pandigital test in C#: using System; using System.Diagnostics; class Program { static bool IsPandigital(int n) { int digits = 0; int count = 0; int tmp; for (; n > 0; n /= 10, ++count) { if ((tmp = digits) == (digits |= 1 << (n - ((n / 10) * 10) - 1))) return false; } return digits == (1 << count) - 1; } static void Main() { int pans = 0; Stopwatch sw = new Stopwatch(); sw.Start(); for (int i = 1; i <= 123456789; i++) { if (IsPandigital(i)) { pans++; } } sw.Stop(); Console.WriteLine("{0}pcs, {1}ms", pans, sw.ElapsedMilliseconds); Console.ReadKey(); } } Pandigital test in C++: #include <iostream> #include <ctime> using namespace std; int IsPandigital(int n) { int digits = 0; int count = 0; int tmp; for (; n > 0; n /= 10, ++count) { if ((tmp = digits) == (digits |= 1 << (n - ((n / 10) * 10) - 1))) return 0; } return digits == (1 << count) - 1; } int main() { int pans = 0; unsigned int start = clock(); for (int i = 1; i <= 123456789; i++) { if (IsPandigital(i)) { pans++; } } int ptime = clock() - start; cout<<"\nPans:"<<pans<<" time:"<<ptime; return 0; } C# variant runs in 29.906 seconds and C++ in about 36.298 seconds. I didn't touch any compiler switches and bot C# and C++ programs were compiled with debug options. Before I attempted to run the test I was worried that C# will lag well behind C++, but now it seems that there is a pretty big speed difference in C# favor. Can anybody explain this? C# is jitted and C++ is compiled native so it's normal that a C++ will be faster than a C# variant. Thanks for the answers!

    Read the article

  • How I can get output from 1st frame textfield input text to 2nd frame textArea

    - by soulgreen
    Here is my 1st frame - I want went I input text in textfield example name then click button report will display output to 2nd frame using textArea... please help me import java.awt.; import java.awt.event.; import javax.swing.; import javax.swing.border.; public class Order extends JFrame implements ActionListener { private JPanel pInfo,pN, pIC, pDate,Blank,pBlank, button, pTotal; private JLabel nameL,icL,DateL; private JTextField nameTF, icTF; private JFormattedTextField DateTF; private JButton calB,clearB,exitB,reportB; public Order() { Container contentPane = getContentPane(); contentPane.setLayout(new BorderLayout()); contentPane.setBackground(Color.gray); pInfo = new JPanel(); pN = new JPanel(); pIC = new JPanel(); pDate = new JPanel(); nameTF = new JTextField(30); icTF = new JTextField(30); DateTF = new JFormattedTextField(java.util.Calendar.getInstance().getTime()); DateTF.setEditable (false); DateTF.addActionListener(this); nameL = new JLabel(" NAME : ",SwingConstants.RIGHT); icL = new JLabel(" IC : ",SwingConstants.RIGHT); DateL = new JLabel(" DATE :",SwingConstants.RIGHT); pInfo.setLayout(new GridLayout(10,2,5,5)); pInfo.setBorder(BorderFactory.createTitledBorder (BorderFactory.createEtchedBorder(),"ORDER")); pN.add(nameL); pN.add(nameTF); pIC.add(icL); pIC.add(icTF); pDate.add(DateL); pDate.add(DateTF); pInfo.add(pN); pInfo.add(pIC); pInfo.add(pDate); pInfo.setBackground(Color.GRAY); pN.setBackground(Color.gray); pIC.setBackground(Color.gray); pDate.setBackground(Color.gray); nameL.setForeground(Color.black); icL.setForeground(Color.black); DateL.setForeground(Color.black); nameTF.setBackground(Color.pink); icTF.setBackground(Color.pink); DateTF.setBackground(Color.pink); contentPane.add(pInfo,BorderLayout.CENTER); Blank = new JPanel(); pBlank = new JPanel(); button = new JPanel(); calB = new JButton("CALCULATE"); calB.setToolTipText("Click to calculate"); clearB = new JButton("RESET"); clearB.setToolTipText("Click to clear"); reportB = new JButton ("REPORT"); reportB.setToolTipText ("Click to print"); exitB = new JButton("EXIT"); exitB.setToolTipText("Click to exit"); Blank.setLayout(new GridLayout(2,2)); Blank.setBorder(BorderFactory.createTitledBorder (BorderFactory.createEtchedBorder(),"")); button.setLayout(new GridLayout(1,4)); button.add(calB,BorderLayout.WEST); button.add(clearB,BorderLayout.CENTER); button.add(reportB,BorderLayout.CENTER); button.add(exitB,BorderLayout.EAST); Blank.add(pBlank); Blank.add(button); contentPane.add(Blank,BorderLayout.SOUTH); Blank.setBackground(Color.gray); pBlank.setBackground(Color.gray); calB.setForeground(Color.black); clearB.setForeground(Color.black); reportB.setForeground(Color.black); exitB.setForeground(Color.black); calB.setBackground(Color.pink); clearB.setBackground(Color.pink); reportB.setBackground(Color.pink); exitB.setBackground(Color.pink); calB.addActionListener(this); clearB.addActionListener(this); reportB.addActionListener(this); exitB.addActionListener(this); } public void actionPerformed(ActionEvent p) { if (p.getSource() == calB) { } else if (p.getSource() == clearB) { } else if (p.getSource () == reportB) { } else if (p.getSource() == exitB) { } } public static void main (String [] args) { Order frame = new Order(); frame.setTitle("Order"); frame.setSize(500,500); frame.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); frame.setResizable(false); frame.setVisible(true); frame.setLocationRelativeTo(null);//center the frame } }

