Search Results

Search found 5101 results on 205 pages for 'expression trees'.

Page 149/205 | < Previous Page | 145 146 147 148 149 150 151 152 153 154 155 156  | Next Page >

• the problem about different treatment to __VA_ARGS__ when using VS 2008 and GCC

  - by liuliu

  I am trying to identify a problem because of an unusual usage of variadic macros. Here is the hypothetic macro: #define va(c, d, ...) c(d, __VA_ARGS__) #define var(a, b, ...) va(__VA_ARGS__, a, b) var(2, 3, printf, “%d %d %d\n”, 1); For gcc, the preprocessor will output printf("%d %d %d\n", 1, 2, 3) but for VS 2008, the output is printf, “%d %d %d\n”, 1(2, 3); I suspect the difference is caused by the different treatment to VA_ARGS, for gcc, it will first expand the expression to va(printf, "%d %d %d\n", 1, 2, 3), and treat 1, 2, 3 as the VA_ARGS for macro va. But for VS 2008, it will first treat b as VA_ARGS for macro va, and then do the expansion. Which one is correct interpretation for C99 variadic macro? or my usage falls into an undefined behavior?

  Read the article

• ngModel and component with isolated scope

  - by Artem Andreev

  I am creating simple ui-datetime directive. It splits javascript Date object into _date, _hours and _minutes parts. _date uses jquery ui datepicker, _hours and _minutes - number inputs. See example: http://jsfiddle.net/andreev_artem/nWsZp/3/ On github: https://github.com/andreev-artem/angular_experiments/tree/master/ui-datetime As far as I understand - best practice when you create a new component is to use isolated scope. When I tried to use isolated scope - nothing works. ngModel.$viewValue === undefined. When I tried to use new scope (my example, not so good variant imho) - ngModel uses value on newly created scope. Of course I can create directive with isolated scope and work with ngModel value through "=expression" (example). But I think that working with ngModelController is a better practice. My questions: Can I use ngModelController with isolated scope? If it is not possible which solution is better for creating such component?

  Read the article

• Numbering Regex Submatches

  - by gentlylisped

  Is there a canonical ordering of submatch expressions in a regular expression? For example: What is the order of the submatches in "(([0-9]{3}).([0-9]{3}).([0-9]{3}).([0-9]{3}))\s+([A-Z]+)" ? a. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([A-Z]+) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) b. (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3}))\s+([A-Z]+) (([0-9]{3})\.([0-9]{3})\.([0-9]{3})\.([0-9]{3})) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([0-9]{3}) ([A-Z]+) or c. somthin' else.

  Read the article

• Mixed Table Type with other types as parameters to Stored Procedured c#

  - by amemak

  Hi, I am asking about how could i pass multi parameters to a stored procedure, one of these parameters is user defined table. When I tried to do it it shows this error: INSERT INTO BD (ID, VALUE, BID) values( (SELECT t1.ID, t1.Value FROM @Table AS t1),someintvalue) here @Table is the user defined table parameter. Msg 116, Level 16, State 1, Procedure UpdateBD, Line 12 Only one expression can be specified in the select list when the subquery is not introduced with EXISTS. Msg 109, Level 15, State 1, Procedure UpdateBD, Line 11 There are more columns in the INSERT statement than values specified in the VALUES clause. The number of values in the VALUES clause must match the number of columns specified in the INSERT statement. Thank you

  Read the article

• Is it possible to create thread-safe collections without locks?

  - by Andrey

  This is pure just for interest question, any sort of questions are welcome. So is it possible to create thread-safe collections without any locks? By locks I mean any thread synchronization mechanisms, including Mutex, Semaphore, and even Interlocked, all of them. Is it possible at user level, without calling system functions? Ok, may be implementation is not effective, i am interested in theoretical possibility. If not what is the minimum means to do it? EDIT: Why immutable collections don't work. This of class Stack with methods Add that returns another Stack. Now here is program: Stack stack = new ...; ThreadedMethod() { loop { //Do the loop stack = stack.Add(element); } } this expression stack = stack.Add(element) is not atomic, and you can overwrite new stack from other thread. Thanks, Andrey

  Read the article

• Catch $.getJSON error

  - by Switz

  I've been trying to figure this out for hours. I have a DYNAMIC youtube search, which I use Youtube's JSON api for. It works usually, but there are times that it won't find anything. Is there a way to figure out if it finds nothing, and then end the function because otherwise it stops the entire code. I tried jsonp, but that didn't seem to be correct. Somewhere I read that error catching is built into the newest jQuery getJSON, but I couldn't find it. The code is really tedious so I'd rather not post it unless it comes to that. I'd appreciate any help! Thanks guys. error showing that json didn't return anything jquery-1.4.4.min.js:32 TypeError: Result of expression 'j' [undefined] is not an object.

