Search Results

Search found 1478 results on 60 pages for 'avi kumar manku'.

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

Page 16/60 | < Previous Page | 12 13 14 15 16 17 18 19 20 21 22 23  | Next Page >

  • How should I determine direction from a phone's orientation & accelerometer?

    - by Manoj Kumar
    I have an Android application which moves a ball based on the orientation of the phone. I've been using the following code to extract the data - but how do I use it to determine what direction the ball should actually travel in? public void onSensorChanged(int sensor, float[] values) { // TODO Auto-generated method stub synchronized (this) { Log.d("HIIIII :- ", "onSensorChanged: " + sensor + ", x: " + values[0] + ", y: " + values[1] + ", z: " + values[2]); if (sensor == SensorManager.SENSOR_ORIENTATION) { System.out.println("Orientation X: " + values[0]); System.out.println("Orientation Y: " + values[1]); System.out.println("Orientation Z: " + values[2]); } if (sensor == SensorManager.SENSOR_ACCELEROMETER) { System.out.println("Accel X: " + values[0]); System.out.println("Accel Y: " + values[1]); System.out.println("Accel Z: " + values[2]); } } }

    Read the article

  • Sound card not detected in 13.04

    - by Ganessh Kumar R P
    I have a problem with my sound card. I don't have volume up or down option anywhere. In the setting -> Sound I don't have any card detected. But when I run the command sudo aplay -l, I get the following output **** List of PLAYBACK Hardware Devices **** Failed to create secure directory (/home/ganessh/.config/pulse): Permission denied card 0: MID [HDA Intel MID], device 0: STAC92xx Analog [STAC92xx Analog] Subdevices: 0/1 Subdevice #0: subdevice #0 card 1: NVidia [HDA NVidia], device 3: HDMI 0 [HDMI 0] Subdevices: 1/1 Subdevice #0: subdevice #0 card 1: NVidia [HDA NVidia], device 7: HDMI 0 [HDMI 0] Subdevices: 1/1 Subdevice #0: subdevice #0 card 1: NVidia [HDA NVidia], device 8: HDMI 0 [HDMI 0] Subdevices: 1/1 Subdevice #0: subdevice #0 card 1: NVidia [HDA NVidia], device 9: HDMI 0 [HDMI 0] Subdevices: 1/1 Subdevice #0: subdevice #0 And the command lspci -v | grep -A7 -i "audio" outputs 00:1b.0 Audio device: Intel Corporation 5 Series/3400 Series Chipset High Definition Audio (rev 06) Subsystem: Dell Device 02a2 Flags: bus master, fast devsel, latency 0, IRQ 48 Memory at f0f20000 (64-bit, non-prefetchable) [size=16K] Capabilities: <access denied> Kernel driver in use: snd_hda_intel 00:1c.0 PCI bridge: Intel Corporation 5 Series/3400 Series Chipset PCI Express Root Port 1 (rev 06) (prog-if 00 [Normal decode]) -- 02:00.1 Audio device: NVIDIA Corporation GF106 High Definition Audio Controller (rev a1) Subsystem: Dell Device 02a2 Flags: bus master, fast devsel, latency 0, IRQ 17 Memory at d3efc000 (32-bit, non-prefetchable) [size=16K] Capabilities: <access denied> Kernel driver in use: snd_hda_intel 07:00.0 Network controller: Intel Corporation Ultimate N WiFi Link 5300 So, I assume that the drivers are properly installed but still I don't get any option in the settings or volume control. The same card used to work well back in 2010 versions(04 and 10) Any help is appreciated. Thanks

    Read the article

  • Testing web applications written in java

    - by Vinoth Kumar
    How do you test the web applications (both server side and client side code)? The testing method has to work irrespective of the framework used (struts, spring web mvc) etc. I am using Java for the server side code, Javascript and HTML for the client side code. This is the sample test case of what I am talking about: 1. When you click on a link, the pop up opens. 2. Change some value in the pop up (say a drop down value) and it gets saved in the DB. 3. Click the popup again, you get the changed values. Can we simulate this kind of thing using unit test cases? Is JUnit enough for this?

    Read the article

  • How to use unused space in ubuntu

    - by Ravi.Kumar
    I installed ubuntu on my machine with only 80 GB of memory anticipating that I will remove it later but now I want to keep it forever (until I am frustrated with linux). I have 500 GB in my machine and now I want to use that raw 420 GB of space. How I can I do that ? with "space/memory" I am referring to secondary memory not Ram. Here is output of : sudo fdisk -l Disk /dev/sda: 500.1 GB, 500107862016 bytes 255 heads, 63 sectors/track, 60801 cylinders, total 976773168 sectors Units = sectors of 1 * 512 = 512 bytes Sector size (logical/physical): 512 bytes / 512 bytes I/O size (minimum/optimal): 512 bytes / 512 bytes Disk identifier: 0x000dcb77 Device Boot Start End Blocks Id System /dev/sda1 * 2048 136718335 68358144 83 Linux

    Read the article

  • Attending MySQL Connect? Your Opinion Matters.