    Read the article

  • Java Box Class: Unsolvable: aligning components to the left or right

    - by user323186
    I have been trying to left align buttons contained in a Box to the left, with no success. They align left alright, but for some reason dont shift all the way left as one would imagine. I attach the code below. Please try compiling it and see for yourself. Seems bizarre to me. Thanks, Eric import java.awt.Dimension; import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.io.BufferedReader; import java.io.File; import java.io.FileNotFoundException; import java.io.FileReader; import java.io.IOException; import javax.swing.Box; import javax.swing.BoxLayout; import javax.swing.JButton; import javax.swing.JFileChooser; import javax.swing.JFrame; import javax.swing.JMenu; import javax.swing.JMenuBar; import javax.swing.JMenuItem; import javax.swing.JScrollPane; import javax.swing.JTextArea; public class MainGUI extends Box implements ActionListener{ //Create GUI Components Box centerGUI=new Box(BoxLayout.X_AXIS); Box bottomGUI=new Box(BoxLayout.X_AXIS); //centerGUI subcomponents JTextArea left=new JTextArea(), right=new JTextArea(); JScrollPane leftScrollPane = new JScrollPane(left), rightScrollPane = new JScrollPane(right); //bottomGUI subcomponents JButton encrypt=new JButton("Encrypt"), decrypt=new JButton("Decrypt"), close=new JButton("Close"), info=new JButton("Info"); //Create Menubar components JMenuBar menubar=new JMenuBar(); JMenu fileMenu=new JMenu("File"); JMenuItem open=new JMenuItem("Open"), save=new JMenuItem("Save"), exit=new JMenuItem("Exit"); int returnVal =0; public MainGUI(){ super(BoxLayout.Y_AXIS); initCenterGUI(); initBottomGUI(); initFileMenu(); add(centerGUI); add(bottomGUI); addActionListeners(); } private void addActionListeners() { open.addActionListener(this); save.addActionListener(this); exit.addActionListener(this); encrypt.addActionListener(this); decrypt.addActionListener(this); close.addActionListener(this); info.addActionListener(this); } private void initFileMenu() { fileMenu.add(open); fileMenu.add(save); fileMenu.add(exit); menubar.add(fileMenu); } public void initCenterGUI(){ centerGUI.add(leftScrollPane); centerGUI.add(rightScrollPane); } public void initBottomGUI(){ bottomGUI.setAlignmentX(LEFT_ALIGNMENT); //setBorder(BorderFactory.createLineBorder(Color.BLACK)); bottomGUI.add(encrypt); bottomGUI.add(decrypt); bottomGUI.add(close); bottomGUI.add(info); } @Override public void actionPerformed(ActionEvent arg0) { // find source of the action Object source=arg0.getSource(); //if action is of such a type do the corresponding action if(source==close){ kill(); } else if(source==open){ //CHOOSE FILE File file1 =chooseFile(); String input1=readToString(file1); System.out.println(input1); left.setText(input1); } else if(source==decrypt){ //decrypt everything in Right Panel and output in left panel decrypt(); } else if(source==encrypt){ //encrypt everything in left panel and output in right panel encrypt(); } else if(source==info){ //show contents of info file in right panel doInfo(); } else { System.out.println("Error"); //throw new UnimplementedActionException(); } } private void doInfo() { // TODO Auto-generated method stub } private void encrypt() { // TODO Auto-generated method stub } private void decrypt() { // TODO Auto-generated method stub } private String readToString(File file) { FileReader fr = null; try { fr = new FileReader(file); } catch (FileNotFoundException e1) { e1.printStackTrace(); } BufferedReader br=new BufferedReader(fr); String line = null; try { line = br.readLine(); } catch (IOException e) { e.printStackTrace(); } String input=""; while(line!=null){ input=input+"\n"+line; try { line=br.readLine(); } catch (IOException e) { e.printStackTrace(); } } return input; } private File chooseFile() { //Create a file chooser final JFileChooser fc = new JFileChooser(); returnVal = fc.showOpenDialog(fc); return fc.getSelectedFile(); } private void kill() { System.exit(0); } public static void main(String[] args) { // TODO Auto-generated method stub MainGUI test=new MainGUI(); JFrame f=new JFrame("Tester"); f.setDefaultCloseOperation(JFrame.EXIT_ON_CLOSE); f.setJMenuBar(test.menubar); f.setPreferredSize(new Dimension(600,400)); //f.setUndecorated(true); f.add(test); f.pack(); f.setVisible(true); } }

