Search Results

Search found 3838 results on 154 pages for 'throws'.

Page 151/154 | < Previous Page | 147 148 149 150 151 152 153 154  | Next Page >

  • PHP + Code Igniter Timecode Calculation Logic Error

    - by Tim
    Hello everyone, I have what I suspect to be a logic problem with an algorithm I am using to work with Video timecode in PHP. All help is appreciated. The Objective Well basically I want to work with timecode and perform calculations For those not familiar with timecode it looks like this 01:10:58:12 or HH:MM:SS:FF 'AKA' HOURS:MINUTES:SECONDS:FRAMES I have used the script from HERE to help me with working with this format. The Problem Now can i just say that this script works!!! Timecode calculations (in this case additions) are being performed correctly. However this script continually throws the following errors, yet still produces the correct output when I try and do the following calculation 00:01:26:00 + 00:02:00:12 The errors from this calculation are shown below A PHP Error was encountered Severity: Notice Message: Undefined index: key Filename: staff/tools.php Line Number: 169 A PHP Error was encountered Severity: Notice Message: Undefined index: key Filename: staff/tools.php Line Number: 169 Line Number 169 is in the parseInput() function // feed it into the tc array $i=0; foreach ($tc AS $key=>$value) { if ( is_numeric($array["$i"]) ) { $tc["$key"]= $array["$i"]; if ($tc["$key"] < 10 && $tc["$key"] > 0 && strlen($tc['key'])==1 ) $tc["$key"]= "0".$tc["$key"]; } $i++; } return $tc; Now I should also mention that the number of times the above error is thrown depends on what I am calculating 00:00:00:00 + 00:00:00:00 returns no errors. 01:01:01:01 + 02:02:02:02 produces 8 of the above errors. For your reference, here is the code in it's entirety function add_cue_sheet_clips_process() { $sheetID = $_POST['sheet_id']; $clipName = $_POST['clip_name']; $tcIn = $_POST['tc_in']; $tcOut = $_POST['tc_out']; // string $input // returns an associative array of hours, minutes, seconds, and frames // function parseInput ($input) { // timecode should look something like hh:mm:ss;ff // allowed separators are : ; . , // values may be single or double digits // hours are least-significant -- 5.4 == 00:00:05;04 $tc= array("frames"=>"00", "seconds"=>"00", "minutes"=>"00", "hours"=>"00"); $punct= array(":", ";", ".", ","); // too big? too small? $input= trim($input); if (strlen($input)>11 || $input=="") { // invalid input, too long -- bzzt return $tc; } // normalize punctuation $input= str_replace( $punct, ":", $input); // blow it up and reverse it so frames come first $array= explode(":", $input); $array= array_reverse($array); // feed it into the tc array $i=0; foreach ($tc AS $key=>$value) { if ( is_numeric($array["$i"]) ) { $tc["$key"]= $array["$i"]; if ($tc["$key"] < 10 && $tc["$key"] > 0 && strlen($tc['key'])==1 ) $tc["$key"]= "0".$tc["$key"]; } $i++; } return $tc; } // array $tc // returns a float number of seconds // function tcToSec($tc) { $wholeseconds= ($tc['hours']*3600) + ($tc['minutes'] * 60) + ($tc['seconds']); $partseconds= ( $tc['frames'] / 25 ); $seconds= $wholeseconds + $partseconds; return $seconds; } // float $seconds // bool $subtract // returns a timecode array // function secToTc ($seconds=0, $subtract=0) { $tc= array("frames"=>"00", "seconds"=>"00", "minutes"=>"00", "hours"=>"00"); $partseconds= fmod($seconds, 1); $wholeseconds= $seconds - $partseconds; // frames if ($subtract==1) $tc['frames']= floor( $partseconds * 25 ); else $tc['frames']= floor( $partseconds * 25 ); // hours $tc['hours']= floor( $wholeseconds / 3600 ); $minsec= ($wholeseconds - ($tc['hours'] * 3600)); // minutes $tc['minutes']= floor( $minsec / 60 ); // seconds $tc['seconds']= ( $minsec - ($tc['minutes'] * 60) ); // padding foreach ( $tc AS $key=>$value ) { if ($value > 0 && $value < 10) $tc["$key"]= "0".$value; if ($value=="0") $tc["$key"]= "00"; } return $tc; } // array $tc // returns string of well-formed timecode // function tcToString (&$tc) { return $tc['hours'].":".$tc['minutes'].":".$tc['seconds'].";".$tc['frames']; } $timecodeIN = parseInput($tcIn); $timecodeOUT = parseInput($tcOut); // normalized inputs... $tc1 = tcToString($timecodeIN); $tc2 = tcToString($timecodeOUT); // get seconds $seconds1 = tcToSec($timecodeIN); $seconds2 = tcToSec($timecodeOUT); $result = $seconds1 + $seconds2; $timecode3 = secToTc($result, 0); $timecodeDUR = tcToString($timecode3); $clipArray = array('clip_name' => $clipName, 'tc_in' => $tcIn, 'tc_out' => $tcOut, 'tc_duration' => $timecodeDUR); $this->db->insert('tools_cue_sheets_clips', $clipArray); redirect('staff/tools/add_cue_sheet_clips/'.$sheetID); } I hope this is enough information for someone to help me get on top of this, I would be extremely greatful. Thanks, Tim

    Read the article

  • Windows Impersonation failed

    - by skprocks
    I am using following code to implement impersonation for the particular windows account,which is failing.Please help. using System.Security.Principal; using System.Runtime.InteropServices; public partial class Source_AddNewProduct : System.Web.UI.Page { [DllImport("advapi32.dll", SetLastError = true)] static extern bool LogonUser( string principal, string authority, string password, LogonSessionType logonType, LogonProvider logonProvider, out IntPtr token); [DllImport("kernel32.dll", SetLastError = true)] static extern bool CloseHandle(IntPtr handle); enum LogonSessionType : uint { Interactive = 2, Network, Batch, Service, NetworkCleartext = 8, NewCredentials } enum LogonProvider : uint { Default = 0, // default for platform (use this!) WinNT35, // sends smoke signals to authority WinNT40, // uses NTLM WinNT50 // negotiates Kerb or NTLM } //impersonation is used when user tries to upload an image to a network drive protected void btnPrimaryPicUpload_Click1(object sender, EventArgs e) { try { string mDocumentExt = string.Empty; string mDocumentName = string.Empty; HttpPostedFile mUserPostedFile = null; HttpFileCollection mUploadedFiles = null; string xmlPath = string.Empty; FileStream fs = null; StreamReader file; string modify; mUploadedFiles = HttpContext.Current.Request.Files; mUserPostedFile = mUploadedFiles[0]; if (mUserPostedFile.ContentLength >= 0 && Path.GetFileName(mUserPostedFile.FileName) != "") { mDocumentName = Path.GetFileName(mUserPostedFile.FileName); mDocumentExt = Path.GetExtension(mDocumentName); mDocumentExt = mDocumentExt.ToLower(); if (mDocumentExt != ".jpg" && mDocumentExt != ".JPG" && mDocumentExt != ".gif" && mDocumentExt != ".GIF" && mDocumentExt != ".jpeg" && mDocumentExt != ".JPEG" && mDocumentExt != ".tiff" && mDocumentExt != ".TIFF" && mDocumentExt != ".png" && mDocumentExt != ".PNG" && mDocumentExt != ".raw" && mDocumentExt != ".RAW" && mDocumentExt != ".bmp" && mDocumentExt != ".BMP" && mDocumentExt != ".TIF" && mDocumentExt != ".tif") { Page.RegisterStartupScript("select", "<script language=" + Convert.ToChar(34) + "VBScript" + Convert.ToChar(34) + "> MsgBox " + Convert.ToChar(34) + "Please upload valid picture file format" + Convert.ToChar(34) + " , " + Convert.ToChar(34) + "64" + Convert.ToChar(34) + " , " + Convert.ToChar(34) + "WFISware" + Convert.ToChar(34) + "</script>"); } else { int intDocLen = mUserPostedFile.ContentLength; byte[] imageBytes = new byte[intDocLen]; mUserPostedFile.InputStream.Read(imageBytes, 0, mUserPostedFile.ContentLength); //xmlPath = @ConfigurationManager.AppSettings["ImagePath"].ToString(); xmlPath = Server.MapPath("./../ProductImages/"); mDocumentName = Guid.NewGuid().ToString().Replace("-", "") + System.IO.Path.GetExtension(mUserPostedFile.FileName); //if (System.IO.Path.GetExtension(mUserPostedFile.FileName) == ".jpg") //{ //} //if (System.IO.Path.GetExtension(mUserPostedFile.FileName) == ".gif") //{ //} mUserPostedFile.SaveAs(xmlPath + mDocumentName); //Remove commenting till upto stmt xmlPath = "./../ProductImages/"; to implement impersonation byte[] bytContent; IntPtr token = IntPtr.Zero; WindowsImpersonationContext impersonatedUser = null; try { // Note: Credentials should be encrypted in configuration file bool result = LogonUser(ConfigurationManager.AppSettings["ServiceAccount"].ToString(), "ad-ent", ConfigurationManager.AppSettings["ServiceAccountPassword"].ToString(), LogonSessionType.Network, LogonProvider.Default, out token); if (result) { WindowsIdentity id = new WindowsIdentity(token); // Begin impersonation impersonatedUser = id.Impersonate(); mUserPostedFile.SaveAs(xmlPath + mDocumentName); } else { throw new Exception("Identity impersonation has failed."); } } catch { throw; } finally { // Stop impersonation and revert to the process identity if (impersonatedUser != null) impersonatedUser.Undo(); // Free the token if (token != IntPtr.Zero) CloseHandle(token); } xmlPath = "./../ProductImages/"; xmlPath = xmlPath + mDocumentName; string o_image = xmlPath; //For impersoantion uncomment this line and comment next line //string o_image = "../ProductImages/" + mDocumentName; ViewState["masterImage"] = o_image; //fs = new FileStream(xmlPath, FileMode.Open, FileAccess.Read); //file = new StreamReader(fs, Encoding.UTF8); //modify = file.ReadToEnd(); //file.Close(); //commented by saurabh kumar 28may'09 imgImage.Visible = true; imgImage.ImageUrl = ViewState["masterImage"].ToString(); img_Label1.Visible = false; } //e.Values["TemplateContent"] = modify; //e.Values["TemplateName"] = mDocumentName.Replace(".xml", ""); } } catch (Exception ex) { ExceptionUtil.UI(ex); Response.Redirect("errorpage.aspx"); } } } The code on execution throws system.invalidoperation exception.I have provided full control to destination folder to the windows service account that i am impersonating.

    Read the article

  • Anyone succeeded at injecting Interfaces into Entity Framework 4 Entities, using T4?

    - by Ciel
    Hello: POCO sort of leaves me wanting: (how can I say I use DI/IoC, if the Repository is not the only place that is creating the entities?)...hence my desire to lock it down, get rid of the temptation of newing up POCOs or EntityObjects anywhere in the code, and just allowing entity interfaces above the Repository/Factory layer. For a second there, I nearly thought I had it...was editing EF4's T4 in order to inject in an Interface def. Was going swimmingly, compiled and worked, until I got to the Associations... I wrapped them with a ICollection, and renamed the underlying original collection with a prefix of Wrapped. Unfortunately, when run, throws an error: //The Member 'WrappedSubExamples' in the CLR type 'XAct.App.Data.Model.EF4.Example' is not present in the conceptual model type 'XAct.App.Data.Model.Entity.Example'. var examples = context2.CreateObjectSet(); My T4 segment I used was (this may not work, as it's the longest code snippet I've ever posted here...sorry): #region Generic Property Abstraction <# if (navProperty.ToEndMember.RelationshipMultiplicity == RelationshipMultiplicity.Many) {#> //XAct.App Generic Wrapper: <#=code.SpaceAfter(NewModifier(navProperty))#><#=Accessibility.ForProperty(navProperty)#> ICollection<I<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>> <#=code.Escape(navProperty)#> { get { if (_X<#=code.Escape(navProperty)# == null){ _X<#=code.Escape(navProperty)# = new WrappedCollection,<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#(this.<#=(navProperty.ToEndMember.RelationshipMultiplicity == RelationshipMultiplicity.Many)?"Wrapped":""#<#=code.Escape(navProperty)#); } return _X<#=code.Escape(navProperty)#; } } private ICollection _X<#=code.Escape(navProperty)#; <# } else { # <#=code.SpaceAfter(NewModifier(navProperty))#<#=Accessibility.ForProperty(navProperty)# I<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)# <#=code.Escape(navProperty)# { get { return (I<#=code.Escape(navProperty)#)this.Wrapped<#=code.Escape(navProperty)#; } set { this.Wrapped<#=code.Escape(navProperty)# = value as <#=code.Escape(navProperty)#; } } <# } # #endregion which then wraps the original collection, renamed with the prefix 'Wrapped': /// <summary> /// <#=SummaryComment(navProperty)#> /// </summary><#=LongDescriptionCommentElement(navProperty, region.CurrentIndentLevel) #> [XmlIgnoreAttribute()] [SoapIgnoreAttribute()] [DataMemberAttribute()] [EdmRelationshipNavigationPropertyAttribute("<#=navProperty.RelationshipType.NamespaceName#>", "<#=navProperty.RelationshipType.Name#>", "<#=navProperty.ToEndMember.Name#>")] <# if (navProperty.ToEndMember.RelationshipMultiplicity == RelationshipMultiplicity.Many) { #> <#=code.SpaceAfter(NewModifier(navProperty))#><#=Accessibility.ForProperty(navProperty)#> EntityCollection<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>> Wrapped<#=code.Escape(navProperty)#> { <#=code.SpaceAfter(Accessibility.ForGetter(navProperty))#>get { return ((IEntityWithRelationships)this).RelationshipManager.GetRelatedCollection<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>"); } <#=code.SpaceAfter(Accessibility.ForSetter(navProperty))#>set { if ((value != null)) { ((IEntityWithRelationships)this).RelationshipManager.InitializeRelatedCollection<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>", value); } } } <# } else { #> <#=code.SpaceAfter(NewModifier(navProperty))#><#=Accessibility.ForProperty(navProperty)#> <#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#> Wrapped<#=code.Escape(navProperty)#> { <#=code.SpaceAfter(Accessibility.ForGetter(navProperty))#>get { return ((IEntityWithRelationships)this).RelationshipManager.GetRelatedReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>").Value; } <#=code.SpaceAfter(Accessibility.ForSetter(navProperty))#>set { ((IEntityWithRelationships)this).RelationshipManager.GetRelatedReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>").Value = value; } } <# string refPropertyName = navProperty.Name + "Reference"; if (entity.Members.Any(m => m.Name == refPropertyName)) { // 6017 is the same error number that EntityClassGenerator uses. Errors.Add(new System.CodeDom.Compiler.CompilerError(SourceCsdlPath, -1, -1, "6017", String.Format(CultureInfo.CurrentCulture, GetResourceString("Template_ConflictingGeneratedNavPropName"), navProperty.Name, entity.FullName, refPropertyName))); } #> /// <summary> /// <#=SummaryComment(navProperty)#> /// </summary><#=LongDescriptionCommentElement(navProperty, region.CurrentIndentLevel)#> [BrowsableAttribute(false)] [DataMemberAttribute()] <#=Accessibility.ForProperty(navProperty)#> EntityReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>> <#=refPropertyName#> { <#=code.SpaceAfter(Accessibility.ForGetter(navProperty))#>get { return ((IEntityWithRelationships)this).RelationshipManager.GetRelatedReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>"); } <#=code.SpaceAfter(Accessibility.ForSetter(navProperty))#>set { if ((value != null)) { ((IEntityWithRelationships)this).RelationshipManager.InitializeRelatedReference<<#=MultiSchemaEscape(navProperty.ToEndMember.GetEntityType(), code)#>>("<#=navProperty.RelationshipType.FullName#>", "<#=navProperty.ToEndMember.Name#>", value); } } } <# } The point is...it bugs out. I've tried various solutions...none worked. Any ideas -- or is this just a wild goose chase, and time to give it up?