    - by Monica Kumar
    Take the MySQL Connect 2012 Survey Thanks to everyone who is at the first ever MySQL Connect Conference in San Francisco this weekend! Don't forget to take your Conference and Session Surveys. Your opinions help shape next year's conference. Take a survey for each of the sessions you attend and be entered into a drawing for one prize for $200 American Express Gift Certificate. Fill in the daily conference survey and be entered into a drawing for one prize for a $500 American Express Gift Card Surveys are located here. Make your opinion count! Take the survey now. Congratulations to Robin Schumacher from DataStax as he is the winner of the Saturday survey!

    Read the article

  • Object of type 'customObject' cannot be converted to type 'customObject'.

    - by Phani Kumar PV
    i am receiving the follwing error when i am invoking a custom object "Object of type 'customObject' cannot be converted to type 'customObject'." Following is the scenario when i am getting the error i am invoking a method in a dll dynamically. Load an assembly CreateInstance.... calling MethodInfo.Invoke() passing int, string as a parameter for my method is working fine = No exceptions are thrown. But if I try and pass a one of my own custom class objects as a parameter, then I get an ArgumentException exception, and it is not either an ArgumentOutOfRangeException or ArgumentNullException. "Object of type 'customObject' cannot be converted to type 'customObject'." I am doing this in a web application. The class file containing the method is in a different proj . also the custom object is a sepearte class in the same file. there is no such thing called a static aseembly in my code. I am trying to invoke a webmethod dynamically. this webmethod is having the customObject type as an input parameter. So when i invoke the webmethod i am dynamically creating the proxy assembly and all. From the same assembly i am trying to create an instance of the cusotm object assinging the values to its properties and then passing this object as a parameter and invoking the method. everything is dynamic and nothing is created static.. :( add reference is not used. Following is a sample code i tried to create it public static object CallWebService(string webServiceAsmxUrl, string serviceName, string methodName, object[] args) { System.Net.WebClient client = new System.Net.WebClient(); //-Connect To the web service using (System.IO.Stream stream = client.OpenRead(webServiceAsmxUrl + "?wsdl")) { //--Now read the WSDL file describing a service. ServiceDescription description = ServiceDescription.Read(stream); ///// LOAD THE DOM ///////// //--Initialize a service description importer. ServiceDescriptionImporter importer = new ServiceDescriptionImporter(); importer.ProtocolName = "Soap12"; // Use SOAP 1.2. importer.AddServiceDescription(description, null, null); //--Generate a proxy client. importer.Style = ServiceDescriptionImportStyle.Client; //--Generate properties to represent primitive values. importer.CodeGenerationOptions = System.Xml.Serialization.CodeGenerationOptions.GenerateProperties; //--Initialize a Code-DOM tree into which we will import the service. CodeNamespace nmspace = new CodeNamespace(); CodeCompileUnit unit1 = new CodeCompileUnit(); unit1.Namespaces.Add(nmspace); //--Import the service into the Code-DOM tree. This creates proxy code //--that uses the service. ServiceDescriptionImportWarnings warning = importer.Import(nmspace, unit1); if (warning == 0) //--If zero then we are good to go { //--Generate the proxy code CodeDomProvider provider1 = CodeDomProvider.CreateProvider("CSharp"); //--Compile the assembly proxy with the appropriate references string[] assemblyReferences = new string[5] { "System.dll", "System.Web.Services.dll", "System.Web.dll", "System.Xml.dll", "System.Data.dll" }; CompilerParameters parms = new CompilerParameters(assemblyReferences); CompilerResults results = provider1.CompileAssemblyFromDom(parms, unit1); //-Check For Errors if (results.Errors.Count > 0) { StringBuilder sb = new StringBuilder(); foreach (CompilerError oops in results.Errors) { sb.AppendLine("========Compiler error============"); sb.AppendLine(oops.ErrorText); } throw new System.ApplicationException("Compile Error Occured calling webservice. " + sb.ToString()); } //--Finally, Invoke the web service method Type foundType = null; Type[] types = results.CompiledAssembly.GetTypes(); foreach (Type type in types) { if (type.BaseType == typeof(System.Web.Services.Protocols.SoapHttpClientProtocol)) { Console.WriteLine(type.ToString()); foundType = type; } } object wsvcClass = results.CompiledAssembly.CreateInstance(foundType.ToString()); MethodInfo mi = wsvcClass.GetType().GetMethod(methodName); return mi.Invoke(wsvcClass, args); } else { return null; } } } I cant find anything static being done by me. any help is greatly appreciated. Regards, Phani Kumar PV