    Read the article

  • Server Error in '/' Application (ASP.NET)

    - by baeltazor
    Hi All I just setup up member ship roles and registration on my website with visual web developer using the tutorial on msdn. It works perfectly locally, but when i uploaded it to my server, I get the following page: "Server Error in '/' Application. -------------------------------------------------------------------------------- Configuration Error Description: An error occurred during the processing of a configuration file required to service this request. Please review the specific error details below and modify your configuration file appropriately. Parser Error Message: The connection name 'LocalSqlServer' was not found in the applications configuration or the connection string is empty. Source Error: [No relevant source lines] Source File: machine.config Line: 160 -------------------------------------------------------------------------------- Version Information: Microsoft .NET Framework Version:2.0.50727.4200; ASP.NET Version:2.0.50727.4016 " Does anybody know why I'm seeing this and how I may go about fixinf this? Any help is greatly appreciated. Thank you Bael. EDIT: I have just looked at my web.config file after reading the following line in the error message: "The connection name 'LocalSqlServer' was not found in the applications configuration or the connection string is empty." ... And have noticed that the following element is completely empty: <connectionStrings/> // Is this one supposed to be empty? if not what should go here? In the error it implies it shouldn't be empty. Also, I don't know where I should place LocalSqlServer LATEST EDIT After changing DataSource to LocalHost i get the following error: Server Error in '/JTS' Application. -------------------------------------------------------------------------------- A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: Named Pipes Provider, error: 40 - Could not open a connection to SQL Server) Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.Data.SqlClient.SqlException: A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: Named Pipes Provider, error: 40 - Could not open a connection to SQL Server) Source Error: An unhandled exception was generated during the execution of the current web request. Information regarding the origin and location of the exception can be identified using the exception stack trace below. Stack Trace: [SqlException (0x80131904): A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: Named Pipes Provider, error: 40 - Could not open a connection to SQL Server)] System.Data.SqlClient.SqlInternalConnection.OnError(SqlException exception, Boolean breakConnection) +4849015 System.Data.SqlClient.TdsParser.ThrowExceptionAndWarning(TdsParserStateObject stateObj) +194 System.Data.SqlClient.TdsParser.Connect(ServerInfo serverInfo, SqlInternalConnectionTds connHandler, Boolean ignoreSniOpenTimeout, Int64 timerExpire, Boolean encrypt, Boolean trustServerCert, Boolean integratedSecurity, SqlConnection owningObject) +4862333 System.Data.SqlClient.SqlInternalConnectionTds.AttemptOneLogin(ServerInfo serverInfo, String newPassword, Boolean ignoreSniOpenTimeout, Int64 timerExpire, SqlConnection owningObject) +90 System.Data.SqlClient.SqlInternalConnectionTds.LoginNoFailover(String host, String newPassword, Boolean redirectedUserInstance, SqlConnection owningObject, SqlConnectionString connectionOptions, Int64 