    Read the article

  • Making swap faster, easier to use and exception-safe

    - by FredOverflow
    I could not sleep last night and started thinking about std::swap. Here is the familiar C++98 version: template <typename T> void swap(T& a, T& b) { T c(a); a = b; b = c; } If a user-defined class Foo uses external ressources, this is inefficient. The common idiom is to provide a method void Foo::swap(Foo& other) and a specialization of std::swap<Foo>. Note that this does not work with class templates since you cannot partially specialize a function template, and overloading names in the std namespace is illegal. The solution is to write a template function in one's own namespace and rely on argument dependent lookup to find it. This depends critically on the client to follow the "using std::swap idiom" instead of calling std::swap directly. Very brittle. In C++0x, if Foo has a user-defined move constructor and a move assignment operator, providing a custom swap method and a std::swap<Foo> specialization has little to no performance benefit, because the C++0x version of std::swap uses efficient moves instead of copies: #include <utility> template <typename T> void swap(T& a, T& b) { T c(std::move(a)); a = std::move(b); b = std::move(c); } Not having to fiddle with swap anymore already takes a lot of burden away from the programmer. Current compilers do not generate move constructors and move assignment operators automatically yet, but as far as I know, this will change. The only problem left then is exception-safety, because in general, move operations are allowed to throw, and this opens up a whole can of worms. The question "What exactly is the state of a moved-from object?" complicates things further. Then I was thinking, what exactly are the semantics of std::swap in C++0x if everything goes fine? What is the state of the objects before and after the swap? Typically, swapping via move operations does not touch external resources, only the "flat" object representations themselves. So why not simply write a swap template that does exactly that: swap the object representations? #include <cstring> template <typename T> void swap(T& a, T& b) { unsigned char c[sizeof(T)]; memcpy( c, &a, sizeof(T)); memcpy(&a, &b, sizeof(T)); memcpy(&b, c, sizeof(T)); } This is as efficient as it gets: it simply blasts through raw memory. It does not require any intervention from the user: no special swap methods or move operations have to be defined. This means that it even works in C++98 (which does not have rvalue references, mind you). But even more importantly, we can now forget about the exception-safety issues, because memcpy never throws. I can see two potential problems with this approach: First, not all objects are meant to be swapped. If a class designer hides the copy constructor or the copy assignment operator, trying to swap objects of the class should fail at compile-time. We can simply introduce some dead code that checks whether copying and assignment are legal on the type: template <typename T> void swap(T& a, T& b) { if (false) // dead code, never executed { T c(a); // copy-constructible? a = b; // assignable? } unsigned char c[sizeof(T)]; std::memcpy( c, &a, sizeof(T)); std::memcpy(&a, &b, sizeof(T)); std::memcpy(&b, c, sizeof(T)); } Any decent compiler can trivially get rid of the dead code. (There are probably better ways to check the "swap conformance", but that is not the point. What matters is that it's possible). Second, some types might perform "unusual" actions in the copy constructor and copy assignment operator. For example, they might notify observers of their change. I deem this a minor issue, because such kinds of objects probably should not have provided copy operations in the first place. Please let me know what you think of this approach to swapping. Would it work in practice? Would you use it? Can you identify library types where this would break? Do you see additional problems? Discuss!

    Read the article

  • Cascading S3 Sink Tap not being deleted with SinkMode.REPLACE

    - by Eric Charles
    We are running Cascading with a Sink Tap being configured to store in Amazon S3 and were facing some FileAlreadyExistsException (see [1]). This was only from time to time (1 time on around 100) and was not reproducable. Digging into the Cascading codem, we discovered the Hfs.deleteResource() is called (among others) by the BaseFlow.deleteSinksIfNotUpdate(). Btw, we were quite intrigued with the silent NPE (with comment "hack to get around npe thrown when fs reaches root directory"). From there, we extended the Hfs tap with our own Tap to add more action in the deleteResource() method (see [2]) with a retry mechanism calling directly the getFileSystem(conf).delete. The retry mechanism seemed to bring improvement, but we are still sometimes facing failures (see example in [3]): it sounds like HDFS returns isDeleted=true, but asking directly after if the folder exists, we receive exists=true, which should not happen. Logs also shows randomly isDeleted true or false when the flow succeeds, which sounds like the returned value is irrelevant or not to be trusted. Can anybody bring his own S3 experience with such a behavior: "folder should be deleted, but it is not"? We suspect a S3 issue, but could it also be in Cascading or HDFS? We run on Hadoop Cloudera-cdh3u5 and Cascading 2.0.1-wip-dev. [1] org.apache.hadoop.mapred.FileAlreadyExistsException: Output directory s3n://... already exists at org.apache.hadoop.mapreduce.lib.output.FileOutputFormat.checkOutputSpecs(FileOutputFormat.java:132) at com.twitter.elephantbird.mapred.output.DeprecatedOutputFormatWrapper.checkOutputSpecs(DeprecatedOutputFormatWrapper.java:75) at org.apache.hadoop.mapred.JobClient$2.run(JobClient.java:923) at org.apache.hadoop.mapred.JobClient$2.run(JobClient.java:882) at java.security.AccessController.doPrivileged(Native Method) at javax.security.auth.Subject.doAs(Subject.java:396) at org.apache.hadoop.security.UserGroupInformation.doAs(UserGroupInformation.java:1278) at org.apache.hadoop.mapred.JobClient.submitJobInternal(JobClient.java:882) at org.apache.hadoop.mapred.JobClient.submitJob(JobClient.java:856) at cascading.flow.hadoop.planner.HadoopFlowStepJob.internalNonBlockingStart(HadoopFlowStepJob.java:104) at cascading.flow.planner.FlowStepJob.blockOnJob(FlowStepJob.java:174) at cascading.flow.planner.FlowStepJob.start(FlowStepJob.java:137) at cascading.flow.planner.FlowStepJob.call(FlowStepJob.java:122) at cascading.flow.planner.FlowStepJob.call(FlowStepJob.java:42) at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:303) at java.util.concurrent.FutureTask.run(FutureTask.java:138) at java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) at java.lang.Thread.run(Thread.j [2] @Override public boolean deleteResource(JobConf conf) throws IOException { LOGGER.info("Deleting resource {}", getIdentifier()); boolean isDeleted = super.deleteResource(conf); LOGGER.info("Hfs Sink Tap isDeleted is {} for {}", isDeleted, getIdentifier()); Path path = new Path(getIdentifier()); int retryCount = 0; int cumulativeSleepTime = 0; int sleepTime = 1000; while (getFileSystem(conf).exists(path)) { LOGGER .info( "Resource {} still exists, it should not... - I will continue to wait patiently...", getIdentifier()); try { LOGGER.info("Now I will sleep " + sleepTime / 1000 + " seconds while trying to delete {} - attempt: {}", getIdentifier(), retryCount + 1); Thread.sleep(sleepTime); cumulativeSleepTime += sleepTime; sleepTime *= 2; } catch (InterruptedException e) { e.printStackTrace(); LOGGER .error( "Interrupted while sleeping trying to delete {} with message {}...", getIdentifier(), e.getMessage()); throw new RuntimeException(e); } if (retryCount == 0) { getFileSystem(conf).delete(getPath(), true); } retryCount++; if (cumulativeSleepTime > MAXIMUM_TIME_TO_WAIT_TO_DELETE_MS) { break; } } if (getFileSystem(conf).exists(path)) { LOGGER .error( "We didn't succeed to delete the resource {}. Throwing now a runtime exception.", getIdentifier()); throw new RuntimeException( "Although we waited to delete the resource for " + getIdentifier() + ' ' + retryCount + " iterations, it still exists - This must be an issue in the underlying storage system."); } return isDeleted; } [3] INFO [pool-2-thread-15] (BaseFlow.java:1287) - [...] at least one sink is marked for delete INFO [pool-2-thread-15] (BaseFlow.java:1287) - [...] sink oldest modified date: Wed Dec 31 23:59:59 UTC 1969 INFO [pool-2-thread-15] (HiveSinkTap.java:148) - Now I will sleep 1 seconds while trying to delete s3n://... - attempt: 1 INFO [pool-2-thread-15] (HiveSinkTap.java:130) - Deleting resource s3n://... INFO [pool-2-thread-15] (HiveSinkTap.java:133) - Hfs Sink Tap isDeleted is true for s3n://... ERROR [pool-2-thread-15] (HiveSinkTap.java:175) - We didn't succeed to delete the resource s3n://... Throwing now a runtime exception. WARN [pool-2-thread-15] (Cascade.java:706) - [...] flow failed: ... java.lang.RuntimeException: Although we waited to delete the resource for s3n://... 0 iterations, it still exists - This must be an issue in the underlying storage system. at com.qubit.hive.tap.HiveSinkTap.deleteResource(HiveSinkTap.java:179) at com.qubit.hive.tap.HiveSinkTap.deleteResource(HiveSinkTap.java:40) at cascading.flow.BaseFlow.deleteSinksIfNotUpdate(BaseFlow.java:971) at cascading.flow.BaseFlow.prepare(BaseFlow.java:733) at cascading.cascade.Cascade$CascadeJob.call(Cascade.java:761) at cascading.cascade.Cascade$CascadeJob.call(Cascade.java:710) at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:303) at java.util.concurrent.FutureTask.run(FutureTask.java:138) at java.util.concurrent.ThreadPoolExecutor$Worker.runTask(ThreadPoolExecutor.java:886) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:908) at java.lang.Thread.run(Thread.java:619)

    Read the article

  • Android ksoap nested soap objects in request gives error in response

    - by Smalesy
    I'm trying to do the following soap request on Android using KSOAP. It contains a list of nested soap objects. However, I must be doing something wrong as I get an error back. The request I am trying to generate is as follows: <?xml version="1.0" encoding="utf-8"?> <soap12:Envelope xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema" xmlns:soap12="http://www.w3.org/2003/05/soap-envelope"> <soap12:Body> <SetAttendanceMarks xmlns="http://hostname.net/"> <strSessionToken>string</strSessionToken> <LessonMarks> <Count>int</Count> <LessonMarks> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> <LessonMark> <StudentId>int</StudentId> <EventInstanceId>int</EventInstanceId> <Mark>string</Mark> </LessonMark> </LessonMarks> </LessonMarks> </SetAttendanceMarks> </soap12:Body> </soap12:Envelope> My code is as follows: public boolean setAttendanceMarks(List<Mark> list) throws Exception { boolean result = false; String methodName = "SetAttendanceMarks"; String soapAction = getHost() + "SetAttendanceMarks"; SoapObject lessMarksN = new SoapObject(getHost(), "LessonMarks"); for (Mark m : list) { PropertyInfo smProp =new PropertyInfo(); smProp.setName("LessonMark"); smProp.setValue(m); smProp.setType(Mark.class); lessMarksN.addProperty(smProp); } PropertyInfo cProp =new PropertyInfo(); cProp.setName("Count"); cProp.setValue(list.size()); cProp.setType(Integer.class); SoapObject lessMarks = new SoapObject(getHost(), "LessonMarks"); lessMarks.addProperty(cProp); lessMarks.addSoapObject(lessMarksN); PropertyInfo sProp =new PropertyInfo(); sProp.setName("strSessionToken"); sProp.setValue(mSession); sProp.setType(String.class); SoapObject request = new SoapObject(getHost(), methodName); request.addProperty(sProp); request.addSoapObject(lessMarks); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope(SoapEnvelope.VER12); envelope.dotNet = true; envelope.setOutputSoapObject(request); HttpTransportSE androidHttpTransport = new HttpTransportSE(getURL()); androidHttpTransport.debug = true; androidHttpTransport.call(soapAction, envelope); String a = androidHttpTransport.requestDump; String b = androidHttpTransport.responseDump; SoapObject resultsRequestSOAP = (SoapObject) envelope.bodyIn; SoapObject res = (SoapObject) resultsRequestSOAP.getProperty(0); String resultStr = res.getPropertyAsString("Result"); if (resultStr.contentEquals("OK")) { result = true; } return result; } The error I get is as follows: <?xml version="1.0" encoding="utf-8"?><soap:Envelope xmlns:soap="http://www.w3.org/2003/05/soap-envelope" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:xsd="http://www.w3.org/2001/XMLSchema"> <soap:Body> <soap:Fault> <soap:Code> <soap:Value>soap:Sender</soap:Value> </soap:Code> <soap:Reason> <soap:Text xml:lang="en">Server was unable to read request. ---&gt; There is an error in XML document (1, 383). ---&gt; The specified type was not recognized: name='LessonMarks', namespace='http://gsdregapp.net/', at &lt;LessonMarks xmlns='http://gsdregapp.net/'&gt;.</soap:Text> </soap:Reason> <soap:Detail /> </soap:Fault> </soap:Body> </soap:Envelope> Can anybody tell me what I am doing wrong? I will be most grateful for any assistance!

    Read the article

  • Sending the files (At least 11 files) from folder through web service to android app.