    Read the article

  • How to set BackGround color to a divider in JSplitPane

    - by Sunil Kumar Sahoo
    I have created a divider in JSplitPane. I am unable to set the color of divider. I want to set the color of divider. please help me how to set color of that divider import javax.swing.; import java.awt.; import java.awt.event.*; public class SplitPaneDemo { JFrame frame; JPanel left, right; JSplitPane pane; int lastDividerLocation = -1; public static void main(String[] args) { SplitPaneDemo demo = new SplitPaneDemo(); demo.makeFrame(); demo.frame.addWindowListener(new WindowAdapter() { public void windowClosing(WindowEvent e) { System.exit(0); } }); demo.frame.show(); } public JFrame makeFrame() { frame = new JFrame(); // Create a horizontal split pane. pane = new JSplitPane(JSplitPane.HORIZONTAL_SPLIT); left = new JPanel(); left.setBackground(Color.red); pane.setLeftComponent(left); right = new JPanel(); right.setBackground(Color.green); pane.setRightComponent(right); JButton showleft = new JButton("Left"); showleft.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { Container c = frame.getContentPane(); if (pane.isShowing()) { lastDividerLocation = pane.getDividerLocation(); } c.remove(pane); c.remove(left); c.remove(right); c.add(left, BorderLayout.CENTER); c.validate(); c.repaint(); } }); JButton showright = new JButton("Right"); showright.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { Container c = frame.getContentPane(); if (pane.isShowing()) { lastDividerLocation = pane.getDividerLocation(); } c.remove(pane); c.remove(left); c.remove(right); c.add(right, BorderLayout.CENTER); c.validate(); c.repaint(); } }); JButton showboth = new JButton("Both"); showboth.addActionListener(new ActionListener() { public void actionPerformed(ActionEvent e) { Container c = frame.getContentPane(); c.remove(pane); c.remove(left); c.remove(right); pane.setLeftComponent(left); pane.setRightComponent(right); c.add(pane, BorderLayout.CENTER); if (lastDividerLocation >= 0) { pane.setDividerLocation(lastDividerLocation); } c.validate(); c.repaint(); } }); JPanel buttons = new JPanel(); buttons.setLayout(new GridBagLayout()); buttons.add(showleft); buttons.add(showright); buttons.add(showboth); frame.getContentPane().add(buttons, BorderLayout.NORTH); pane.setPreferredSize(new Dimension(400, 300)); frame.getContentPane().add(pane, BorderLayout.CENTER); frame.pack(); pane.setDividerLocation(0.5); return frame; } } Thanks Sunil kumar Sahoo

    Read the article

  • How to Convert Videos to 3GP for Mobile Phones

    - by DigitalGeekery
    Would you like to play videos on your phone, but the device only supports 3GP files? We’ll show you how to convert popular video files into 3GP mobile phone video format with Pazera Free Video to 3GP Converter. Download the Pazera Free Video to 3GP Converter (Download link below). It will allow you to convert popular video files (AVI, MPEG, MP4, FLV, MKV, and MOV) to work on your mobile phone. There is no installation to run. You’ll just need to unzip the download folder and double-click the videoto3gp.exe file to run the application. To add video files to the queue, click on the Add files button. Browse for your file, and click Open.   Your video will be added to the Queue. You can add multiple files to the queue and convert them all at one time. The converter comes with several pre-configured profiles for conversion settings. To load a profile, select one from the Profile drop down list and then click the Load button. The settings in the panels at the bottom of the application will be automatically updated.   If you are a more advanced user, the options on the lower panels allow for adjusting settings to your liking. You can choose between 3GP and 3G2 (for some older phones), H.263, MPEG-4, and XviD video codecs, AAC or AMR-NB audio codecs, as well as a variety of bitrates, resolutions, etc.  By default, the converted file will be output to the same location as the input directory. You can change it by clicking the text box input radio button and browsing for a different folder. Click Convert to start the conversion process. A conversion output box will open and display the progress. When finished, click Close.   Now you’re ready to load the video onto your phone and enjoy.     Conclusion Pazera Free Video to 3GP Converter is not exactly the ultimate video conversion tool, but it is quick and simple enough for the average user to convert most video formats to 3GP. Plus, it’s portable. You can copy the folder to a USB drive and take it with you. Do you have some 3GP video files you’d like to convert to more common formats? Check out our earlier article on how to convert 3GP to AVI and MPEG for free. Link Download Pazera Free Video to 3GP Converter Similar Articles Productive Geek Tips Convert .3GP and .3G2 Files to AVI / MPEG for FreeExtract Audio from a Video File with Pazera Free Audio ExtractorConvert PDF Files to Word Documents and Other FormatsConvert YouTube Videos to MP3 with YouTube DownloaderFriday Fun: Watch HD Video Content with Meevid TouchFreeze Alternative in AutoHotkey The Icy Undertow Desktop Windows Home Server – Backup to LAN The Clear & Clean Desktop Use This Bookmarklet to Easily Get Albums Use AutoHotkey to Assign a Hotkey to a Specific Window Latest Software Reviews Tinyhacker Random Tips VMware Workstation 7 Acronis Online Backup DVDFab 6 Revo Uninstaller Pro Daily Motivator (Firefox) FetchMp3 Can Download Videos & Convert Them to Mp3 Use Flixtime To Create Video Slideshows Creating a Password Reset Disk in Windows Bypass Waiting Time On Customer Service Calls With Lucyphone MELTUP – "The Beginning Of US Currency Crisis And Hyperinflation"