  Read the article

• Is it possible to use DLR in a .NET 3.5 website project?

  - by Aplato

  I'm trying to evaluate an expression stored in a database i.e. "if (Q1 ==2) {result = 3.1;} elseif (Q1 ==3){result=4.1;} else result = 5.9;" Rather than parsing it myself I'm trying to use the DLR. I'm using version .92 from the Codeplex repository and my solution is a .NET 3.5 website; and I'm having conflicts between the System.Core and Microsoft.Scripting.ExtenstionAttribute .dll's. Error = { Description: "'ExtensionAttribute' is ambiguous in the namespace 'System.Runtime.CompilerServices'.", File: "InternalXmlHelper.vb" } At this time I cannot upgrade to .NET 4.0 and make significant use of the .net 3.5 features (so downgrading is not an option). Any help greatly appreciated.

  Read the article

• Can't enumerate LinQ results with left join

  - by nvtthang

  var itemSet = from item in da.GetList<Models.account>() join file in objFileStorageList on item.account_id equals file.parent_id into objFile from fileItem in objFile.DefaultIfEmpty() where item.company != null && item.company.company_id == 123 orderby item.updatedDate descending select new { Id = item.account_id, RefNo = item.refNo, StartDate = item.StartDate , EndDate = item.EndDate , Comment = item.comment, FileStorageID = fileItem != null ? fileItem.fileStorage_id : -1, Identification = fileItem != null ? fileItem.identifier : null, fileName = fileItem != null ? fileItem.file_nm : null }; It raises error message when I try to enumerate through collection result from Linq query above. LINQ to Entities does not recognize the method 'System.Collections.Generic.IEnumerable1[SCEFramework.Models.fileStorage] DefaultIfEmpty[fileStorage](System.Collections.Generic.IEnumerable1[SCEFramework.Models.fileStorage])' method, and this method cannot be translated into a store expression foreach (var item in itemSet) { string itemRef= item.RefNo; } Please suggest me any solutions. Thanks in advance.

  Read the article

• Javascript substrings multiline replace by RegExp

  - by Radek Šimko

  Hi, I'm having some troubles with matching a regular expression in multi-line string. <script> var str="Welcome to Google!\n"; str = str + "We are proud to announce that Microsoft has \n"; str = str + "one of the worst Web Developers sites in the world."; document.write(str.replace(/.*(microsoft).*/gmi, "$1")); </script> http://jsbin.com/osoli3/3/edit As you may see on the link above, the output of the code looks like this: Welcome to Google! Microsoft one of the worst Web Developers sites in the world. Which means, that the replace() method goes line by line and if there's no match in that line, it returns just the whole line... Even if it has the "m" (multiline) modifier...

  Read the article

• gdb: SIGTRAP on std::string::c_str() call

  - by sheepsimulator

  So I've been trying to use gdb to return the value of a string I have by calling > print <member variable name>.c_str() But everytime I do so, I get this: Program received signal SIGTRAP, Trace/breakpoint trap. <some address> in std::string::c_str() from /usr/lib/libstdc++.so.6 GDB remains in the frame where the signal was received. To change this behavior use "set unwindonsignal on" Evaluation of the expression containing the function (std::string::c_str() const) will be abandoned. Two questions: Why/how is the standard library throwing SIGTRAP? I checked basic_string.h and c_str() is defined as: const _CharT* c_str() const { return _M_data(); } I don't see any SIGTRAP-throwing here... is there a way to get around this SIGTRAP? How can I read the text value of the std::string out (without getting some crazy extension library) in gdb?

  Read the article

• Error: A SQLParamenter wtih ParameterName @myparm is not contained by this SQLParameter Collection

  - by SidC

  Good Morning, I'm working on an ASP.NET 3.5 webforms application and have written the following code: Protected Sub btnSubmit_Click(ByVal sender As Object, ByVal e As System.EventArgs) Handles btnSubmit.Click Dim connectionString As String = WebConfigurationManager.ConnectionStrings("Diel_inventoryConnectionString").ConnectionString Dim con As New SqlConnection(connectionString) Dim adapter1 As New SqlDataAdapter adapter1.SelectCommand = New SqlCommand adapter1.SelectCommand.CommandType = CommandType.StoredProcedure adapter1.SelectCommand.CommandText = "PartSproc" Dim parmNSN As New SqlParameter("@NSN", SqlDbType.NVarChar) Dim parmName As New SqlParameter("@PartName", SqlDbType.NVarChar) txtNSN.Text = adapter1.SelectCommand.Parameters("@NSN").Value txtSearch.Text = adapter1.SelectCommand.Parameters("@PartName").Value Dim dt As New DataTable() adapter1.Fill(dt) MySearch.DataSource = dt MySearch.DataBind() End Sub When I run the page, I receive the error A SQLParameter with @NSN is not contained by this SQLParameter Collection. I tried using apostrophes around the @NSN and @PartName but that does not work either and presents expression expected error. How might I rectify the above code so that it references the @NSN and @PartName parameters correctly? Thanks, Sid