    - by Shashank_Itmaster
    Hello All, I stuck in middle of this situation,Please help me out. My question is that I want to send files (Total 11 PDF Files) to android app using web service. I tried it with below code.Main Class from which web service is created public class MultipleFilesImpl implements MultipleFiles { public FileData[] sendPDFs() { FileData fileData = null; // List<FileData> filesDetails = new ArrayList<FileData>(); File fileFolder = new File( "C:/eclipse/workspace/AIPWebService/src/pdfs/"); // File fileTwo = new File( // "C:/eclipse/workspace/AIPWebService/src/simple.pdf"); File sendFiles[] = fileFolder.listFiles(); // sendFiles[0] = fileOne; // sendFiles[1] = fileTwo; DataHandler handler = null; char[] readLine = null; byte[] data = null; int offset = 0; int numRead = 0; InputStream stream = null; FileOutputStream outputStream = null; FileData[] filesData = null; try { System.out.println("Web Service Called Successfully"); for (int i = 0; i < sendFiles.length; i++) { handler = new DataHandler(new FileDataSource(sendFiles[i])); fileData = new FileData(); data = new byte[(int) sendFiles[i].length()]; stream = handler.getInputStream(); while (offset < data.length && (numRead = stream.read(data, offset, data.length - offset)) >= 0) { offset += numRead; } readLine = Base64Coder.encode(data); offset = 0; numRead = 0; System.out.println("'Reading File............................"); System.out.println("\n"); System.out.println(readLine); System.out.println("Data Reading Successful"); fileData.setFileName(sendFiles[i].getName()); fileData.setFileData(String.valueOf(readLine)); readLine = null; System.out.println("Data from bean " + fileData.getFileData()); outputStream = new FileOutputStream("D:/" + sendFiles[i].getName()); outputStream.write(Base64Coder.decode(fileData.getFileData())); outputStream.flush(); outputStream.close(); stream.close(); // FileData fileDetails = new FileData(); // fileDetails = fileData; // filesDetails.add(fileData); filesData = new FileData[(int) sendFiles[i].length()]; } // return fileData; } catch (FileNotFoundException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } catch (Exception e) { e.printStackTrace(); } return filesData; } } Also The Interface MultipleFiles:- public interface MultipleFiles extends Remote { public FileData[] sendPDFs() throws FileNotFoundException, IOException, Exception; } Here I am sending an array of bean "File Data",having properties viz. FileData & FileName. FileData- contains file data in encoded. FileName- encoded file name. The Bean:- (FileData) public class FileData { private String fileName; private String fileData; public String getFileName() { return fileName; } public void setFileName(String fileName) { this.fileName = fileName; } public String getFileData() { return fileData; } public void setFileData(String string) { this.fileData = string; } } The android DDMS gives out of memory exception when tried below code & when i tried to send two files then only first file is created. public class PDFActivity extends Activity { private final String METHOD_NAME = "sendPDFs"; private final String NAMESPACE = "http://webservice.uks.com/"; private final String SOAP_ACTION = NAMESPACE + METHOD_NAME; private final String URL = "http://192.168.1.123:8080/AIPWebService/services/MultipleFilesImpl"; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); TextView textViewOne = (TextView) findViewById(R.id.textViewOne); try { SoapObject soapObject = new SoapObject(NAMESPACE, METHOD_NAME); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope( SoapEnvelope.VER11); envelope.setOutputSoapObject(soapObject); textViewOne.setText("Web Service Started"); AndroidHttpTransport httpTransport = new AndroidHttpTransport(URL); httpTransport.call(SOAP_ACTION, envelope); // SoapObject result = (SoapObject) envelope.getResponse(); Object result = envelope.getResponse(); Log.i("Result", result.toString()); // String fileName = result.getProperty("fileName").toString(); // String fileData = result.getProperty("fileData").toString(); // Log.i("File Name", fileName); // Log.i("File Data", fileData); // File pdfFile = new File(fileName); // FileOutputStream outputStream = // openFileOutput(pdfFile.toString(), // MODE_PRIVATE); // outputStream.write(Base64Coder.decode(fileData)); Log.i("File", "File Created"); // textViewTwo.setText(result); // Object result = envelope.getResponse(); // FileOutputStream outputStream = openFileOutput(name, mode) } catch (Exception e) { e.printStackTrace(); } } } Please help with some explanation or changes in my code. Thanks in Advance.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • How do I prevent my form from freezing when it is loading an image from the web at the click of a button?

    - by Vimal Basdeo
    I want to display an image from the web to a panel in another Jframe at the click of a button but whenever I click the button first the image loads and during this time the current form potentially freezes and once the image has loaded the form is displayed with the image.. How can I avoid the situation where my form freezes since it is very irritating My codes :: My current class private void btn_TrackbusActionPerformed(java.awt.event.ActionEvent evt) { try { sendMessage("Query,map,$,start,211,Arsenal,!"); System.out.println(receiveMessage()); } catch (UnknownHostException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (IOException ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } catch (Exception ex) { Logger.getLogger(client_Trackbus.class.getName()).log(Level.SEVERE, null, ex); } client_trackedbus nextform=new client_trackedbus(planform,connection,packet_receive,packet_send); this.setVisible(false); this.dispose(); nextform.setVisible(true); // TODO add your handling code here: } My next class that displays the image public class client_trackedbus extends javax.swing.JFrame { client_planform planform=null; DatagramSocket connection=null; DatagramPacket packet_receive=null; DatagramPacket packet_send=null; JLabel label=null; /** Creates new form client_trackedbus */ public client_trackedbus(client_planform planform,DatagramSocket connection,DatagramPacket packet_receive,DatagramPacket packet_send) { initComponents(); this.planform=planform; this.connection=connection; this.packet_receive=packet_receive; this.packet_send=packet_send; try { displayMap("http://www.huddletogether.com/projects/lightbox2/images/image-2.jpg", jPanel1, new JLabel()); } catch (MalformedURLException ex) { Logger.getLogger(client_trackedbus.class.getName()).log(Level.SEVERE, null, ex); } } private void displayMap(String url,JPanel panel,JLabel label) throws MalformedURLException{ URL imageurl=new URL(url); Image image=(Toolkit.getDefaultToolkit().createImage(imageurl)); ImageIcon icon = new ImageIcon(image); label.setIcon(icon); panel.add(label); // System.out.println(panel.getSize().width); this.getContentPane().add(panel); } /** This method is called from within the constructor to * initialize the form. * WARNING: Do NOT modify this code. The content of this method is * always regenerated by the Form Editor. */ @SuppressWarnings("unchecked") // <editor-fold defaultstate="collapsed" desc="Generated Code"> private void initComponents() { jPanel1 = new javax.swing.JPanel(); jLabel1 = new javax.swing.JLabel(); btn_Exit = new javax.swing.JButton(); btn_Plan = new javax.swing.JButton(); setDefaultCloseOperation(javax.swing.WindowConstants.EXIT_ON_CLOSE); setTitle("Public Transport Journey Planner"); javax.swing.GroupLayout jPanel1Layout = new javax.swing.GroupLayout(jPanel1); jPanel1.setLayout(jPanel1Layout); jPanel1Layout.setHorizontalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 368, Short.MAX_VALUE) ); jPanel1Layout.setVerticalGroup( jPanel1Layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGap(0, 172, Short.MAX_VALUE) ); jLabel1.setFont(new java.awt.Font("Arial", 1, 18)); jLabel1.setText("Your tracked bus"); btn_Exit.setText("Exit"); btn_Exit.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_ExitActionPerformed(evt); } }); btn_Plan.setText("Plan journey"); btn_Plan.addActionListener(new java.awt.event.ActionListener() { public void actionPerformed(java.awt.event.ActionEvent evt) { btn_PlanActionPerformed(evt); } }); javax.swing.GroupLayout layout = new javax.swing.GroupLayout(getContentPane()); getContentPane().setLayout(layout); layout.setHorizontalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(104, 104, 104) .addComponent(jLabel1)) .addGroup(layout.createSequentialGroup() .addContainerGap() .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE)) .addGroup(layout.createSequentialGroup() .addGap(65, 65, 65) .addComponent(btn_Plan) .addGap(65, 65, 65) .addComponent(btn_Exit, javax.swing.GroupLayout.PREFERRED_SIZE, 87, javax.swing.GroupLayout.PREFERRED_SIZE))) .addContainerGap(20, Short.MAX_VALUE)) ); layout.setVerticalGroup( layout.createParallelGroup(javax.swing.GroupLayout.Alignment.LEADING) .addGroup(layout.createSequentialGroup() .addGap(35, 35, 35) .addComponent(jLabel1) .addGap(18, 18, 18) .addComponent(jPanel1, javax.swing.GroupLayout.PREFERRED_SIZE, javax.swing.GroupLayout.DEFAULT_SIZE, javax.swing.GroupLayout.PREFERRED_SIZE) .addGap(18, 18, 18) .addGroup(layout.createParallelGroup(javax.swing.GroupLayout.Alignment.BASELINE) .addComponent(btn_Exit) .addComponent(btn_Plan)) .addContainerGap(12, Short.MAX_VALUE)) ); pack(); }// </editor-fold> private void btn_ExitActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: Exitform(); } private void btn_PlanActionPerformed(java.awt.event.ActionEvent evt) { // TODO add your handling code here: this.setVisible(false); this.dispose(); this.planform.setVisible(true); } private void Exitform(){ this.setVisible(false); this.dispose(); } /** * @param args the command line arguments */ public static void main(String args[]) { java.awt.EventQueue.invokeLater(new Runnable() { public void run() { // new client_trackedbus().setVisible(true); } }); } // Variables declaration - do not modify private javax.swing.JButton btn_Exit; private javax.swing.JButton btn_Plan; private javax.swing.JLabel jLabel1; private javax.swing.JPanel jPanel1; // End of variables declaration }

    Read the article

  • XML over HTTP with JMS and Spring

    - by Will Sumekar
    I have a legacy HTTP server where I need to send an XML file over HTTP request (POST) using Java (not browser) and the server will respond with another XML in its HTTP response. It is similar to Web Service but there's no WSDL and I have to follow the existing XML structure to construct my XML to be sent. I have done a research and found an example that matches my requirement here. The example uses HttpClient from Apache Commons. (There are also other examples I found but they use java.net networking package (like URLConnection) which is tedious so I don't want to use them). But it's also my requirement to use Spring and JMS. I know from Spring's reference that it's possible to combine HttpClient, JMS and Spring. My question is, how? Note that it's NOT in my requirement to use HttpClient. If you have a better suggestion, I'm welcome. Appreciate it. For your reference, here's the XML-over-HTTP example I've been talking about: /* * $Header: * $Revision$ * $Date$ * ==================================================================== * * Copyright 2002-2004 The Apache Software Foundation * * Licensed under the Apache License, Version 2.0 (the "License"); * you may not use this file except in compliance with the License. * You may obtain a copy of the License at * * http://www.apache.org/licenses/LICENSE-2.0 * * Unless required by applicable law or agreed to in writing, software * distributed under the License is distributed on an "AS IS" BASIS, * WITHOUT WARRANTIES OR CONDITIONS OF ANY KIND, either express or implied. * See the License for the specific language governing permissions and * limitations under the License. * ==================================================================== * * This software consists of voluntary contributions made by many * individuals on behalf of the Apache Software Foundation. For more * information on the Apache Software Foundation, please see * <http://www.apache.org/>. * * [Additional notices, if required by prior licensing conditions] * */ import java.io.File; import java.io.FileInputStream; import org.apache.commons.httpclient.HttpClient; import org.apache.commons.httpclient.methods.InputStreamRequestEntity; import org.apache.commons.httpclient.methods.PostMethod; /** * * This is a sample application that demonstrates * how to use the Jakarta HttpClient API. * * This application sends an XML document * to a remote web server using HTTP POST * * @author Sean C. Sullivan * @author Ortwin Glück * @author Oleg Kalnichevski */ public class PostXML { /** * * Usage: * java PostXML http://mywebserver:80/ c:\foo.xml * * @param args command line arguments * Argument 0 is a URL to a web server * Argument 1 is a local filename * */ public static void main(String[] args) throws Exception { if (args.length != 2) { System.out.println( "Usage: java -classpath <classpath> [-Dorg.apache.commons."+ "logging.simplelog.defaultlog=<loglevel>]" + " PostXML <url> <filename>]"); System.out.println("<classpath> - must contain the "+ "commons-httpclient.jar and commons-logging.jar"); System.out.println("<loglevel> - one of error, "+ "warn, info, debug, trace"); System.out.println("<url> - the URL to post the file to"); System.out.println("<filename> - file to post to the URL"); System.out.println(); System.exit(1); } // Get target URL String strURL = args[0]; // Get file to be posted String strXMLFilename = args[1]; File input = new File(strXMLFilename); // Prepare HTTP post PostMethod post = new PostMethod(strURL); // Request content will be retrieved directly // from the input stream // Per default, the request content needs to be buffered // in order to determine its length. // Request body buffering can be avoided when // content length is explicitly specified post.setRequestEntity(new InputStreamRequestEntity( new FileInputStream(input), input.length())); // Specify content type and encoding // If content encoding is not explicitly specified // ISO-8859-1 is assumed post.setRequestHeader( "Content-type", "text/xml; charset=ISO-8859-1"); // Get HTTP client HttpClient httpclient = new HttpClient(); // Execute request try { int result = httpclient.executeMethod(post); // Display status code System.out.println("Response status code: " + result); // Display response System.out.println("Response body: "); System.out.println(post.getResponseBodyAsString()); } finally { // Release current connection to the connection pool // once you are done post.releaseConnection(); } } }

    Read the article

  • Help needed on an SQL configuration problem.

    - by user321048
    I have been banging my head with this one more the two weeks, and still don't know what the problem is ( I can't narrow it down). The problem is the following. I have a solution with 3 project in it all written in c# and I with LINQ. One project is the main web site, the other is the data layer (communication with the database) and the third one is a custom little CMS. The problem is the following: On a hosting provider when I publish the site it all works perfectly, but this site was needed to be hosted on the client server so I needed to do that. But the problem is that I also needed to configure the client server, because they don't have an Administrator employed (I know, I know ;) ). For the first time I some how managed, to set it up but a problem appear. My main web site is working just as it suppose to be - it reads (communicates with) the database, but My CMS is not. It shows the first log in page, but after that when I try to log in it throws the following error: A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.) Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.Data.SqlClient.SqlException: A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.) Source Error: An unhandled exception was generated during the execution of the current web request. Information regarding the origin and location of the exception can be identified using the exception stack trace below. Stack Trace: [SqlException (0x80131904): A network-related or instance-specific error occurred while establishing a connection to SQL Server. The server was not found or was not accessible. Verify that the instance name is correct and that SQL Server is configured to allow remote connections. (provider: TCP Provider, error: 0 - A connection attempt failed because the connected party did not properly respond after a period of time, or established connection failed because connected host has failed to respond.)] System.Data.SqlClient.SqlInternalConnection.OnError(SqlException exception, Boolean breakConnection) +4846887 System.Data.SqlClient.TdsParser.ThrowExceptionAndWarning(TdsParserStateObject stateObj) +194 System.Data.SqlClient.TdsParser.Connect(ServerInfo serverInfo, SqlInternalConnectionTds connHandler, Boolean ignoreSniOpenTimeout, Int64 timerExpire, Boolean encrypt, Boolean trustServerCert, Boolean integratedSecurity, SqlConnection owningObject) +4860189 System.Data.SqlClient.SqlInternalConnectionTds.AttemptOneLogin(ServerInfo serverInfo, String newPassword, Boolean ignoreSniOpenTimeout, Int64 timerExpire, SqlConnection owningObject) +90 System.Data.SqlClient.SqlInternalConnectionTds.LoginNoFailover(String host, String newPassword, Boolean redirectedUserInstance, SqlConnection owningObject, SqlConnectionString connectionOptions, Int64 timerStart) +342 System.Data.SqlClient.SqlInternalConnectionTds.OpenLoginEnlist(SqlConnection owningObject, SqlConnectionString connectionOptions, String newPassword, Boolean redirectedUserInstance) +221 System.Data.SqlClient.SqlInternalConnectionTds..ctor(DbConnectionPoolIdentity identity, SqlConnectionString connectionOptions, Object providerInfo, String newPassword, SqlConnection owningObject, Boolean redirectedUserInstance) +189 System.Data.SqlClient.SqlConnectionFactory.CreateConnection(DbConnectionOptions options, Object poolGroupProviderInfo, DbConnectionPool pool, DbConnection owningConnection) +185 System.Data.ProviderBase.DbConnectionFactory.CreatePooledConnection(DbConnection owningConnection, DbConnectionPool pool, DbConnectionOptions options) +31 System.Data.ProviderBase.DbConnectionPool.CreateObject(DbConnection owningObject) +433 System.Data.ProviderBase.DbConnectionPool.UserCreateRequest(DbConnection owningObject) +66 System.Data.ProviderBase.DbConnectionPool.GetConnection(DbConnection owningObject) +499 System.Data.ProviderBase.DbConnectionFactory.GetConnection(DbConnection owningConnection) +65 System.Data.ProviderBase.DbConnectionClosed.OpenConnection(DbConnection outerConnection, DbConnectionFactory connectionFactory) +117 System.Data.SqlClient.SqlConnection.Open() +122 System.Data.Linq.SqlClient.SqlConnectionManager.UseConnection(IConnectionUser user) +44 System.Data.Linq.SqlClient.SqlProvider.get_IsSqlCe() +45 System.Data.Linq.SqlClient.SqlProvider.InitializeProviderMode() +20 System.Data.Linq.SqlClient.SqlProvider.System.Data.Linq.Provider.IProvider.Execute(Expression query) +57 System.Data.Linq.DataQuery`1.System.Linq.IQueryProvider.Execute(Expression expression) +23 System.Linq.Queryable.Count(IQueryable`1 source) +240 CMS.Security.UserProfile.LoginUser() in C:\Documents and Settings\Dimitar\Desktop\New Mepso Final 08_04\CMS\Classes\UserProfile.cs:132 CMS.Default.Login1_Authenticate(Object sender, AuthenticateEventArgs e) in C:\Documents and Settings\Dimitar\Desktop\New Mepso Final 08_04\CMS\Default.aspx.cs:37 System.Web.UI.WebControls.Login.OnAuthenticate(AuthenticateEventArgs e) +108 System.Web.UI.WebControls.Login.AttemptLogin() +115 System.Web.UI.WebControls.Login.OnBubbleEvent(Object source, EventArgs e) +101 System.Web.UI.Control.RaiseBubbleEvent(Object source, EventArgs args) +37 System.Web.UI.WebControls.Button.OnCommand(CommandEventArgs e) +118 System.Web.UI.WebControls.Button.RaisePostBackEvent(String eventArgument) +166 System.Web.UI.WebControls.Button.System.Web.UI.IPostBackEventHandler.RaisePostBackEvent(String eventArgument) +10 System.Web.UI.Page.RaisePostBackEvent(IPostBackEventHandler sourceControl, String eventArgument) +13 System.Web.UI.Page.RaisePostBackEvent(NameValueCollection postData) +36 System.Web.UI.Page.ProcessRequestMain(Boolean includeStagesBeforeAsyncPoint, Boolean includeStagesAfterAsyncPoint) +1565 Maybe this is a dumb question, but I cannot find the root of the problem, let alone the solution. So far I have tried the following: -setting time out on connection string to a higher value -configuration and after that turning off server firewall -checking the connection string over and over again (they are the same for all three projects and are saved in web.config) Important notes: I have tried executing the project from VS2008 with a connection string to the same database and the results are the same. That's why I think the problem is the SQL Server 2005 and not the IIS7. Any bit of information is more then welcomed.