    Read the article

  • Encoding h.264 with libavcodec/x264

    - by Leviathan
    I am attempting to encode video using libavcodec/libavformat. I'm trying to change the standard output-example.c from ffmpeg source. The AVI file is created on the disk, but the only sound is encoded. I tried adding a lot of options for x264 from here. All the other codecs works fine, mpeg2, mpeg4, mjpeg, xvid. In addition to specifying the parameters x264, I also set the codec to AVOutputFormat structure. That's all I've done. AVOutputFormat *pOutFormat; // in header file av_register_all(); AVCodec *codec = avcodec_find_encoder_by_name("libx264"); pOutFormat = guess_format("avi", NULL, NULL); pOutFormat->video_codec = codec->id; The debug output of my application: Output #0, mp4, to 'D:\1.avi': Stream #0.0: Video: libx264, yuv420p, 320x240, q=10-51, 500 kb/s, 90k tbn, 25 tbc Stream #0.1: Audio: aac, 44100 Hz, 1 channels, s16, 128 kb/s [libx264 @ 0x694010]using cpu capabilities: MMX2 SSE2Fast SSSE3 FastShuffle SSE4.2 [libx264 @ 0x694010]bitrate tolerance too small, using .01 [libx264 @ 0x694010]profile Main, level 2.0 [libx264 @ 0x694010]frame I:150 Avg QP:14.76 size: 2534 [libx264 @ 0x694010]mb I I16..4: 75.9% 0.0% 24.1% [libx264 @ 0x694010]final ratefactor: 17.57 [libx264 @ 0x694010]coded y,uvDC,uvAC intra: 42.7% 92.4% 47.4% [libx264 @ 0x694010]i16 v,h,dc,p: 11% 14% 2% 73% [libx264 @ 0x694010]i4 v,h,dc,ddl,ddr,vr,hd,vl,hu: 21% 18% 29% 5% 8% 10% 3% 3% 2% [libx264 @ 0x694010]kb/s:506.79

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • SIM to OIM Migration: A How-to Guide to Avoid Costly Mistakes (SDG Corporation)

    - by Darin Pendergraft
    In the fall of 2012, Oracle launched a major upgrade to its IDM portfolio: the 11gR2 release.  11gR2 had four major focus areas: More simplified and customizable user experience Support for cloud, mobile, and social applications Extreme scalability Clear upgrade path For SUN migration customers, it is critical to develop and execute a clearly defined plan prior to beginning this process.  The plan should include initiation and discovery, assessment and analysis, future state architecture, review and collaboration, and gap analysis.  To help better understand your upgrade choices, SDG, an Oracle partner has developed a series of three whitepapers focused on SUN Identity Manager (SIM) to Oracle Identity Manager (OIM) migration. In the second of this series on SUN Identity Manager (SIM) to Oracle Identity Manager (OIM) migration, Santosh Kumar Singh from SDG  discusses the proper steps that should be taken during the planning-to-post implementation phases to ensure a smooth transition from SIM to OIM. Read the whitepaper for Part 2: Download Part 2 from SDGC.com In the last of this series of white papers, Santosh will talk about Identity and Access Management best practices and how these need to be considered when going through with an OIM migration. If you have not taken the opportunity, please read the first in this series which discusses the Migration Approach, Methodology, and Tools for you to consider when planning a migration from SIM to OIM. Read the white paper for part 1: Download Part 1 from SDGC.com About the Author: Santosh Kumar Singh Identity and Access Management (IAM) Practice Leader Santosh, in his capacity as SDG Identity and Access Management (IAM) Practice Leader, has direct senior management responsibility for the firm's strategy, planning, competency building, and engagement deliverance for this Practice. He brings over 12+ years of extensive IT, business, and project management and delivery experience, primarily within enterprise directory, single sign-on (SSO) application, and federated identity services, provisioning solutions, role and password management, and security audit and enterprise blueprint. Santosh possesses strong architecture and implementation expertise in all areas within these technologies and has repeatedly lead teams in successfully deploying complex technical solutions. About SDG: SDG Corporation empowers forward thinking companies to strategize their future, realize their vision, and minimize their IT risk. SDG distinguishes itself by offering flexible business models to fit their clients’ needs; faster time-to-market with its pre-built solutions and frameworks; a broad-based foundation of domain experts, and deep program management expertise. (www.sdgc.com)