timerStart) +342 System.Data.SqlClient.SqlInternalConnectionTds.OpenLoginEnlist(SqlConnection owningObject, SqlConnectionString connectionOptions, String newPassword, Boolean redirectedUserInstance) +221 System.Data.SqlClient.SqlInternalConnectionTds..ctor(DbConnectionPoolIdentity identity, SqlConnectionString connectionOptions, Object providerInfo, String newPassword, SqlConnection owningObject, Boolean redirectedUserInstance) +189 System.Data.SqlClient.SqlConnectionFactory.CreateConnection(DbConnectionOptions options, Object poolGroupProviderInfo, DbConnectionPool pool, DbConnection owningConnection) +185 System.Data.ProviderBase.DbConnectionFactory.CreatePooledConnection(DbConnection owningConnection, DbConnectionPool pool, DbConnectionOptions options) +31 System.Data.ProviderBase.DbConnectionPool.CreateObject(DbConnection owningObject) +433 System.Data.ProviderBase.DbConnectionPool.UserCreateRequest(DbConnection owningObject) +66 System.Data.ProviderBase.DbConnectionPool.GetConnection(DbConnection owningObject) +499 System.Data.ProviderBase.DbConnectionFactory.GetConnection(DbConnection owningConnection) +65 System.Data.ProviderBase.DbConnectionClosed.OpenConnection(DbConnection outerConnection, DbConnectionFactory connectionFactory) +117 System.Data.SqlClient.SqlConnection.Open() +122 System.Web.DataAccess.SqlConnectionHolder.Open(HttpContext context, Boolean revertImpersonate) +87 System.Web.DataAccess.SqlConnectionHelper.GetConnection(String connectionString, Boolean revertImpersonation) +221 System.Web.Security.SqlMembershipProvider.GetPasswordWithFormat(String username, Boolean updateLastLoginActivityDate, Int32& status, String& password, Int32& passwordFormat, String& passwordSalt, Int32& failedPasswordAttemptCount, Int32& failedPasswordAnswerAttemptCount, Boolean& isApproved, DateTime& lastLoginDate, DateTime& lastActivityDate) +815 System.Web.Security.SqlMembershipProvider.CheckPassword(String username, String password, Boolean updateLastLoginActivityDate, Boolean failIfNotApproved, String& salt, Int32& passwordFormat) +105 System.Web.Security.SqlMembershipProvider.CheckPassword(String username, String password, Boolean updateLastLoginActivityDate, Boolean failIfNotApproved) +42 System.Web.Security.SqlMembershipProvider.ValidateUser(String username, String password) +78 System.Web.UI.WebControls.Login.AuthenticateUsingMembershipProvider(AuthenticateEventArgs e) +60 System.Web.UI.WebControls.Login.OnAuthenticate(AuthenticateEventArgs e) +119 System.Web.UI.WebControls.Login.AttemptLogin() +115 System.Web.UI.WebControls.Login.OnBubbleEvent(Object source, EventArgs e) +101 System.Web.UI.Control.RaiseBubbleEvent(Object source, EventArgs args) +37 System.Web.UI.WebControls.Button.OnCommand(CommandEventArgs e) +118 System.Web.UI.WebControls.Button.RaisePostBackEvent(String eventArgument) +166 System.Web.UI.WebControls.Button.System.Web.UI.IPostBackEventHandler.RaisePostBackEvent(String eventArgument) +10 System.Web.UI.Page.RaisePostBackEvent(IPostBackEventHandler sourceControl, String eventArgument) +13 System.Web.UI.Page.RaisePostBackEvent(NameValueCollection postData) +36 System.Web.UI.Page.ProcessRequestMain(Boolean includeStagesBeforeAsyncPoint, Boolean includeStagesAfterAsyncPoint) +1565 -------------------------------------------------------------------------------- Version Information: Microsoft .NET Framework Version:2.0.50727.4927; ASP.NET Version:2.0.50727.4927