    Read the article

  • Getting parameter sent via html form and saving in my db

    - by Wesley
    I have error in my code i don't know to solve it please help me: My Servlet: package br.com.cad.servlet; import java.io.IOException; import java.io.PrintWriter; import java.util.Date; import java.text.ParseException; import java.text.SimpleDateFormat; import java.util.Calendar; import javax.servlet.ServletException; import javax.servlet.http.HttpServlet; import javax.servlet.http.HttpServletRequest; import javax.servlet.http.HttpServletResponse; import br.com.cad.dao.Cadastro; import br.com.cad.basica.Contato; public class AddDados extends HttpServlet{ protected void service(HttpServletRequest request, HttpServletResponse response) throws IOException, ServletException { PrintWriter out = response.getWriter(); String nome = request.getParameter("nome"); String sobrenome = request.getParameter("sobrenome"); String rg = request.getParameter("rg"); String cpf = request.getParameter("cpf"); String sexo = request.getParameter("sexo"); StringBuilder finalDate = new StringBuilder("DataNascimento1") .append("/"+request.getParameter("DataNascimento??2")) .append("/"+request.getParameter("DataNascimento3")); try { SimpleDateFormat sdf = new SimpleDateFormat("dd/MM/yyyy"); finalDate.toString(); } catch(ParseException e) { out.println("Erro de conversão da data"); return; } Contato contato = new Contato(); contato.setNome(nome); contato.setSobrenome(sobrenome); contato.setRg(rg); contato.setCpf(cpf); contato.setSexo(sexo); if ("Masculino".equals(contato.getSexo())) { contato.setSexo("M"); } else { contato.setSexo("F"); } contato.setDataNascimento1(dataNascimento1); //error here ????? contato.setDataNascimento2(dataNascimento2); //error here ????? contato.setDataNascimento3(dataNascimento3); //error here ????? Cadastro dao = new Cadastro(); dao.adiciona(contato); out.println("<html>"); out.println("<body>"); out.println("Contato " + contato.getNome() + " adicionado com sucesso"); out.println("</body>"); out.println("</html>"); } } My object dao package br.com.cad.dao; import java.sql.Connection; import java.sql.PreparedStatement; import java.sql.SQLException; import java.sql.Date; import br.com.cad.dao.ConnectDb; import br.com.cad.basica.Contato; public class Cadastro { private Connection connection; public Cadastro() { this.connection = new ConnectDb().getConnection(); } public void adiciona(Contato contato) { String sql = "INSERT INTO dados_cadastro(pf_nome, pf_ultimonome, pf_rg, pf_cpf, pf_sexo,pf_dt_nasc) VALUES(?,?,?,?,?,?,?,?)"; try { PreparedStatement stmt = connection.prepareStatement(sql); stmt.setString(1, contato.getNome()); stmt.setString(2, contato.getSobrenome()); stmt.setString(3, contato.getRg()); stmt.setString(4, contato.getCpf()); stmt.setString(5, contato.getSexo()); stmt.setDate(6, new Date( contato.getDataNascimento1().getTimeInMillis()) ); // i think there are error here i don't know to solve it ????? stmt.execute(); stmt.close(); System.out.println("Cadastro realizado com sucesso!."); } catch(SQLException sqlException) { throw new RuntimeException(sqlException); } } } My class cadastro package br.com.cad.basica; import java.util.Calendar; public class Contato { private Long id; private String nome; private String sobrenome; private String email; private String endereco; private Calendar dataNascimento1; private Calendar dataNascimento2; private Calendar dataNascimento3; private String rg; private String cpf; private String sexo; public Long getId() { return id; } public void setId(Long id) { this.id = id; } public String getNome() { return nome; } public void setNome(String nome) { this.nome = nome; } ...getters and setters I need to saving data in my mysql db, but i have some doubt about this code main how to get parameter send form html combobox( 1 for day, 2 for month, 3 for year of birth) i concatened with StringBuilder finalDate ... so i have some problem in my code please help me!!!

    Read the article

  • For Loop help In a Hash Cracker Homework.

    - by aaron burns
    On the homework I am working on we are making a hash cracker. I am implementing it so as to have my cracker. java call worker.java. Worker.java implements Runnable. Worker is to take the start and end of a list of char, the hash it is to crack, and the max length of the password that made the hash. I know I want to do a loop in run() BUT I cannot think of how I would do it so it would go to the given max pasword length. I have posted the code I have so far. Any directions or areas I should look into.... I thought there was a way to do this with a certain way to write the loop but I don't know or can't find the correct syntax. Oh.. also. In main I divide up so x amount of threads can be chosen and I know that as of write now it only works for an even number of the 40 possible char given. package HashCracker; import java.util.*; import java.security.MessageDigest; import java.security.NoSuchAlgorithmException; public class Cracker { // Array of chars used to produce strings public static final char[] CHARS = "abcdefghijklmnopqrstuvwxyz0123456789.,-!".toCharArray(); public static final int numOfChar=40; /* Given a byte[] array, produces a hex String, such as "234a6f". with 2 chars for each byte in the array. (provided code) */ public static String hexToString(byte[] bytes) { StringBuffer buff = new StringBuffer(); for (int i=0; i<bytes.length; i++) { int val = bytes[i]; val = val & 0xff; // remove higher bits, sign if (val<16) buff.append('0'); // leading 0 buff.append(Integer.toString(val, 16)); } return buff.toString(); } /* Given a string of hex byte values such as "24a26f", creates a byte[] array of those values, one byte value -128..127 for each 2 chars. (provided code) */ public static byte[] hexToArray(String hex) { byte[] result = new byte[hex.length()/2]; for (int i=0; i<hex.length(); i+=2) { result[i/2] = (byte) Integer.parseInt(hex.substring(i, i+2), 16); } return result; } public static void main(String args[]) throws NoSuchAlgorithmException { if(args.length==1)//Hash Maker { //create a byte array , meassage digestand put password into it //and get out a hash value printed to the screen using provided methods. byte[] myByteArray=args[0].getBytes(); MessageDigest hasher=MessageDigest.getInstance("SHA-1"); hasher.update(myByteArray); byte[] digestedByte=hasher.digest(); String hashValue=Cracker.hexToString(digestedByte); System.out.println(hashValue); } else//Hash Cracker { ArrayList<Thread> myRunnables=new ArrayList<Thread>(); int numOfThreads = Integer.parseInt(args[2]); int charPerThread=Cracker.numOfChar/numOfThreads; int start=0; int end=charPerThread-1; for(int i=0; i<numOfThreads; i++) { //creates, stores and starts threads. Runnable tempWorker=new Worker(start, end, args[1], Integer.parseInt(args[1])); Thread temp=new Thread(tempWorker); myRunnables.add(temp); temp.start(); start=end+1; end=end+charPerThread; } } } import java.util.*; public class Worker implements Runnable{ private int charStart; private int charEnd; private String Hash2Crack; private int maxLength; public Worker(int start, int end, String hashValue, int maxPWlength) { charStart=start; charEnd=end; Hash2Crack=hashValue; maxLength=maxPWlength; } public void run() { byte[] myHash2Crack_=Cracker.hexToArray(Hash2Crack); for(int i=charStart; i<charEnd+1; i++) { Cracker.numOfChar[i]////// this is where I am stuck. } } }

    Read the article

  • Swing object: first setText() gets "stuck" when using Mac Java SE 6

    - by Tim
    Hi there, I am a Java newbie trying to maintain an application that works fine under J2SE 5.0 (32- and 64-bit) but has a very specific problem when run under Java SE 6 64-bit: [Tims-MPB:~] tlynch% java -version java version "1.6.0_15" Java(TM) SE Runtime Environment (build 1.6.0_15-b03-226) Java HotSpot(TM) 64-Bit Server VM (build 14.1-b02-92, mixed mode) The application is cross-platform and reportedly works correctly on Java SE 6 under Windows, though I haven't been able to verify that myself. The program uses a JTextField for some text entry and a JLabel to indicate the text to be entered. The first time the showDialog() method is called to set the label text and display the dialog, it works correctly, but subsequent calls all result in the display of the label from the initial invocation rather than the one most recently specified via setText(). public void showDialog(String msgText) { System.out.println("set ChatDialog: " + msgText); jLabel1.setText(msgText); jLabel1.repaint(); // I added this; it didn't help System.out.println("get ChatDialog: " + jLabel1.getText()); super.setVisible(true); } [the full text of the class is provided below] The added printlns validate that expected text is passed to the label's setText() method and is confirmed by retrieving it using getText(), but what shows up on the screen/GUI is always the text from the very first time the method was called for the object. A similar issue is observed with a JTextArea used to label another dialog box. These problem are consistent across multiple Mac systems running Java SE 6 under OS 10.5.x and 10.6.x, but they are never observed when one reverts to J2SE 5.0. If there is some background information pertinent to this problem that I have omitted, please let me know. Any insights or advice appreciated. package gui; import java.awt.*; import java.awt.event.KeyEvent; import javax.swing.*; // Referenced classes of package gui: // MyJPanel, ChatDialog_jTextField1_keyAdapter, WarWindow public class ChatDialog extends JDialog { public ChatDialog(JFrame parent, WarWindow w) { super(parent, true); text = ""; borderLayout1 = new BorderLayout(); jPanel1 = new MyJPanel(); borderLayout2 = new BorderLayout(); jPanel2 = new MyJPanel(); jPanel3 = new MyJPanel(); jLabel1 = new JLabel(); jTextField1 = new JTextField(); warWindow = w; try { jbInit(); } catch(Exception exception) { System.out.println("Problem with ChatDialog init"); exception.printStackTrace(); } return; } public String getText() { return text; } void jTextField1_keyPressed(KeyEvent e) { int id = e.getKeyCode(); switch(id) { case 10: // '\n' text = jTextField1.getText(); setVisible(false); break; } } private void jbInit() throws Exception { setLocation(232, 450); setSize(560, 60); setModal(true); setResizable(false); setUndecorated(true); getContentPane().setLayout(borderLayout1); jPanel1.setLayout(borderLayout2); jPanel2.setMinimumSize(new Dimension(10, 20)); jPanel2.setPreferredSize(new Dimension(10, 20)); jLabel1.setPreferredSize(new Dimension(380, 15)); jLabel1.setHorizontalAlignment(0); jLabel1.setText("Chat Message"); jTextField1.setPreferredSize(new Dimension(520, 21)); jTextField1.setRequestFocusEnabled(false); jTextField1.addKeyListener(new ChatDialog_jTextField1_keyAdapter(this)); getContentPane().add(jPanel1, "Center"); jPanel1.add(jPanel2, "North"); jPanel2.add(jLabel1, null); jPanel1.add(jPanel3, "Center"); jPanel3.add(jTextField1, null); } public void setVisible(boolean b) { jTextField1.setText(""); super.setVisible(b); } public void showDialog(String msgText) { System.out.println("set ChatDialog: " + msgText); jLabel1.setText(msgText); jLabel1.repaint(); // I added this; it didn't help System.out.println("get ChatDialog: " + jLabel1.getText()); super.setVisible(true); } void this_keyPressed(KeyEvent e) { int id = e.getKeyCode(); switch(id) { case 10: // '\n' System.exit(88); break; } } BorderLayout borderLayout1; BorderLayout borderLayout2; JLabel jLabel1; JPanel jPanel1; JPanel jPanel2; JPanel jPanel3; JTextField jTextField1; String text; WarWindow warWindow; }

    Read the article

  • Struts Tiles application

    - by rav83
    Am trying a tiles application.Below is my code tiles-defs.xml </tiles-definitions> <definition name="${YOUR_DEFINITION_HERE}"> </definition> <definition name="commonPage" path="/jsps/template.jsp"> <put name="header" value="/jsps/header.jsp" /> <put name="menu" value="/jsps/menu.jsp" /> <put name="body" value="/jsps/homebody.jsp" /> <put name="footer" value="/jsps/footer.jsp" /> </definition> <definition name="aboutUsPage" extends="commonPage"> <put name="body" value="/jsps/aboutUsBody.jsp" /> </definition> </tiles-definitions> struts-config.xml <action path="/aboutus" type="java.com.mbest.core.action.AboutUsAction" parameter="method"> <forward name="success" path="aboutUsPage"/> <forward name="failure" path="aboutUsPage"/> </action> </action-mappings> template.jsp <%@ taglib uri="/WEB-INF/struts-tiles.tld" prefix="tiles" %> <html> <head><title></title></head> <body> <table border="1" cellspacing="0" cellpadding="0" style="width: 98%; height: 100%"> <tr> <td colspan="2"> <tiles:insert attribute="header"/> </td> </tr> <tr style="height: 500px"> <td valign="top" style="width: 200px"> <tiles:insert attribute="menu"/> </td> <td valign="baseline" align="left"> <tiles:insert attribute="body"/> </tr> <tr> <td colspan="2"> <tiles:insert attribute="footer"/> </td> </tr> </table> </body> </html> homebody.jsp <%@ taglib uri="/WEB-INF/struts-bean.tld" prefix="bean" %> <%@taglib uri="/WEB-INF/struts-html.tld" prefix="html"%> <%@taglib uri="/WEB-INF/struts-tiles.tld" prefix="tiles" %> <html> <head> <title></title> <style type="text/css"> <%@include file="../css/helper.css"%> <%@include file="../css/dropdown.css" %> <%@include file="../css/default.ultimate.css" %> </style> </head> <body> <div id="header"> <ul id="nav" class="dropdown dropdown-horizontal"> <li><span class="dir"><html:link page="/aboutus.do?method=aboutUsPage" >About Us</html:link></span></li> <li><span class="dir"><a href="./">Products</a></span></li> <li><span class="dir"><a href="./">Infrastructure</a></span></li> <li><span class="dir"><a href="./">Pharmaceutical Formulations</a></span></li> <li><span class="dir"><a href="./">Contact Us</a></span></li> </ul> </div> </body> </html> AboutUsAction.java package java.com.mindbest.core.action; import javax.servlet.http.HttpServletRequest; import javax.servlet.http.HttpServletResponse; import org.apache.struts.action.ActionForm; import org.apache.struts.action.ActionForward; import org.apache.struts.action.ActionMapping; import org.apache.struts.actions.DispatchAction; public class AboutUsAction extends DispatchAction { public ActionForward aboutUsPage(ActionMapping mapping,ActionForm form, HttpServletRequest request,HttpServletResponse response)throws Exception { return mapping.findForward("success"); } } aboutUsBody.jsp hello In my above code if i try to access the app using (domainname)/example/aboutus.do its giving 500 error.Can anyone help me figure this out?