  Read the article

• F# - This code isn't compiling for me

  - by stacker

  This code isn't compiling for me: let countDown = [5L .. -1L .. 0L];; I have a book that says it should return this: val countDown : int list = [5L; 4L; 3L; 2L; 1L; 0L] Compiler Error: Program.fs(42,24): error FS0010: Unexpected character '-' in expression > > let countDown = [5L .. -1L .. 0L];; let countDown = [5L .. -1L .. 0L];; -----------------------^

  Read the article

• asp.net databinding string is passed to function but runtime occurs

  - by rod

  Hi All, I'm using a code-behind function (called TestFx) in my binding expression. I'm passing a string and the function accepts a string but I still get a runtime error saying invalid args. But if I change the method to accept an object and inspect the value, "it's a string!" Can someone please explain? -rod ProductDescription: <asp:Label ID="ProductDescriptionLabel" runat="server" Text='<%# TestFx(Eval("ProductDescription")) %>' /> <br />

  Read the article

• Do I need to include the 'this' when using a property name in a closure?

  - by Scott Whitlock

  I'm using a list of Actions to store an undo history for an object. Let's say I have a property of my object called myChildObject and it's being changed, so I want to store the undo action where I would set it back to it's current value: public class Class1 { public Class1() { } private readonly List<Action> m_undoActions = new List<Action>(); private SomeObject myChildObject { get; set; } public void ChangeState(SomeObject newChildObject) { // copies the reference SomeObject existingObject = myChildObject; m_undoActions.Add(() => myChildObject = existingObject); myChildObject = newChildObject; } } Looking at the lambda expression, existingObject is a local variable, so it's using a closure to pass a reference to that variable, but what about the property myChildObject? Do I need to use 'this' to preface it? Do I need to make a copy of the 'this' reference to a local variable first? Thanks for helping me understand this closure stuff.

  Read the article

• Tentative date casting in tsql

  - by Tewr

  I am looking for something like TRYCAST in TSQL or an equivalent method / hack. In my case I am extracting some date data from an xml column. The following query throws "Arithmetic overflow error converting expression to data type datetime." if the piece of data found in the xml cannot be converted to datetime (in this specific case, the date is "0001-01-01" in some cases). Is there a way to detect this exception before it occurs? select [CustomerInfo].value('(//*:InceptionDate/text())[1]', 'datetime') FROM Customers An example of what I am trying to achieve in pseudocode with an imagined tsql function TRYCAST(expr, totype, defaultvalue): select TRYCAST( [CustomerInfo].value('(//*:InceptionDate/text())[1]', 'nvarchar(100)'), datetime, null) FROM Customers

  Read the article

• Delphi component or library to display mathematical expressions

  - by Svein Bringsli

  I'm looking for a simple component that displays mathematical expressions in Delphi. When I started out I thought it would be easy to find something on the net, but it turns out it was harder than anticipated. There are lots and lots of components that will parse mathematical expressions, but few (none?) that will display them. Ideally I would like a component as simple as a TLabel, where I could set the caption to some expression and it would be displayed correctly, but some sort of library that let's me draw expressions to a canvas would also be sufficient for my needs. Update: I'm not talking about plotting graphs of functions or something like that. I want to display (for instance) (X^2+3)/X like this:

  Read the article

• Parse a text file into multiple text file

  - by Vijay Kumar Singh

  I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

  Read the article

• Cache Wrapper with expressions

  - by Fujiy

  I dont know if is possible. I want a class to encapsulate all Cache of my site. I thinking about the best way to do this to avoid conflict with keys. My first idea is something like this: public static TResult Cachear<TResult>(this Cache cache, Expression<Func<TResult>> funcao) { string chave = funcao.ToString(); if (!(cache[chave] is TResult)) { cache[chave] = funcao.Compile()(); } return (TResult)cache[chave]; } Is the best way? Ty

  Read the article

• JavaScript lazy regex for matching HTML tags

  - by Grnbeagle

  Hi, I'm having a problem writing a regular expression for matching HTML tags. I found a similar entry here, but this didn't quite work in my case. Here's my test string: <div id="div0" class="myclass">here's some text that may include whitespace</div><div id="div1" class="myclass"> and some more here </div> And here's my regex based on the aforementioned entry: <div[^>]*class="myclass">[^~]*?<\/div> Note that I need to match the first instance of <div /> with class of "myclass." The content may have carriage returns. These <div> tags won't be nested. Here's a rubular page for testing: http://rubular.com/r/vlfcikKMXk

  Read the article

• Why won't this SQL CAST work?