    Read the article

  • Import/rip/convert DVD to Adobe Premiere Pro for Mac

    - by alexyu2010
    For those who want to edit their videos, Adobe Premiere Pro will inevitably a good choice, it is a professional, real time, timeline based video editing software application that supports many video editing cards and plug-ins for accelerated processing, additional file format support and video/audio effects. Although Adobe Premiere Pro is said to be for professionals, is not so complicated that a hobbyist can't excel at using it in an hour or so. General file formats supported by Adobe Premiere Pro Up to now, Adobe Creative Suite has released several versions of Adobe Premiere Pro, including Adobe Premiere 1.0, Adobe Premiere 2.0, Adobe Premiere Pro CS3, Adobe Premiere Pro CS4 and the newly published Adobe Premiere Pro CS5. Although I saw diversity in file formats they support, I did find some common file formats supported by all of them, such as AVI, MOV, MPG. Importing DVD, Adobe Premiere Pro says "NO" It is obvious to all of us that Adobe Premiere Pro will never give DVD a hug, and it isn't rare to see that many people are really confused when they want to import their DVDs to Adobe Premiere Pro for editing. What to do? Yes, you may have noticed that, there is only a way out, that is ripping your DVDs to some formats workable with Adobe Premiere Pro natively, and this is what DVD to Adobe Premiere Pro can do. Importing DVD to Adobe Premiere Pro on Mac DVD to Adobe Premiere Pro converter for Mac is the specially designed application for ripping/converting DVD movies, DVD VOB files or DVD clips to Adobe Premiere Pro compatible AVI, MOV, MPG files with either DVD ripping tool and video converting tool within the versatile DVD to Adobe Premiere Pro converter who is a powerful program for dealing with DVD and videos perfectly. Mac DVD to Adobe Premiere Pro converter can work with a wide variety of files including DVD, VOB, AVI, WMV, MPG, MOV, MP4, DV, FLV, MKV, ASF, SWF, HD video for using with other editing tools like iMovie, FCP etc, play on QuickTime, iTunes, put on portable devices like iPod, iPhone, iPad, iRiver, BlackBerry, Gphone, Mobile Phone or upload to webistes such as YouTube, MySpace. DVD to Adobe Premiere Pro converter for Mac can also help you do some basic editing. You can trim, crop your DVD movie or DVD clip, apply special effect to make it more artistic, merge several DVD clips to a single one or tweak the output parameters for video and audio separately to get a better quality rendering. Besides, to get a good common of the process the preview widnows is also available for you.

    Read the article

  • Pourquoi réinventer la roue quand il y a Runnable ? La startup ambitionne de devenir le « YouTube du Code »

    Pourquoi réinventer la roue quand il y a Runnable ? La startup ambitionne de devenir le « YouTube du Code » Runnable, qui a récemment été lancé par une startup du même nom basée à Palo Alto avec pour objectif la facilitation de la découverte et de la réutilisation de portions de code, a annoncé qu'elle a soulevé une levée de fonds de 2 millions de dollars grâce à la participation de Sierra Ventures, Resolute VC, AngelPad et 500 startups.Yash Kumar Directeur Général et co-fondateur de la start-up...