    Read the article

  • Record audio via MediaRecorder

    - by Isuru Madusanka
    I am trying to record audio by MediaRecorder, and I get an error, I tried to change everything and nothing works. Last two hours I try to find the error, I used Log class too and I found out that error occurred when it call recorder.start() method. What could be the problem? public class AudioRecorderActivity extends Activity { MediaRecorder recorder; File audioFile = null; private static final String TAG = "AudioRecorderActivity"; private View startButton; private View stopButton; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); startButton = findViewById(R.id.start); stopButton = findViewById(R.id.stop); setContentView(R.layout.main); } public void startRecording(View view) throws IOException{ startButton.setEnabled(false); stopButton.setEnabled(true); File sampleDir = Environment.getExternalStorageDirectory(); try{ audioFile = File.createTempFile("sound", ".3gp", sampleDir); }catch(IOException e){ Toast.makeText(getApplicationContext(), "SD Card Access Error", Toast.LENGTH_LONG).show(); Log.e(TAG, "Sdcard access error"); return; } recorder = new MediaRecorder(); recorder.setAudioSource(MediaRecorder.AudioSource.MIC); recorder.setOutputFormat(MediaRecorder.OutputFormat.THREE_GPP); recorder.setAudioEncoder(MediaRecorder.AudioEncoder.AMR_NB); recorder.setAudioEncodingBitRate(16); recorder.setAudioSamplingRate(44100); recorder.setOutputFile(audioFile.getAbsolutePath()); recorder.prepare(); recorder.start(); } public void stopRecording(View view){ startButton.setEnabled(true); stopButton.setEnabled(false); recorder.stop(); recorder.release(); addRecordingToMediaLibrary(); } protected void addRecordingToMediaLibrary(){ ContentValues values = new ContentValues(4); long current = System.currentTimeMillis(); values.put(MediaStore.Audio.Media.TITLE, "audio" + audioFile.getName()); values.put(MediaStore.Audio.Media.DATE_ADDED, (int)(current/1000)); values.put(MediaStore.Audio.Media.MIME_TYPE, "audio/3gpp"); values.put(MediaStore.Audio.Media.DATA, audioFile.getAbsolutePath()); ContentResolver contentResolver = getContentResolver(); Uri base = MediaStore.Audio.Media.EXTERNAL_CONTENT_URI; Uri newUri = contentResolver.insert(base, values); sendBroadcast(new Intent(Intent.ACTION_MEDIA_SCANNER_SCAN_FILE, newUri)); Toast.makeText(this, "Added File" + newUri, Toast.LENGTH_LONG).show(); } } And here is the xml layout. <?xml version="1.0" encoding="utf-8"?> <RelativeLayout xmlns:android="http://schemas.android.com/apk/res/android" android:id="@+id/RelativeLayout1" android:layout_width="fill_parent" android:layout_height="fill_parent" android:orientation="vertical" > <Button android:id="@+id/start" android:layout_width="wrap_content" android:layout_height="wrap_content" android:layout_alignParentTop="true" android:layout_centerHorizontal="true" android:layout_marginTop="146dp" android:onClick="startRecording" android:text="Start Recording" /> <Button android:id="@+id/stop" android:layout_width="wrap_content" android:layout_height="wrap_content" android:layout_alignLeft="@+id/start" android:layout_below="@+id/start" android:layout_marginTop="41dp" android:enabled="false" android:onClick="stopRecording" android:text="Stop Recording" /> </RelativeLayout> And I added permission to AndroidManifest file. <?xml version="1.0" encoding="utf-8"?> <manifest xmlns:android="http://schemas.android.com/apk/res/android" package="in.isuru.audiorecorder" android:versionCode="1" android:versionName="1.0" > <uses-sdk android:minSdkVersion="8" /> <application android:icon="@drawable/ic_launcher" android:label="@string/app_name" > <activity android:name=".AudioRecorderActivity" android:label="@string/app_name" > <intent-filter> <action android:name="android.intent.action.MAIN" /> <category android:name="android.intent.category.LAUNCHER" /> </intent-filter> </activity> </application> <uses-permission android:name="android.permission.WRITE_EXTERNAL_STORAGE"/> <uses-permission android:name="android.permission.RECORD_AUDIO" /> </manifest> I need to record high quality audio. Thanks!

    Read the article

  • ResultSet Already closed error

    - by javatraniee
    why am i getting an error of resultset already closed error public class Server implements Runnable { private static int port=1600, maxConnections=0; public static Connection connnew=null; public static Connection connnew1=null; public static Statement stnew,stnew1,stnew2,stnew3,stnew4; public void getConnection() { try{ Class.forName("org.gjt.mm.mysql.Driver"); connnew= DriverManager.getConnection("jdbc:mysql://localhost/db_alldata","root","flashkit"); connnew1= DriverManager.getConnection("jdbc:mysql://localhost/db_main","root","flashkit"); stnew=connnew.createStatement(); stnew1=connnew.createStatement(); stnew2=connnew1.createStatement(); stnew3=connnew1.createStatement(); stnew4=connnew1.createStatement(); }catch (Exception e) { System.out.print("Get Connection Exception---"+new SimpleDateFormat("yyyy-MM-dd HH:mm:ss").format(new Date())+"----- "+e); } } public void closeConnection() { try{ if(!(connnew.isClosed())) { stnew.close(); stnew1.close(); connnew.close(); } if(!(connnew1.isClosed())) { stnew2.close(); stnew3.close(); stnew4.close(); connnew1.close(); } }catch (Exception e) { System.out.print("Close Connection Closing Exception-----"+new SimpleDateFormat("yyyy-MM-dd HH:mm:ss").format(new Date())+"-------"+e); } } Server() { try{ }catch(Exception ee) { System.out.print("Server Exceptions in main connection--"+new SimpleDateFormat("yyyy-MM-dd HH:mm:ss").format(new Date())+"------"+ee); } } public static void main(String[] args) throws SQLException { int i=0; Server STUD= new Server(); STUD.getConnection(); try { ServerSocket listener = new ServerSocket(port); Socket server; while((i++ < maxConnections) || (maxConnections == 0)) { @SuppressWarnings("unused") doComms connection; server = listener.accept(); try{ ResultSet checkconnection=stnew4.executeQuery("select count(*) from t_studentdetails"); if(checkconnection.next()) { //DO NOTHING IF EXCEPTION THEN CLOSE ALL CONNECTIONS AND OPEN NEW CONNECTIONS } }catch (Exception e) { System.out.print("Db Connection Lost Closing And Re-Opning It--------"+new SimpleDateFormat("yyyy-MM-dd HH:mm:ss").format(new Date())+"--------"+e); STUD.closeConnection(); STUD.getConnection(); } doComms conn_c= new doComms(server,stnew,stnew1,stnew2,stnew3); Thread t = new Thread(conn_c); t.start(); } }catch (IOException ioe) { System.out.println("Main IOException on socket listen: " + ioe); } } public void run() { } } class doComms implements Runnable { private Socket server; private String input; static Connection conn=null; static Connection conn1=null; static Statement st,st1,st2,st3; doComms(Socket server, Statement st,Statement st1,Statement st2,Statement st3 ) { this.server=server; doComms.st=st; doComms.st1=st1; doComms.st2=st2; doComms.st3=st3; } @SuppressWarnings("deprecation") public void run () { input=""; //char ch; try { DataInputStream in = new DataInputStream (server.getInputStream()); OutputStreamWriter outgoing=new OutputStreamWriter(server.getOutputStream()); while(!(null==(input=in.readLine()))) { savetodatabase(input,server.getPort(),outgoing); } //server.close(); } catch (IOException ioe) { System.out.println("RUN IOException on socket listen:-------"+new SimpleDateFormat("yyyy-MM-dd HH:mm:ss").format(new Date())+"----- " + ioe); ioe.printStackTrace(); } } public void savetodatabase(String line, int port1, OutputStreamWriter outgoing) { try { String Rollno="-",name="-",div="-",storeddate="-",storedtime="-",mailfrom=""; String newline=line; String unitid="-"; storeddate=new SimpleDateFormat("yyyy-MM-dd").format(new java.util.Date()); storedtime=new SimpleDateFormat("HH:mm:ss").format(new java.util.Date()); String sql2="delete from t_currentport where PortNumber='"+port1+"''"; st2.executeUpdate(sql2); sql2="insert into t_currentport (unitid, portnumber,thedate,thetime) values ('"+unitid+"','"+port1+"','"+storeddate+"','"+storedtime+"')"; st2.executeUpdate(sql2); String tablename=GetTable(); String sql="select * from t_studentdetails where Unitid='"+unitid+"'"; ResultSet rst=st2.executeQuery(sql); if(rst.next()) { Rollno=rst.getString("Rollno"); name=rst.getString("name"); div=rst.getString("div"); } String sql1="insert into studentInfo StoredDate,StoredTime,Subject,UnitId,Body,Status,Rollno,div,VehId,MailDate,MailTime,MailFrom,MailTo,Header,UnProcessedStamps) values('"+storeddate+"','"+storedtime+"','"+unitid+"','"+unitid+"','"+newline+"','Pending','"+Rollno+"','"+div+"','"+name+"','"+storeddate+"','"+storedtime+"','"+mailfrom+"','"+mailfrom+"','-','-')"; st1.executeUpdate(sql1); }catch(Exception e) { System.out.print("Save to db Connection Exception--"+new SimpleDateFormat("yyyy-MM-dd HH:mm:ss").format(new Date())+"-->"+e); } } }

    Read the article

  • HttpURLConnection! Connection.getInputStream is java.io.FileNotFoundException

    - by user3643283
    I created a method "UPLPAD2" to upload file to server. Splitting my file to packets(10MB). It's OK (100%). But when i call getInputStream, i get FileNotFoundException. I think, in loop, i make new HttpURLConnection to set "setRequestProperty". This is a problem. Here's my code: @SuppressLint("NewApi") public int upload2(URL url, String filePath, OnProgressUpdate progressCallBack, AtomicInteger cancelHandle) throws IOException { HttpURLConnection connection = null; InputStream fileStream = null; OutputStream out = null; InputStream in = null; HttpResponse response = new HttpResponse(); Log.e("Upload_Url_Util", url.getFile()); Log.e("Upload_FilePath_Util", filePath); long total = 0; try { // Write the request. // Read from filePath and upload to server (url) byte[] buf = new byte[1024]; fileStream = new FileInputStream(filePath); long lenghtOfFile = (new java.io.File(filePath)).length(); Log.e("LENGHT_Of_File", lenghtOfFile + ""); int totalPacket = 5 * 1024 * 1024; // 10 MB int totalChunk = (int) ((lenghtOfFile + (totalPacket - 1)) / totalPacket); String headerValue = ""; String contentLenght = ""; for (int i = 0; i < totalChunk; i++) { long from = i * totalPacket; long to = 0; if ((from + totalPacket) > lenghtOfFile) { to = lenghtOfFile; } else { to = (totalPacket * (i + 1)); } to = to - 1; headerValue = "bytes " + from + "-" + to + "/" + lenghtOfFile; contentLenght = "Content-Length:" + (to - from + 1); Log.e("Conten_LENGHT", contentLenght); connection = client.open(url); connection.setRequestMethod("POST"); connection.setRequestProperty("Content-Range", headerValue); connection.setRequestProperty("Content-Length", Long.toString(to - from + 1)); out = connection.getOutputStream(); Log.e("Lenght_Of_File", lenghtOfFile + ""); Log.e("Total_Packet", totalPacket + ""); Log.e("Total_Chunk", totalChunk + ""); Log.e("Header_Valure", headerValue); int read = 1; while (read > 0 && cancelHandle.intValue() == 0 && total < totalPacket * (i + 1)) { read = fileStream.read(buf); if (read > 0) { out.write(buf, 0, read); total += read; progressCallBack .onProgressUpdate((int) ((total * 100) / lenghtOfFile)); } } Log.e("TOTAL_", total + "------" + totalPacket * (i + 1)); Log.e("I_", i + ""); Log.e("LENGHT_Of_File", lenghtOfFile + ""); if (i < totalChunk - 1) { connection.disconnect(); } out.close(); } // Read the response. response.setHttpCode(connection.getResponseCode()); in = connection.getInputStream(); // I GET ERROR HERE. if (connection.getResponseCode() != HttpURLConnection.HTTP_OK) { throw new IOException("Unexpected HTTP response: " + connection.getResponseCode() + " " + connection.getResponseMessage()); } byte[] body = readFully(in); response.setBody(body); response.setHeaderFields(connection.getHeaderFields()); if (cancelHandle.intValue() != 0) { return 1; } JSONObject jo = new JSONObject(response.getBodyAsString()); Log.e("Upload_Body_res_", response.getBodyAsString()); if (jo.has("error")) { if (jo.has("code")) { int errCode = jo.getInt("code"); Log.e("Upload_Had_errcode", errCode + ""); return errCode; } else { return 504; } } Log.e("RESPONE_BODY_UPLOAD", response.getBodyAsString() + ""); return 0; } catch (Exception e) { e.printStackTrace(); Log.e("Http_UpLoad_Response_Exception", e.toString()); response.setHttpCode(connection.getResponseCode()); Log.e("ErrorCode_Upload_Util_Return", response.getHttpCode() + ""); if (connection.getResponseCode() == 200) { return 1; } else if (connection.getResponseCode() == 0) { return 1; } else { return response.getHttpCode(); } // Log.e("ErrorCode_Upload_Util_Return", response.getHttpCode()+""); } finally { if (fileStream != null) fileStream.close(); if (out != null) out.close(); if (in != null) in.close(); } } And Logcat 06-12 09:39:29.558: W/System.err(30740): java.io.FileNotFoundException: http://download-f77c.fshare.vn/upload/NRHAwh+bUCxjUtcD4cn9xqkADpdL32AT9pZm7zaboHLwJHLxOPxUX9CQxOeBRgelkjeNM5XcK11M1V-x 06-12 09:39:29.558: W/System.err(30740): at com.squareup.okhttp.internal.http.HttpURLConnectionImpl.getInputStream(HttpURLConnectionImpl.java:187) 06-12 09:39:29.563: W/System.err(30740): at com.fsharemobile.client.HttpUtil.upload2(HttpUtil.java:383) 06-12 09:39:29.563: W/System.err(30740): at com.fsharemobile.fragments.ExplorerFragment$7$1.run(ExplorerFragment.java:992) 06-12 09:39:29.568: W/System.err(30740): at java.lang.Thread.run(Thread.java:856) 06-12 09:39:29.568: E/Http_UpLoad_Response_Exception(30740): java.io.FileNotFoundException: http://download-f77c.fshare.vn/upload/NRHAwh+bUCxjUtcD4cn9xqkADpdL32AT9pZm7zaboHLwJHLxOPxUX9CQxOeBRgelkjeNM5XcK11M1V-x