    Read the article

  • Https in java ends up with strange results

    - by Senne
    I'm trying to illustrate to students how https is used in java. But i have the feeling my example is not really the best out there... The code works well on my windows 7: I start the server, go to https://localhost:8080/somefile.txt and i get asked to trust the certificate, and all goes well. When I try over http (before or after accepting the certificate) I just get a blank page, which is ok for me. BUT when I try the exact same thing on my windows XP: Same thing, all goes well. But then (after accepting the certificate first), I'm also able to get all the the files through http! (if I first try http before https followed by accepting the certificate, I get no answer..) I tried refreshing, hard refreshing a million times but this should not be working, right? Is there something wrong in my code? I'm not sure if I use the right approach to implement https here... package Security; import java.io.*; import java.net.*; import java.util.*; import java.util.concurrent.Executors; import java.security.*; import javax.net.ssl.*; import com.sun.net.httpserver.*; public class HTTPSServer { public static void main(String[] args) throws IOException { InetSocketAddress addr = new InetSocketAddress(8080); HttpsServer server = HttpsServer.create(addr, 0); try { System.out.println("\nInitializing context ...\n"); KeyStore ks = KeyStore.getInstance("JKS"); char[] password = "vwpolo".toCharArray(); ks.load(new FileInputStream("myKeys"), password); KeyManagerFactory kmf = KeyManagerFactory.getInstance("SunX509"); kmf.init(ks, password); SSLContext sslContext = SSLContext.getInstance("TLS"); sslContext.init(kmf.getKeyManagers(), null, null); // a HTTPS server must have a configurator for the SSL connections. server.setHttpsConfigurator (new HttpsConfigurator(sslContext) { // override configure to change default configuration. public void configure (HttpsParameters params) { try { // get SSL context for this configurator SSLContext c = getSSLContext(); // get the default settings for this SSL context SSLParameters sslparams = c.getDefaultSSLParameters(); // set parameters for the HTTPS connection. params.setNeedClientAuth(true); params.setSSLParameters(sslparams); System.out.println("SSL context created ...\n"); } catch(Exception e2) { System.out.println("Invalid parameter ...\n"); e2.printStackTrace(); } } }); } catch(Exception e1) { e1.printStackTrace(); } server.createContext("/", new MyHandler1()); server.setExecutor(Executors.newCachedThreadPool()); server.start(); System.out.println("Server is listening on port 8080 ...\n"); } } class MyHandler implements HttpHandler { public void handle(HttpExchange exchange) throws IOException { String requestMethod = exchange.getRequestMethod(); if (requestMethod.equalsIgnoreCase("GET")) { Headers responseHeaders = exchange.getResponseHeaders(); responseHeaders.set("Content-Type", "text/plain"); exchange.sendResponseHeaders(200, 0); OutputStream responseBody = exchange.getResponseBody(); String response = "HTTP headers included in your request:\n\n"; responseBody.write(response.getBytes()); Headers requestHeaders = exchange.getRequestHeaders(); Set<String> keySet = requestHeaders.keySet(); Iterator<String> iter = keySet.iterator(); while (iter.hasNext()) { String key = iter.next(); List values = requestHeaders.get(key); response = key + " = " + values.toString() + "\n"; responseBody.write(response.getBytes()); System.out.print(response); } response = "\nHTTP request body: "; responseBody.write(response.getBytes()); InputStream requestBody = exchange.getRequestBody(); byte[] buffer = new byte[256]; if(requestBody.read(buffer) > 0) { responseBody.write(buffer); } else { responseBody.write("empty.".getBytes()); } URI requestURI = exchange.getRequestURI(); String file = requestURI.getPath().substring(1); response = "\n\nFile requested = " + file + "\n\n"; responseBody.write(response.getBytes()); responseBody.flush(); System.out.print(response); Scanner source = new Scanner(new File(file)); String text; while (source.hasNext()) { text = source.nextLine() + "\n"; responseBody.write(text.getBytes()); } source.close(); responseBody.close(); exchange.close(); } } }

    Read the article

< Previous Page | 141 142 143 144 145 146 147 148 149 150 151  | Next Page >