    Read the article

  • Silverlight Cream for November 08, 2011 -- #1165

    - by Dave Campbell
    In this Issue: Brian Noyes, Michael Crump, WindowsPhoneGeek, Erno de Weerd, Jesse Liberty, Derik Whittaker, Sumit Dutta, Asim Sajjad, Dhananjay Kumar, Kunal Chowdhury, and Beth Massi. Above the Fold: Silverlight: "Working with Prism 4 Part 1: Getting Started" Brian Noyes WP7: "Getting Started with the Coding4Fun toolkit Tile Control" WindowsPhoneGeek LightSwitch: "How to Connect to and Diagram your SQL Express Database in Visual Studio LightSwitch" Beth Massi Shoutouts: Michael Palermo's latest Desert Mountain Developers is up Michael Washington's latest Visual Studio #LightSwitch Daily is up From SilverlightCream.com: Working with Prism 4 Part 1: Getting Started Brian Noyes has a series starting at SilverlightShow about Prism 4 ... this is the first one, so a good time to jump in and pick up on an intro and basic info about Prism plus building your first Prism app. 10 Laps around Silverlight 5 (Part 5 of 10) Michael Crump has Part 5 of his 10-part Silverlight 5 investigation up at SilverlightShow talking about all the various text features added in Silverlight 5 Beta: Text Tracking and Leading, Linked and MultiColumn, OpenType, etc. Getting Started with the Coding4Fun toolkit Tile Control WindowsPhoneGeek takes on the Tile control from the Coding4Fun toolkit... as usual, great tutorial... diagrams, code, explanation Using AppHarbor, Bitbucket and Mercurial with ASP.NET and Silverlight – Part 2 CouchDB, Cloudant and Hammock Erno de Weerd has Part 2 of his trilogy and he's trying to beat David Anson for the long title record :) ... in this episode, he's adding in cloud storage to the mix in a 35-step tutorial. Background Audio Jesse Liberty's talking about background Audio... and no not the Muzak in the elevator (do they still have that?) ... he's tlking about the WP7.1 BackgroundAudioPlayer Using the ToggleSwitch in WinRT/Metro (for C#) Derik Whittaker shows off the ToggleSwitch for WinRT/Metro... not a lot to be said about it, but he says it all :) Part 19 - Windows Phone 7 - Access Phone Contacts Sumit Dutta has Part 19! of his WP7 series up... talking today about getting a phone number from the directory using the PhoneNumberChooserTask ContextMenu using MVVM Asim Sajjad shows how to make the Context Menu ViewModel friendly in this short tutorial. Code to make call in Windows Phone 7 Dhananjay Kumar's latest WP7 post is explaining how to make a call programmatically using the PhoneCallTask launcher. Silverlight Page Navigation Framework - Basic Concept Kunal Chowdhury has a 3-part tutorial series on Silverlight Navigation up. This is the first in the series, and he hits the basics... what constitutes a Page, and how to get started with the navigation framework. How to Connect to and Diagram your SQL Express Database in Visual Studio LightSwitch Beth Massi's latest LightSwitch post is on using the Data Designer to easily crete and model database tables... during development this is in SQL Express, but can be deployed to most SQL server db you like Stay in the 'Light! Twitter SilverlightNews | Twitter WynApse | WynApse.com | Tagged Posts | SilverlightCream Join me @ SilverlightCream | Phoenix Silverlight User Group Technorati Tags: Silverlight    Silverlight 3    Silverlight 4    Windows Phone MIX10

    Read the article

  • WinXP Movie Maker Codec Error

    - by Bob Rivers
    Hi, I'm trying to use Windows XP Movie Maker, but when I try to import an AVI video, it shows an error telling me that it wasn't import due to an the fact that the codec wasn't available (I'm able to see the video using the windows media player) First, the error message suggested to enable the option "download codecs automatically" under "tools options general". I did it. But know the error tells me that the codec wasn't available and, if I already installed it, I should reinitialize movie maker. I also already did it... The error msg is: The file D:\movie1.avi cannot be imported because the codec required to play the file is not installed on your computer. If you have already tried to download and install the codec, close and restart Windows Movie Maker, and then try to import the file again. Any hint? TIA, Bob

    Read the article

  • SQLAuthority News – SQL Server 2012 Upgrade Technical Guide – A Comprehensive Whitepaper – (454 pages – 9 MB)

    - by pinaldave
    Microsoft has just released SQL Server 2012 Upgrade Technical Guide. This guide is very comprehensive and covers the subject of upgrade in-depth. This is indeed a helpful detailed white paper. Even writing a summary of this white paper would take over 100 pages. This further proves that SQL Server 2012 is quite an important release from Microsoft. This white paper discusses how to upgrade from SQL Server 2008/R2 to SQL Server 2012. I love how it starts with the most interesting and basic discussion of upgrade strategies: 1) In-place upgrades, 2) Side by side upgrade, 3) One-server, and 4) Two-server. This whitepaper is not just pure theory but is also an excellent source for some tips and tricks. Here is an example of a good tip from the paper: “If you want to upgrade just one database from a legacy instance of SQL Server and not upgrade the other databases on the server, use the side-by-side upgrade method instead of the in-place method.” There are so many trivia, tips and tricks that make creating the list seems humanly impossible given a short period of time. My friend Vinod Kumar, an SQL Server expert, wrote a very interesting article on SQL Server 2012 Upgrade before. In that article, Vinod addressed the most interesting and practical questions related to upgrades. He started with the fundamentals of how to start backup before upgrade and ended with fail-safe strategies after the upgrade is over. He covered end-to-end concepts in his blog posts in simple words in extremely precise statements. A successful upgrade uses a cycle of: planning, document process, testing, refine process, testing, planning upgrade window, execution, verifying of upgrade and opening for business. If you are at Vinod’s blog post, I suggest you go all the way down and collect the gold mine of most important links. I have bookmarked the blog by blogging about it and I suggest that you bookmark it as well with the way you prefer. Vinod Kumar’s blog post on SQL Server 2012 Upgrade Technical Guide SQL Server 2012 Upgrade Technical Guide is a detailed resource that’s also available online for free. Each chapter was carefully crafted and explained in detail. Here is a quick list of the chapters included in the whitepaper. Before downloading the guide, beware of its size of 9 MB and 454 pages. Here’s the list of chapters: Chapter 1: Upgrade Planning and Deployment Chapter 2: Management Tools Chapter 3: Relational Databases Chapter 4: High Availability Chapter 5: Database Security Chapter 6: Full-Text Search Chapter 7: Service Broker Chapter 8: SQL Server Express Chapter 9: SQL Server Data Tools Chapter 10: Transact-SQL Queries Chapter 11: Spatial Data Chapter 12: XML and XQuery Chapter 13: CLR Chapter 14: SQL Server Management Objects Chapter 15: Business Intelligence Tools Chapter 16: Analysis Services Chapter 17: Integration Services Chapter 18: Reporting Services Chapter 19: Data Mining Chapter 20: Other Microsoft Applications and Platforms Appendix 1: Version and Edition Upgrade Paths Appendix 2: SQL Server 2012: Upgrade Planning Checklist Download SQL Server 2012 Upgrade Technical Guide [454 pages and 9 MB] Reference: Pinal Dave (http://blog.sqlauthority.com) Filed under: Database, DBA, PostADay, SQL, SQL Authority, SQL Documentation, SQL Download, SQL Query, SQL Server, SQL Tips and Tricks, SQL White Papers, SQLAuthority News, SQLServer, T SQL, Technology