    Read the article

  • Stacked up with web service configuration

    - by Allan Chua
    I'm currently stacked with the web service that im creating right now. when Testing it in local it all works fine but when I try to deploy it to the web server it throws me the following error An error occurred while trying to make a request to URI '...my web service URI here....'. This could be due to attempting to access a service in a cross-domain way without a proper cross-domain policy in place, or a policy that is unsuitable for SOAP services. You may need to contact the owner of the service to publish a cross-domain policy file and to ensure it allows SOAP-related HTTP headers to be sent. This error may also be caused by using internal types in the web service proxy without using the InternalsVisibleToAttribute attribute. Please see the inner exception for more details. here is my web config. <?xml version="1.0"?> <configuration> <configSections> </configSections> <system.webServer> <modules runAllManagedModulesForAllRequests="true"> </modules> <validation validateIntegratedModeConfiguration="false" /> <security> <requestFiltering> <requestLimits maxAllowedContentLength="2000000000" /> </requestFiltering> </security> </system.webServer> <connectionStrings> <add name="........" providerName="System.Data.SqlClient" /> </connectionStrings> <appSettings> <!-- Testing --> <add key="DataConnectionString" value="..........." /> </appSettings> <system.web> <compilation debug="true" targetFramework="4.0"> <buildProviders> <add extension=".rdlc" type="Microsoft.Reporting.RdlBuildProvider, Microsoft.ReportViewer.WebForms, Version=10.0.0.0, Culture=neutral, PublicKeyToken=b03f5f7f11d50a3a" /> </buildProviders> </compilation> <httpRuntime executionTimeout="1200" maxRequestLength="2000000" /> </system.web> <system.serviceModel> <serviceHostingEnvironment aspNetCompatibilityEnabled="true" multipleSiteBindingsEnabled="true" /> <behaviors> <serviceBehaviors> <behavior name="Service1"> <serviceMetadata httpGetEnabled="true" /> <serviceDebug includeExceptionDetailInFaults="true" /> <dataContractSerializer maxItemsInObjectGraph="2000000000" /> </behavior> <behavior name=""> <serviceMetadata httpGetEnabled="true" /> <serviceDebug includeExceptionDetailInFaults="false" /> </behavior> <behavior name="nextSPOTServiceBehavior"> <serviceMetadata httpsGetEnabled="true"/> <serviceDebug includeExceptionDetailInFaults="true" /> <dataContractSerializer maxItemsInObjectGraph="2000000000" /> </behavior> </serviceBehaviors> </behaviors> <bindings> <basicHttpBinding> <binding name="SecureBasic" closeTimeout="00:10:00" openTimeout="00:10:00" receiveTimeout="00:10:00" sendTimeout="00:10:00" maxBufferSize="2147483647" maxReceivedMessageSize="2147483647"> <security mode="Transport" /> <readerQuotas maxArrayLength="2000000" maxStringContentLength="2000000"/> </binding> <binding name="BasicHttpBinding_IDownloadManagerService" closeTimeout="00:10:00" openTimeout="00:10:00" receiveTimeout="00:10:00" sendTimeout="00:10:00" maxBufferSize="2147483647" maxReceivedMessageSize="2147483647"> <security mode="Transport" /> </binding> </basicHttpBinding> </bindings> <services> <service behaviorConfiguration="nextSPOTServiceBehavior" name="NextSPOTDownloadManagerWebServiceTester.Web.WebServices.DownloadManagerService"> <endpoint binding="basicHttpBinding" bindingConfiguration="SecureBasic" name="basicHttpSecure" contract="NextSPOTDownloadManagerWebServiceTester.Web.WebServices.IDownloadManagerService" /> <!--<endpoint binding="basicHttpBinding" bindingConfiguration="" name="basicHttp" contract="NextSPOTDownloadManagerWebServiceTester.Web.WebServices.IDownloadManagerService" />--> <!--<endpoint address="" binding="basicHttpBinding" bindingConfiguration="BasicHttpBinding_IDownloadManagerService" contract="NextSPOTDownloadManagerWebServiceTester.Web.WebServices.IDownloadManagerService" /> <endpoint address="mex" binding="mexHttpsBinding" contract="IMetadataExchange" />--> </service> </services > </system.serviceModel> </configuration>

    Read the article

  • What is the best strategy for populating a TableView from a service?

    - by alrutherford
    I have an application which has a potentially long running background process. I want this process to populate a TableView as results objects are generated. The results objects are added to an observableList and have properties which are bound to the columns in the usual fashion for JavaFX. As an example of this consider the following sample code Main Application import java.util.LinkedList; import javafx.application.Application; import javafx.collections.FXCollections; import javafx.collections.ObservableList; import javafx.event.ActionEvent; import javafx.event.EventHandler; import javafx.geometry.Insets; import javafx.scene.Group; import javafx.scene.Scene; import javafx.scene.control.Button; import javafx.scene.control.TableColumn; import javafx.scene.control.TableView; import javafx.scene.control.cell.PropertyValueFactory; import javafx.scene.layout.VBox; import javafx.stage.Stage; public class DataViewTest extends Application { private TableView<ServiceResult> dataTable = new TableView<ServiceResult>(); private ObservableList<ServiceResult> observableList; private ResultService resultService; public static void main(String[] args) { launch(args); } @Override public void start(Stage stage) { observableList = FXCollections.observableArrayList(new LinkedList<ServiceResult>()); resultService = new ResultService(observableList); Button refreshBtn = new Button("Update"); refreshBtn.setOnAction(new EventHandler<ActionEvent>() { @Override public void handle(ActionEvent arg0) { observableList.clear(); resultService.reset(); resultService.start(); } }); TableColumn<ServiceResult, String> nameCol = new TableColumn<ServiceResult, String>("Value"); nameCol.setCellValueFactory(new PropertyValueFactory<ServiceResult, String>("value")); nameCol.setPrefWidth(200); dataTable.getColumns().setAll(nameCol); // productTable.getItems().addAll(products); dataTable.setItems(observableList); Scene scene = new Scene(new Group()); stage.setTitle("Table View Sample"); stage.setWidth(300); stage.setHeight(500); final VBox vbox = new VBox(); vbox.setSpacing(5); vbox.setPadding(new Insets(10, 0, 0, 10)); vbox.getChildren().addAll(refreshBtn, dataTable); ((Group) scene.getRoot()).getChildren().addAll(vbox); stage.setScene(scene); stage.show(); } } Service public class ResultService extends Service<Void> { public static final int ITEM_COUNT = 100; private ObservableList<ServiceResult> observableList; /** * Construct service. * */ public ResultService(ObservableList<ServiceResult> observableList) { this.observableList = observableList; } @Override protected Task<Void> createTask() { return new Task<Void>() { @Override protected Void call() throws Exception { process(); return null; } }; } public void process() { for (int i = 0; i < ITEM_COUNT; i++) { observableList.add(new ServiceResult(i)); } } } Data public class ServiceResult { private IntegerProperty valueProperty; /** * Construct property object. * */ public ServiceResult(int value) { valueProperty = new SimpleIntegerProperty(); setValue(value); } public int getValue() { return valueProperty.get(); } public void setValue(int value) { this.valueProperty.set(value); } public IntegerProperty valueProperty() { return valueProperty; } } Both the service and the TableView share a reference to the observable list? Is this good practise in JavaFx and if not what is the correct strategy? If you hit the the 'Update' button the list will not always refresh to the ITEM_COUNT length. I believe this is because the observableList.clear() is interfering with the update which is running in the background thread. Can anyone shed some light on this?

    Read the article

  • Login or Register (Ruby on rails)

    - by DanielZ
    Hello stackoverflow, I'm working on an Ruby on Rails application (2.3.x) and i want to make a form that lets the user login or register. I want to do this in the same form. I have a JS function that replaces the form elements like this: Login form: <% form_for @user do |f| %> <div id="form"> <%= f.label :email, "E-mail" %> <%= f.text_field :email %> <%= f.label :password, "Password" %> <%= f.password_field :password %> <%= link_to "I don't have an account, "#", :id => "changeForm"%> <%= f.submit "Login" %> </div> <% end %> The id "changeForm" triggers a JS function that changes the form elements. So if you press the url the html looks like this: <% form_for @user do |f| %> <div id="form"> <%= f.label :name, "Name" %> <%= f.text_field :name %> <%= f.label :email, "E-mail" %> <%= f.text_field :email %> <%= f.label :password, "Password" %> <%= f.password_field :password %> <%= f.label :password_confirmation, "Password confirmation" %> <%= f.password_field :password_confirmation %> <%= link_to "I do have an account, "#", :id => "changeForm"%> <%= f.submit "Register" %> </div> <% end %> I added the neccesary validations to my user model: class User < ActiveRecord::Base attr_reader :password validates_presence_of :name, :email, :password validates_format_of :email, :with => /\A([^@\s]+)@((?:[-a-z0-9]+\.)+[a-z]{2,})\Z/i validates_confirmation_of :password But what happens when you fill in the email / password you get the errors that the name is missing and that the password fields aren't confirmed. So i could do some nasty programming in my user model like this: #if password_conf or the name are present the user has tried to register... if params[:user][:password_confirmation].present? || params[:user][:name].present? #so we'll try to save the user if @user.save #if the user is saved authenticate the user current_session.user = User.authenticate(params[:user]) #if the user is logged in? if current_session.user.present? flash[:notice] = "succesvully logged redirect_to some_routes_path else #not logged in... flash[:notice] = "Not logged in" render :action => "new" end else #user not saved render :action => "new" end else #So if the params[:user][:password_confirmation] or [:user][:name] weren't present we geuss the user wants to login... current_session.user = User.authenticate(params[:user]) #are we logged_in? if current_session.user.present? flash[:notice] = "Succesvully logged in" redirect_to some_routes_path else #errors toevoegen @user.errors.add(:email, "The combination of email/password isn't valid") @user.errors.add(:password," ") render :action => "new" end end end Without validations this (imho dirty code and should not be in the controller) works. But i want to use the validates_presence_of methods and i don't want to slap the "conventions over configurations" in the face. So another thing i have tried is adding a hidden field to the form: #login form <%= f.hidden_field :login, :value => true %> # and ofcourse set it to false if we want to register. And then i wanted to use the method: before_validation before_validation_on_create do |user| if params[:user].login == true #throws an error i know... validates_presence_of :email, :password validates_format_of :email, :with => /\A([^@\s]+)@((?:[-a-z0-9]+\.)+[a-z]{2,})\Z/i else validates_presence_of :name, :email, :password validates_format_of :email, :with => /\A([^@\s]+)@((?:[-a-z0-9]+\.)+[a-z]{2,})\Z/i validates_confirmation_of :password end end But this doesn't work because i can't access the params. And login isn't a attribute for the user object. But i thought that in this way i could validate the email and password params if the user wants to login. And all the other attrs if the user want to register. So all i could think of doesn't work how i want it to work. So my main goal is this: 1 form for login/register with the use of the validation methods in the user model. So if we want to login but don't fill in any information = give validation errors. And if the user wants to login but the email/password combination doens't match give the "@user.errors.add(:email, "the combination wasn't found in the db...")". And the same goes for user register... Thanks in advance!

    Read the article

  • SQL: Using a CASE Statement to update 1000 rows at once

    - by SoLoGHoST
    Ok, I would like to use a CASE STATEMENT for this, but I am lost with this. Basically, I need to update a ton of rows, but just on the "position" column. I need to update all "position" values from 0 - count(position) for each id_layout_position column per id_layout column. OK, here is a pic of what the table looks like: Now let's say I delete the circled row, this will remove position = 2 and give me: 0, 1, 3, 5, 6, 7, and 4. But I want to add something at the end now and make sure that it has the last possible position, but the positions are already messed up, so I need to reorder them like so before I insert the new row: 0, 1, 2, 3, 4, 5, 6. But it must be ordered by lowest first. So 0 stays at 0, 1 stays at 1, 3 gets changed to 2, the 4 at the end gets changed to a 3, 5 gets changed to 4, 6 gets changed to 5, and 7 gets changed to 6. Hopefully you guys get the picture now. I'm completely lost here. Also, note, this table is tiny compared to how fast it can grow in size, so it needs to be able to do this FAST, thus I was thinking on the CASE STATEMENT for an UPDATE QUERY. Here's what I got for a regular update, but I don't wanna throw this into a foreach loop, as it would take forever to do it. I'm using SMF (Simple Machines Forums), so it might look a little different, but the idea is the same, and CASE statements are supported... $smcFunc['db_query']('', ' UPDATE {db_prefix}dp_positions SET position = {int:position} WHERE id_layout_position = {int:id_layout_position} AND id_layout = {int:id_layout}', array( 'position' => $position++, 'id_layout_position' => (int) $id_layout_position, 'id_layout' => (int) $id_layout, ) ); Anyways, I need to apply some sort of CASE on this so that I can auto-increment by 1 all values that it finds and update to the next possible value. I know I'm doing this wrong, even in this QUERY. But I'm totally lost when it comes to CASES. Here's an example of a CASE being used within SMF, so you can see this and hopefully relate: $conditions = ''; foreach ($postgroups as $id => $min_posts) { $conditions .= ' WHEN posts >= ' . $min_posts . (!empty($lastMin) ? ' AND posts <= ' . $lastMin : '') . ' THEN ' . $id; $lastMin = $min_posts; } // A big fat CASE WHEN... END is faster than a zillion UPDATE's ;). $smcFunc['db_query']('', ' UPDATE {db_prefix}members SET id_post_group = CASE ' . $conditions . ' ELSE 0 END' . ($parameter1 != null ? ' WHERE ' . (is_array($parameter1) ? 'id_member IN ({array_int:members})' : 'id_member = {int:members}') : ''), array( 'members' => $parameter1, ) ); Before I do the update, I actually have a SELECT which throws everything I need into arrays like so: $disabled_sections = array(); $positions = array(); while ($row = $smcFunc['db_fetch_assoc']($request)) { if (!isset($disabled_sections[$row['id_group']][$row['id_layout']])) $disabled_sections[$row['id_group']][$row['id_layout']] = array( 'info' => $module_info[$name], 'id_layout_position' => $row['id_layout_position'] ); // Increment the positions... if (!is_null($row['position'])) { if (!isset($positions[$row['id_layout']][$row['id_layout_position']])) $positions[$row['id_layout']][$row['id_layout_position']] = 1; else $positions[$row['id_layout']][$row['id_layout_position']]++; } else $positions[$row['id_layout']][$row['id_layout_position']] = 0; } Thanks, I know if anyone can help me here it's definitely you guys and gals... Anyways, here is my question: How do I use a CASE statement in the first code example, so that I can update all of the rows in the position column from 0 - total # of rows found, that have that id_layout value and that id_layout_position value, and continue this for all different id_layout values in that table? Can I use the arrays above somehow? I'm sure I'll have to use the id_layout and id_layout_position values for this right? But how can I do this? Ok, guy, I get an error, saying "Hacking Attempt" with the following code: // Updating all positions in here. $smcFunc['db_query']('', ' SET @pos = 0; UPDATE {db_prefix}dp_positions SET position=@pos:=@pos+1 ORDER BY id_layout_position, position', array( ) ); Am I doing something wrong? Perhaps SMF has safeguards against this approach?? Perhaps I need to use a CASE STATEMENT instead?