  - by Kev

  I have a nvarchar(50) column in a SQL Server 2000 table defined as follows: TaskID nvarchar(50) NULL I need to fill this column with some random SQL Unique Identifiers (I am unable to change the column type to uniqueidentifier). I tried this: UPDATE TaskData SET TaskID = CAST(NEWID() AS nvarchar) but I got the following error: Msg 8115, Level 16, State 2, Line 1 Arithmetic overflow error converting expression to data type nvarchar. I also tried: UPDATE TaskData SET TaskID = CAST(NEWID() AS nvarchar(50)) but then got this error: Msg 8152, Level 16, State 6, Line 1 String or binary data would be truncated. I don't understand why this doesn't work but this does: DECLARE @TaskID nvarchar(50) SET @TaskID = CAST(NEW() AS nvarchar(50)) I also tried CONVERT(nvarchar, NEWID()) and CONVERT(nvarchar(50), NEWID()) but got the same errors.

  Read the article

• Capturing the contents of <select>

  - by joey mueller

  I'm trying to use a regular expression to capture the contents of all option values inside an HTML select element For example, in: <select name="test"> <option value="blah">one</option> <option value="mehh">two</option> <option value="rawr">three</option> </select> I'd like to capture one two and three into an array. My current code is var pages = responseDetails.responseText.match(/<select name="page" .+?>(?:\s*<option .+?>([^<]+)<\/option>)+\s*<\/select>/); for (var c = 0; c<pages.length; c++) { alert(pages[c]); } But it only captures the last value, in this case, "three". How can I modify this to capture all of them? Thanks!

  Read the article

• Criteria hibernate

  - by apb

  my code session.createCriteria(Input.class); DateFormat format = new SimpleDateFormat("yyyy-MM-dd hh:mm:ss"); Date startDate = (Date)format.parse("2005-01-01 00:00:00"); Date endDate = (Date)format.parse("2005-03-03 00:00:00"); crit.add(Expression.between ("inputDate", new Date(startDate.getTime()), new Date(endDate.getTime()))); This code return a list, but there is no element present in it. i think it doesn't match the condition. Anybody help.

  Read the article

• How to Redirect Subdomains to Other Domain

  - by Codex73

  What I'm trying to accomplish with htaccess mod-rewrite: Redirect all sub-domains to new domain name w rewrite rule. e.g. test1.olddomain.com === test1.newdomain.com test2.olddomain.com === test2.newdomain.com test3.olddomain.com === test3.newdomain.com This is what I have so far which of course is wrong: Options +FollowSymLinks RewriteEngine on RewriteCond %{HTTP_HOST} ^olddomain\.com$ [NC] RewriteRule ^(.*)$ http://www.newdomain.com/$1 [R=301,L] RewriteCond %{HTTP_HOST} ^www\.olddomain\.com$ [NC] RewriteRule ^(.*) http://www.newdomain.com/$1 [R=301,L] RewriteRule [a-zA-Z]+\.olddomain.com$ http://$1.newdomain.com/ [R=301,L] Since I'm not a Regular Expression junkie just yet, I need your help... Thanks for any help you can give here. I know also we can compile these first two conditions into one. Note: The reason I don't redirect all domain using DNS is that a lot of directories need special rewrite rules in order to maintain positions on SEO.

  Read the article

• LINQ query needs either ascending or descending in the same query

  - by Sir Psycho

  Is there anyway this code can be refactored? The only difference is the order by part. Idealy I'd like to use a delegate/lamda expression so the code is reusable but I don't know how to conditionally add and remove the query operators OrderBy and OrderByDescending var linq = new NorthwindDataContext(); var query1 = linq.Customers .Where(c => c.ContactName.StartsWith("a")) .SelectMany(cus=>cus.Orders) .OrderBy(ord => ord.OrderDate) .Select(ord => ord.CustomerID); var query2 = linq.Customers .Where(c => c.ContactName.StartsWith("a")) .SelectMany(cus => cus.Orders) .OrderByDescending(ord => ord.OrderDate) .Select(ord => ord.CustomerID);

  Read the article

• Double pointer const-correctness warnings in C

  - by Michael Koval

  You can obviously cast a pointer to non-const data to a a pointer of the same type to const data: int *x = NULL; int const *y = x; Adding additional const qualifiers to match the additional indirection should logically work the same way: int * *x = NULL; int *const *y = x; /* okay */ int const *const *z = y; /* warning */ Compiling this with GCC or Clang with the -Wall flag, however, results in the following warning: test.c:4:23: warning: initializing 'int const *const *' with an expression of type 'int *const *' discards qualifiers in nested pointer types int const *const *z = y; /* warning */ ^ ~ Why does adding an additional const qualifier "discard qualifiers in nested pointer types"?

  Read the article

< Previous Page | 145 146 147 148 149 150 151 152 153 154 155 156  | Next Page >