    Read the article

  • Can't write to file - 'Operation not permitted' WITH sudo

    - by charliehorse55
    I am having trouble writing to a few files on an external HD. I am using it to store media files as well as my time machine backup. The drive is formatted as HFS+ Journaled, and other files on the drive can be written successfully. Additionally, the time machine backup is working perfectly. Permissions for the file: $ ls -le -@ Parks\ and\ Recreation\ -\ S01E01.avi -rw-rw-rw-@ 1 evantandersen staff 182950496 22 May 2009 Parks and Recreation - S01E01.avi com.apple.FinderInfo 32 Things I have already tried: sudo chflags -N sudo chown myusername sudo chown 666 sudo chgrp staff Checked that the file is not locked (get info in finder) Why can't I modify that file? Even with sudo I can't modify it at all.

    Read the article

  • Silverlight Cream for June 21, 2011 -- #1110

    - by Dave Campbell
    In this Issue: Colin Eberhardt, Kunal Chowdhury(-2-), Peter Kuhn(-2-, -3-), Mike Gold, WindowsPhoneGeek, Nigel Sampson, Paul Sheriff, Dhananjay Kumar, and Erno de Weerd. Above the Fold: Silverlight: "Silverlight Debug Helper" Peter Kuhn3 WP7: "Metro In Motion #8 – AutoCompleteBox Reveal Animation" Colin Eberhardt Shoutouts: Check out the Top 5 from my friends at SilverlightShow from last week: SilverlightShow for June 13 - 19, 2011 From SilverlightCream.com: Metro In Motion #8 – AutoCompleteBox Reveal Animation Colin Eberhardt found yet another 'Metro In Motion' to duplicate... this one is the auto-complete effect seen in the WP7 email client... check out the video on the post! Windows Phone 7 (Mango) Tutorial - 16 - How to Create a WP7 Alarm Application? Kunal Chowdhury has a couple more of his Mango tutorials up... number 16 (!) is on creating an Alarm app using scheduled tasks. Windows Phone 7 (Mango) Tutorial - 17 - How to Create a WP7 Reminder Application? Kunal Chowdhury's latest is number 17 in the Mango series and he's discussing the Reminder class which is part of the Scheduler namespace. Silverlight Debug Helper Peter Kuhn has deployed a new version of his "Silverlight Debug Helper"... this time he's added support for FireFox and Chrome. Getting ready for the Windows Phone 7 Exam 70-599 (Part 3) Peter Kuhn also has Part 3 of his series posted at SilverlightShow on getting ready for the WP7 exam. XNA for Silverlight developers: Part 13 - Mango (2) Finally, Peter Kuhn's latest XNA for Silverlight developers tutorial is up at SilverlightShow and is the 2nd Mango post for game devs. Detecting Altitude using the WP7 Phone WindowsPhoneGeek apparently turned the reigns of his blog over to Mike Gold for this post about Altitude detection on the WP7. Windows Phone Mango: Getting Started with MVVM in 10 Minutes If you're out there and still haven't gotten your head around MVVM, or want to take another look at why you're beating yourself up doing it [ :) ]... WindowsPhoneGeek has a quick write-up on MVVM and WP7.1 apps Creating app promotional videos Nigel Sampson details how he uses Expression Encoder to produce the app videos he has on his blog for his WP7* apps. Sort Data in Windows Phone using Collection View Source Paul Sheriff's latest post is up, and is another WP7 post. This time on how to sort the data you consume by using a CollectionViewSource object in XAML and not write any code! Viewing Flickr Images on Windows 7.1 Phone or Mango Phone Dhananjay Kumar has a tutorial up for WP7.1 showing how to use the Flickr REST service to display images on your device. Windows Phone 7: Drawing graphics for your application with Inkscape – Part II: Icons Part 2 of Erno de Weerd's Trilogy on Drawing graphics for your WP7* apps in Inkscape is up... this tutorial is all about icons... good stuff! Stay in the 'Light! Twitter SilverlightNews | Twitter WynApse | WynApse.com | Tagged Posts | SilverlightCream Join me @ SilverlightCream | Phoenix Silverlight User Group Technorati Tags: Silverlight    Silverlight 3    Silverlight 4    Windows Phone MIX10