    Read the article

  • Handling file upload in a non-blocking manner

    - by Kaliyug Antagonist
    The background thread is here Just to make objective clear - the user will upload a large file and must be redirected immediately to another page for proceeding different operations. But the file being large, will take time to be read from the controller's InputStream. So I unwillingly decided to fork a new Thread to handle this I/O. The code is as follows : The controller servlet /** * @see HttpServlet#doPost(HttpServletRequest request, HttpServletResponse * response) */ protected void doPost(HttpServletRequest request, HttpServletResponse response) throws ServletException, IOException { // TODO Auto-generated method stub System.out.println("In Controller.doPost(...)"); TempModel tempModel = new TempModel(); tempModel.uploadSegYFile(request, response); System.out.println("Forwarding to Accepted.jsp"); /*try { Thread.sleep(1000 * 60); } catch (InterruptedException e) { // TODO Auto-generated catch block e.printStackTrace(); }*/ request.getRequestDispatcher("/jsp/Accepted.jsp").forward(request, response); } The model class package com.model; import java.io.IOException; import java.util.concurrent.ExecutionException; import java.util.concurrent.Future; import javax.servlet.http.HttpServletRequest; import javax.servlet.http.HttpServletResponse; import com.utils.ProcessUtils; public class TempModel { public void uploadSegYFile(HttpServletRequest request, HttpServletResponse response) { // TODO Auto-generated method stub System.out.println("In TempModel.uploadSegYFile(...)"); /* * Trigger the upload/processing code in a thread, return immediately * and notify when the thread completes */ try { FileUploaderRunnable fileUploadRunnable = new FileUploaderRunnable( request.getInputStream()); /* * Future<FileUploaderRunnable> future = ProcessUtils.submitTask( * fileUploadRunnable, fileUploadRunnable); * * FileUploaderRunnable processed = future.get(); * * System.out.println("Is file uploaded : " + * processed.isFileUploaded()); */ Thread uploadThread = new Thread(fileUploadRunnable); uploadThread.start(); } catch (IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } /* * catch (InterruptedException e) { // TODO Auto-generated catch block * e.printStackTrace(); } catch (ExecutionException e) { // TODO * Auto-generated catch block e.printStackTrace(); } */ System.out.println("Returning from TempModel.uploadSegYFile(...)"); } } The Runnable package com.model; import java.io.File; import java.io.FileInputStream; import java.io.FileNotFoundException; import java.io.FileOutputStream; import java.io.IOException; import java.io.InputStream; import java.nio.ByteBuffer; import java.nio.channels.Channels; import java.nio.channels.ReadableByteChannel; public class FileUploaderRunnable implements Runnable { private boolean isFileUploaded = false; private InputStream inputStream = null; public FileUploaderRunnable(InputStream inputStream) { // TODO Auto-generated constructor stub this.inputStream = inputStream; } public void run() { // TODO Auto-generated method stub /* Read from InputStream. If success, set isFileUploaded = true */ System.out.println("Starting upload in a thread"); File outputFile = new File("D:/06c01_output.seg");/* * This will be changed * later */ FileOutputStream fos; ReadableByteChannel readable = Channels.newChannel(inputStream); ByteBuffer buffer = ByteBuffer.allocate(1000000); try { fos = new FileOutputStream(outputFile); while (readable.read(buffer) != -1) { fos.write(buffer.array()); buffer.clear(); } fos.flush(); fos.close(); readable.close(); } catch (FileNotFoundException e) { // TODO Auto-generated catch block e.printStackTrace(); } catch (IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } System.out.println("File upload thread completed"); } public boolean isFileUploaded() { return isFileUploaded; } } My queries/doubts : Spawning threads manually from the Servlet makes sense to me logically but scares me coding wise - the container isn't aware of these threads after all(I think so!) The current code is giving an Exception which is quite obvious - the stream is inaccessible as the doPost(...) method returns before the run() method completes : In Controller.doPost(...) In TempModel.uploadSegYFile(...) Returning from TempModel.uploadSegYFile(...) Forwarding to Accepted.jsp Starting upload in a thread Exception in thread "Thread-4" java.lang.NullPointerException at org.apache.coyote.http11.InternalInputBuffer.fill(InternalInputBuffer.java:512) at org.apache.coyote.http11.InternalInputBuffer.fill(InternalInputBuffer.java:497) at org.apache.coyote.http11.InternalInputBuffer$InputStreamInputBuffer.doRead(InternalInputBuffer.java:559) at org.apache.coyote.http11.AbstractInputBuffer.doRead(AbstractInputBuffer.java:324) at org.apache.coyote.Request.doRead(Request.java:422) at org.apache.catalina.connector.InputBuffer.realReadBytes(InputBuffer.java:287) at org.apache.tomcat.util.buf.ByteChunk.substract(ByteChunk.java:407) at org.apache.catalina.connector.InputBuffer.read(InputBuffer.java:310) at org.apache.catalina.connector.CoyoteInputStream.read(CoyoteInputStream.java:202) at java.nio.channels.Channels$ReadableByteChannelImpl.read(Unknown Source) at com.model.FileUploaderRunnable.run(FileUploaderRunnable.java:39) at java.lang.Thread.run(Unknown Source) Keeping in mind the point 1., does the use of Executor framework help me in anyway ? package com.utils; import java.util.concurrent.Future; import java.util.concurrent.ScheduledThreadPoolExecutor; public final class ProcessUtils { /* Ensure that no more than 2 uploads,processing req. are allowed */ private static final ScheduledThreadPoolExecutor threadPoolExec = new ScheduledThreadPoolExecutor( 2); public static <T> Future<T> submitTask(Runnable task, T result) { return threadPoolExec.submit(task, result); } } So how should I ensure that the user doesn't block and the stream remains accessible so that the (uploaded)file can be read from it?

    Read the article

  • How to give position zero of spinner a prompt value?

    - by Eugene H
    The database is then transferring the data to a spinner which I want to leave position 0 blank so I can add a item to the spinner with no value making it look like a prompt. I have been going at it all day. FAil after Fail MainActivity public class MainActivity extends Activity { Button AddBtn; EditText et; EditText cal; Spinner spn; SQLController SQLcon; ProgressDialog PD; @Override protected void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.activity_main); AddBtn = (Button) findViewById(R.id.addbtn_id); et = (EditText) findViewById(R.id.et_id); cal = (EditText) findViewById(R.id.et_cal); spn = (Spinner) findViewById(R.id.spinner_id); spn.setOnItemSelectedListener(new OnItemSelectedListenerWrapper( new OnItemSelectedListener() { @Override public void onItemSelected(AdapterView<?> parent, View view, int pos, long id) { SQLcon.open(); Cursor c = SQLcon.readData(); if (c.moveToPosition(pos)) { String name = c.getString(c .getColumnIndex(DBhelper.MEMBER_NAME)); String calories = c.getString(c .getColumnIndex(DBhelper.KEY_CALORIES)); et.setText(name); cal.setText(calories); } SQLcon.close(); // closing database } @Override public void onNothingSelected(AdapterView<?> parent) { // TODO Auto-generated method stub } })); SQLcon = new SQLController(this); // opening database SQLcon.open(); loadtospinner(); AddBtn.setOnClickListener(new OnClickListener() { @Override public void onClick(View v) { new MyAsync().execute(); } }); } public void loadtospinner() { ArrayList<String> al = new ArrayList<String>(); Cursor c = SQLcon.readData(); c.moveToFirst(); while (!c.isAfterLast()) { String name = c.getString(c.getColumnIndex(DBhelper.MEMBER_NAME)); String calories = c.getString(c .getColumnIndex(DBhelper.KEY_CALORIES)); al.add(name + ", Calories: " + calories); c.moveToNext(); } ArrayAdapter<String> aa1 = new ArrayAdapter<String>( getApplicationContext(), android.R.layout.simple_spinner_item, al); spn.setAdapter(aa1); // closing database SQLcon.close(); } private class MyAsync extends AsyncTask<Void, Void, Void> { @Override protected void onPreExecute() { super.onPreExecute(); PD = new ProgressDialog(MainActivity.this); PD.setTitle("Please Wait.."); PD.setMessage("Loading..."); PD.setCancelable(false); PD.show(); } @Override protected Void doInBackground(Void... params) { String name = et.getText().toString(); String calories = cal.getText().toString(); // opening database SQLcon.open(); // insert data into table SQLcon.insertData(name, calories); return null; } @Override protected void onPostExecute(Void result) { super.onPostExecute(result); loadtospinner(); PD.dismiss(); } } } DataBase public class SQLController { private DBhelper dbhelper; private Context ourcontext; private SQLiteDatabase database; public SQLController(Context c) { ourcontext = c; } public SQLController open() throws SQLException { dbhelper = new DBhelper(ourcontext); database = dbhelper.getWritableDatabase(); return this; } public void close() { dbhelper.close(); } public void insertData(String name, String calories) { ContentValues cv = new ContentValues(); cv.put(DBhelper.MEMBER_NAME, name); cv.put(DBhelper.KEY_CALORIES, calories); database.insert(DBhelper.TABLE_MEMBER, null, cv); } public Cursor readData() { String[] allColumns = new String[] { DBhelper.MEMBER_ID, DBhelper.MEMBER_NAME, DBhelper.KEY_CALORIES }; Cursor c = database.query(DBhelper.TABLE_MEMBER, allColumns, null, null, null, null, null); if (c != null) { c.moveToFirst(); } return c; } } Helper public class DBhelper extends SQLiteOpenHelper { // TABLE INFORMATTION public static final String TABLE_MEMBER = "member"; public static final String MEMBER_ID = "_id"; public static final String MEMBER_NAME = "name"; public static final String KEY_CALORIES = "calories"; // DATABASE INFORMATION static final String DB_NAME = "MEMBER.DB"; static final int DB_VERSION = 2; // TABLE CREATION STATEMENT private static final String CREATE_TABLE = "create table " + TABLE_MEMBER + "(" + MEMBER_ID + " INTEGER PRIMARY KEY AUTOINCREMENT, " + MEMBER_NAME + " TEXT NOT NULL," + KEY_CALORIES + " INT NOT NULL);"; public DBhelper(Context context) { super(context, DB_NAME, null, DB_VERSION); } @Override public void onCreate(SQLiteDatabase db) { db.execSQL(CREATE_TABLE); } @Override public void onUpgrade(SQLiteDatabase db, int oldVersion, int newVersion) { // TODO Auto-generated method stub db.execSQL("DROP TABLE IF EXISTS " + TABLE_MEMBER); onCreate(db); } }

    Read the article

  • VS 2010 SP1 and SQL CE

    - by ScottGu
    Last month we released the Beta of VS 2010 Service Pack 1 (SP1).  You can learn more about the VS 2010 SP1 Beta from Jason Zander’s two blog posts about it, and from Scott Hanselman’s blog post that covers some of the new capabilities enabled with it.   You can download and install the VS 2010 SP1 Beta here. Last week I blogged about the new Visual Studio support for IIS Express that we are adding with VS 2010 SP1. In today’s post I’m going to talk about the new VS 2010 SP1 tooling support for SQL CE, and walkthrough some of the cool scenarios it enables.  SQL CE – What is it and why should you care? SQL CE is a free, embedded, database engine that enables easy database storage. No Database Installation Required SQL CE does not require you to run a setup or install a database server in order to use it.  You can simply copy the SQL CE binaries into the \bin directory of your ASP.NET application, and then your web application can use it as a database engine.  No setup or extra security permissions are required for it to run. You do not need to have an administrator account on the machine. Just copy your web application onto any server and it will work. This is true even of medium-trust applications running in a web hosting environment. SQL CE runs in-memory within your ASP.NET application and will start-up when you first access a SQL CE database, and will automatically shutdown when your application is unloaded.  SQL CE databases are stored as files that live within the \App_Data folder of your ASP.NET Applications. Works with Existing Data APIs SQL CE 4 works with existing .NET-based data APIs, and supports a SQL Server compatible query syntax.  This means you can use existing data APIs like ADO.NET, as well as use higher-level ORMs like Entity Framework and NHibernate with SQL CE.  This enables you to use the same data programming skills and data APIs you know today. Supports Development, Testing and Production Scenarios SQL CE can be used for development scenarios, testing scenarios, and light production usage scenarios.  With the SQL CE 4 release we’ve done the engineering work to ensure that SQL CE won’t crash or deadlock when used in a multi-threaded server scenario (like ASP.NET).  This is a big change from previous releases of SQL CE – which were designed for client-only scenarios and which explicitly blocked running in web-server environments.  Starting with SQL CE 4 you can use it in a web-server as well. There are no license restrictions with SQL CE.  It is also totally free. Easy Migration to SQL Server SQL CE is an embedded database – which makes it ideal for development, testing, and light-usage scenarios.  For high-volume sites and applications you’ll probably want to migrate your database to use SQL Server Express (which is free), SQL Server or SQL Azure.  These servers enable much better scalability, more development features (including features like Stored Procedures – which aren’t supported with SQL CE), as well as more advanced data management capabilities. We’ll ship migration tools that enable you to optionally take SQL CE databases and easily upgrade them to use SQL Server Express, SQL Server, or SQL Azure.  You will not need to change your code when upgrading a SQL CE database to SQL Server or SQL Azure.  Our goal is to enable you to be able to simply change the database connection string in your web.config file and have your application just work. New Tooling Support for SQL CE in VS 2010 SP1 VS 2010 SP1 includes much improved tooling support for SQL CE, and adds support for using SQL CE within ASP.NET projects for the first time.  With VS 2010 SP1 you can now: Create new SQL CE Databases Edit and Modify SQL CE Database Schema and Indexes Populate SQL CE Databases within Data Use the Entity Framework (EF) designer to create model layers against SQL CE databases Use EF Code First to define model layers in code, then create a SQL CE database from them, and optionally edit the DB with VS Deploy SQL CE databases to remote servers using Web Deploy and optionally convert them to full SQL Server databases You can take advantage of all of the above features from within both ASP.NET Web Forms and ASP.NET MVC based projects. Download You can enable SQL CE tooling support within VS 2010 by first installing VS 2010 SP1 (beta). Once SP1 is installed, you’ll also then need to install the SQL CE Tools for Visual Studio download.  This is a separate download that enables the SQL CE tooling support for VS 2010 SP1. Walkthrough of Two Scenarios In this blog post I’m going to walkthrough how you can take advantage of SQL CE and VS 2010 SP1 using both an ASP.NET Web Forms and an ASP.NET MVC based application. Specifically, we’ll walkthrough: How to create a SQL CE database using VS 2010 SP1, then use the EF4 visual designers in Visual Studio to construct a model layer from it, and then display and edit the data using an ASP.NET GridView control. How to use an EF Code First approach to define a model layer using POCO classes and then have EF Code-First “auto-create” a SQL CE database for us based on our model classes.  We’ll then look at how we can use the new VS 2010 SP1 support for SQL CE to inspect the database that was created, populate it with data, and later make schema changes to it.  We’ll do all this within the context of an ASP.NET MVC based application. You can follow the two walkthroughs below on your own machine by installing VS 2010 SP1 (beta) and then installing the SQL CE Tools for Visual Studio download (which is a separate download that enables SQL CE tooling support for VS 2010 SP1). Walkthrough 1: Create a SQL CE Database, Create EF Model Classes, Edit the Data with a GridView This first walkthrough will demonstrate how to create and define a SQL CE database within an ASP.NET Web Form application.  We’ll then build an EF model layer for it and use that model layer to enable data editing scenarios with an <asp:GridView> control. Step 1: Create a new ASP.NET Web Forms Project We’ll begin by using the File->New Project menu command within Visual Studio to create a new ASP.NET Web Forms project.  We’ll use the “ASP.NET Web Application” project template option so that it has a default UI skin implemented: Step 2: Create a SQL CE Database Right click on the “App_Data” folder within the created project and choose the “Add->New Item” menu command: This will bring up the “Add Item” dialog box.  Select the “SQL Server Compact 4.0 Local Database” item (new in VS 2010 SP1) and name the database file to create “Store.sdf”: Note that SQL CE database files have a .sdf filename extension. Place them within the /App_Data folder of your ASP.NET application to enable easy deployment. When we clicked the “Add” button above a Store.sdf file was added to our project: Step 3: Adding a “Products” Table Double-clicking the “Store.sdf” database file will open it up within the Server Explorer tab.  Since it is a new database there are no tables within it: Right click on the “Tables” icon and choose the “Create Table” menu command to create a new database table.  We’ll name the new table “Products” and add 4 columns to it.  We’ll mark the first column as a primary key (and make it an identify column so that its value will automatically increment with each new row): When we click “ok” our new Products table will be created in the SQL CE database. Step 4: Populate with Data Once our Products table is created it will show up within the Server Explorer.  We can right-click it and choose the “Show Table Data” menu command to edit its data: Let’s add a few sample rows of data to it: Step 5: Create an EF Model Layer We have a SQL CE database with some data in it – let’s now create an EF Model Layer that will provide a way for us to easily query and update data within it. Let’s right-click on our project and choose the “Add->New Item” menu command.  This will bring up the “Add New Item” dialog – select the “ADO.NET Entity Data Model” item within it and name it “Store.edmx” This will add a new Store.edmx item to our solution explorer and launch a wizard that allows us to quickly create an EF model: Select the “Generate From Database” option above and click next.  Choose to use the Store.sdf SQL CE database we just created and then click next again.  The wizard will then ask you what database objects you want to import into your model.  Let’s choose to import the “Products” table we created earlier: When we click the “Finish” button Visual Studio will open up the EF designer.  It will have a Product entity already on it that maps to the “Products” table within our SQL CE database: The VS 2010 SP1 EF designer works exactly the same with SQL CE as it does already with SQL Server and SQL Express.  The Product entity above will be persisted as a class (called “Product”) that we can programmatically work against within our ASP.NET application. Step 6: Compile the Project Before using your model layer you’ll need to build your project.  Do a Ctrl+Shift+B to compile the project, or use the Build->Build Solution menu command. Step 7: Create a Page that Uses our EF Model Layer Let’s now create a simple ASP.NET Web Form that contains a GridView control that we can use to display and edit the our Products data (via the EF Model Layer we just created). Right-click on the project and choose the Add->New Item command.  Select the “Web Form from Master Page” item template, and name the page you create “Products.aspx”.  Base the master page on the “Site.Master” template that is in the root of the project. Add an <h2>Products</h2> heading the new Page, and add an <asp:gridview> control within it: Then click the “Design” tab to switch into design-view. Select the GridView control, and then click the top-right corner to display the GridView’s “Smart Tasks” UI: Choose the “New data source…” drop down option above.  This will bring up the below dialog which allows you to pick your Data Source type: Select the “Entity” data source option – which will allow us to easily connect our GridView to the EF model layer we created earlier.  This will bring up another dialog that allows us to pick our model layer: Select the “StoreEntities” option in the dropdown – which is the EF model layer we created earlier.  Then click next – which will allow us to pick which entity within it we want to bind to: Select the “Products” entity in the above dialog – which indicates that we want to bind against the “Product” entity class we defined earlier.  Then click the “Enable automatic updates” checkbox to ensure that we can both query and update Products.  When you click “Finish” VS will wire-up an <asp:EntityDataSource> to your <asp:GridView> control: The last two steps we’ll do will be to click the “Enable Editing” checkbox on the Grid (which will cause the Grid to display an “Edit” link on each row) and (optionally) use the Auto Format dialog to pick a UI template for the Grid. Step 8: Run the Application Let’s now run our application and browse to the /Products.aspx page that contains our GridView.  When we do so we’ll see a Grid UI of the Products within our SQL CE database. Clicking the “Edit” link for any of the rows will allow us to edit their values: When we click “Update” the GridView will post back the values, persist them through our EF Model Layer, and ultimately save them within our SQL CE database. Learn More about using EF with ASP.NET Web Forms Read this tutorial series on the http://asp.net site to learn more about how to use EF with ASP.NET Web Forms.  The tutorial series uses SQL Express as the database – but the nice thing is that all of the same steps/concepts can also now also be done with SQL CE.   Walkthrough 2: Using EF Code-First with SQL CE and ASP.NET MVC 3 We used a database-first approach with the sample above – where we first created the database, and then used the EF designer to create model classes from the database.  In addition to supporting a designer-based development workflow, EF also enables a more code-centric option which we call “code first development”.  Code-First Development enables a pretty sweet development workflow.  It enables you to: Define your model objects by simply writing “plain old classes” with no base classes or visual designer required Use a “convention over configuration” approach that enables database persistence without explicitly configuring anything Optionally override the convention-based persistence and use a fluent code API to fully customize the persistence mapping Optionally auto-create a database based on the model classes you define – allowing you to start from code first I’ve done several blog posts about EF Code First in the past – I really think it is great.  The good news is that it also works very well with SQL CE. The combination of SQL CE, EF Code First, and the new VS tooling support for SQL CE, enables a pretty nice workflow.  Below is a simple example of how you can use them to build a simple ASP.NET MVC 3 application. Step 1: Create a new ASP.NET MVC 3 Project We’ll begin by using the File->New Project menu command within Visual Studio to create a new ASP.NET MVC 3 project.  We’ll use the “Internet Project” template so that it has a default UI skin implemented: Step 2: Use NuGet to Install EFCodeFirst Next we’ll use the NuGet package manager (automatically installed by ASP.NET MVC 3) to add the EFCodeFirst library to our project.  We’ll use the Package Manager command shell to do this.  Bring up the package manager console within Visual Studio by selecting the View->Other Windows->Package Manager Console menu command.  Then type: install-package EFCodeFirst within the package manager console to download the EFCodeFirst library and have it be added to our project: When we enter the above command, the EFCodeFirst library will be downloaded and added to our application: Step 3: Build Some Model Classes Using a “code first” based development workflow, we will create our model classes first (even before we have a database).  We create these model classes by writing code. For this sample, we will right click on the “Models” folder of our project and add the below three classes to our project: The “Dinner” and “RSVP” model classes above are “plain old CLR objects” (aka POCO).  They do not need to derive from any base classes or implement any interfaces, and the properties they expose are standard .NET data-types.  No data persistence attributes or data code has been added to them.   The “NerdDinners” class derives from the DbContext class (which is supplied by EFCodeFirst) and handles the retrieval/persistence of our Dinner and RSVP instances from a database. Step 4: Listing Dinners We’ve written all of the code necessary to implement our model layer for this simple project.  Let’s now expose and implement the URL: /Dinners/Upcoming within our project.  We’ll use it to list upcoming dinners that happen in the future. We’ll do this by right-clicking on our “Controllers” folder and select the “Add->Controller” menu command.  We’ll name the Controller we want to create “DinnersController”.  We’ll then implement an “Upcoming” action method within it that lists upcoming dinners using our model layer above.  We will use a LINQ query to retrieve the data and pass it to a View to render with the code below: We’ll then right-click within our Upcoming method and choose the “Add-View” menu command to create an “Upcoming” view template that displays our dinners.  We’ll use the “empty” template option within the “Add View” dialog and write the below view template using Razor: Step 4: Configure our Project to use a SQL CE Database We have finished writing all of our code – our last step will be to configure a database connection-string to use. We will point our NerdDinners model class to a SQL CE database by adding the below <connectionString> to the web.config file at the top of our project: EF Code First uses a default convention where context classes will look for a connection-string that matches the DbContext class name.  Because we created a “NerdDinners” class earlier, we’ve also named our connectionstring “NerdDinners”.  Above we are configuring our connection-string to use SQL CE as the database, and telling it that our SQL CE database file will live within the \App_Data directory of our ASP.NET project. Step 5: Running our Application Now that we’ve built our application, let’s run it! We’ll browse to the /Dinners/Upcoming URL – doing so will display an empty list of upcoming dinners: You might ask – but where did it query to get the dinners from? We didn’t explicitly create a database?!? One of the cool features that EF Code-First supports is the ability to automatically create a database (based on the schema of our model classes) when the database we point it at doesn’t exist.  Above we configured  EF Code-First to point at a SQL CE database in the \App_Data\ directory of our project.  When we ran our application, EF Code-First saw that the SQL CE database didn’t exist and automatically created it for us. Step 6: Using VS 2010 SP1 to Explore our newly created SQL CE Database Click the “Show all Files” icon within the Solution Explorer and you’ll see the “NerdDinners.sdf” SQL CE database file that was automatically created for us by EF code-first within the \App_Data\ folder: We can optionally right-click on the file and “Include in Project" to add it to our solution: We can also double-click the file (regardless of whether it is added to the project) and VS 2010 SP1 will open it as a database we can edit within the “Server Explorer” tab of the IDE. Below is the view we get when we double-click our NerdDinners.sdf SQL CE file.  We can drill in to see the schema of the Dinners and RSVPs tables in the tree explorer.  Notice how two tables - Dinners and RSVPs – were automatically created for us within our SQL CE database.  This was done by EF Code First when we accessed the NerdDinners class by running our application above: We can right-click on a Table and use the “Show Table Data” command to enter some upcoming dinners in our database: We’ll use the built-in editor that VS 2010 SP1 supports to populate our table data below: And now when we hit “refresh” on the /Dinners/Upcoming URL within our browser we’ll see some upcoming dinners show up: Step 7: Changing our Model and Database Schema Let’s now modify the schema of our model layer and database, and walkthrough one way that the new VS 2010 SP1 Tooling support for SQL CE can make this easier.  With EF Code-First you typically start making database changes by modifying the model classes.  For example, let’s add an additional string property called “UrlLink” to our “Dinner” class.  We’ll use this to point to a link for more information about the event: Now when we re-run our project, and visit the /Dinners/Upcoming URL we’ll see an error thrown: We are seeing this error because EF Code-First automatically created our database, and by default when it does this it adds a table that helps tracks whether the schema of our database is in sync with our model classes.  EF Code-First helpfully throws an error when they become out of sync – making it easier to track down issues at development time that you might otherwise only find (via obscure errors) at runtime.  Note that if you do not want this feature you can turn it off by changing the default conventions of your DbContext class (in this case our NerdDinners class) to not track the schema version. Our model classes and database schema are out of sync in the above example – so how do we fix this?  There are two approaches you can use today: Delete the database and have EF Code First automatically re-create the database based on the new model class schema (losing the data within the existing DB) Modify the schema of the existing database to make it in sync with the model classes (keeping/migrating the data within the existing DB) There are a couple of ways you can do the second approach above.  Below I’m going to show how you can take advantage of the new VS 2010 SP1 Tooling support for SQL CE to use a database schema tool to modify our database structure.  We are also going to be supporting a “migrations” feature with EF in the future that will allow you to automate/script database schema migrations programmatically. Step 8: Modify our SQL CE Database Schema using VS 2010 SP1 The new SQL CE Tooling support within VS 2010 SP1 makes it easy to modify the schema of our existing SQL CE database.  To do this we’ll right-click on our “Dinners” table and choose the “Edit Table Schema” command: This will bring up the below “Edit Table” dialog.  We can rename, change or delete any of the existing columns in our table, or click at the bottom of the column listing and type to add a new column.  Below I’ve added a new “UrlLink” column of type “nvarchar” (since our property is a string): When we click ok our database will be updated to have the new column and our schema will now match our model classes. Because we are manually modifying our database schema, there is one additional step we need to take to let EF Code-First know that the database schema is in sync with our model classes.  As i mentioned earlier, when a database is automatically created by EF Code-First it adds a “EdmMetadata” table to the database to track schema versions (and hash our model classes against them to detect mismatches between our model classes and the database schema): Since we are manually updating and maintaining our database schema, we don’t need this table – and can just delete it: This will leave us with just the two tables that correspond to our model classes: And now when we re-run our /Dinners/Upcoming URL it will display the dinners correctly: One last touch we could do would be to update our view to check for the new UrlLink property and render a <a> link to it if an event has one: And now when we refresh our /Dinners/Upcoming we will see hyperlinks for the events that have a UrlLink stored in the database: Summary SQL CE provides a free, embedded, database engine that you can use to easily enable database storage.  With SQL CE 4 you can now take advantage of it within ASP.NET projects and applications (both Web Forms and MVC). VS 2010 SP1 provides tooling support that enables you to easily create, edit and modify SQL CE databases – as well as use the standard EF designer against them.  This allows you to re-use your existing skills and data knowledge while taking advantage of an embedded database option.  This is useful both for small applications (where you don’t need the scalability of a full SQL Server), as well as for development and testing scenarios – where you want to be able to rapidly develop/test your application without having a full database instance.  SQL CE makes it easy to later migrate your data to a full SQL Server or SQL Azure instance if you want to – without having to change any code in your application.  All we would need to change in the above two scenarios is the <connectionString> value within the web.config file in order to have our code run against a full SQL Server.  This provides the flexibility to scale up your application starting from a small embedded database solution as needed. Hope this helps, Scott P.S. In addition to blogging, I am also now using Twitter for quick updates and to share links. Follow me at: twitter.com/scottgu

    Read the article

< Previous Page | 147 148 149 150 151 152 153 154  | Next Page >