    Read the article

  • Can mediatomb VLC profile transcode audio as MP3 rather than mpga ?

    - by djangofan
    In the /etc/mediatomb/config.xml, can mediatomb VLC profile transcode audo as MP3 rather than mpga ? My Sony GoogleTV wont render streamed .avi files files with a mpga audio in them. The original files are Divx encoded with 128kbs MP3 audio but mediatomb is transcoding them. How can I change this? Any ideas? Can I turn off the audio and video transcoding somehow? I need some ideas to try. <profile name="vlcprof" enabled="yes" type="external"> <mimetype>video/mpeg</mimetype> <agent command="vlc" arguments="-I dummy %in --sout #transcode{venc=ffmpeg,vcodec=mp2v,vb=4096,fps=25,aenc=ffmpeg,acodec=mpga,ab=192,samplerate=44100,channels=2}:standard{access=file,mux=ps,dst=%out} vlc:quit"/> <buffer size="10485760" chunk-size="131072" fill-size="2621440"/> <accept-url>yes</accept-url> <first-resource>yes</first-resource> </profile> I know that that MP3 encoding support is external to FFmpeg and must be configured appropriately, but I have no idea how to handle that. I would guess I can work around that by somehow telling ffmpeg to not transcode the audio stream? Also, should I create a separate vlcprof entry for video/avi ? Can you create more than one profile for VLC in the config.xml for mediatomb?

    Read the article

  • Silverlight Cream for March 13, 2011 -- #1059

    - by Dave Campbell
    In this Issue: András Velvárt, WIndowsPhoneGeek(-2-), Jesse Liberty(-2-), Victor Gaudioso, Kunal Chowdhury, Jeremy Likness, Michael Crump, and Dhananjay Kumar. Above the Fold: Silverlight: "Application Library Caching in Silverlight 4" Kunal Chowdhury WP7: "Handling WP7 orientation changes via Visual States" András Velvárt Shoutouts: Joe McBride gave a MEF Head User Group presentation and has posted How to Become a MEF Head – Slides & Code From SilverlightCream.com: Handling WP7 orientation changes via Visual States András Velvárt has an Expression Blend/WP7 post up discussing WP7 orientation changes and handling them via Visual States ... see an example from his SurfCube app, and a behavior to handle the control... with source. WP7 PerformanceProgressBar in depth WIndowsPhoneGeek has a post up discussing the WP7 Performance bar from the Windows Phone Toolkit. This is an update on the Toolkit based on the Feb 2011 release. Great explanation of the PerformanceProgressBar, external links, and sample code. Getting data out of WP7 WMAppManifest is easy with Coding4Fun PhoneHelper Next WindowsPhoneGeek has a post up about the PhoneHelper in the Coding4Fun TOolkit, and using it to get data out of the WMAppManifest easily. Good discussion, Links, and code as always Silverlight Unit Test For Phone In Jesse Liberty's "Windows Phone From Scratch" number 41, he's discussing Unit Testing for WP7... he gives some good external links and some good examples. Yet Another Podcast #27–Paul Betts Jesse Liberty's next post is his "Yet Another Podcast" number 27, and an interview with Paul Betts, the creator of Reactive UI... check out the podcast and also the good links listed. New Silverlight Video Tutorial: How to use the Fluid Move Behavior Victor Gaudioso has a new video tutorial up on using the Fluid Move Behavior... making a selected item animate from a ListBox to a Master Details Grid. Application Library Caching in Silverlight 4 Kunal Chowdhury takes a break from SilverlightZone long enough to write a post about Application Library Caching... for example on-demand loading of a 3rd-party XAP. Jounce Part 13: Navigation Parameters Jeremy Likness has his 13th post of a series in understanding his Jounce MVVM framework up. This episode surrounds a new release and what it contains, the primary focus being navigation parameters... that is you can raise a navigation event with a payload. Profiling Silverlight Applications after installing Visual Studio 2010 Service Pack 1 Michael Crump digs into the performance wizard for Silverlight that we get with VS2010 SP1. He shows how to get and read a profile... great intro to a new tool. Binding XML File to Data Grid in Silverlight Dhananjay Kumar demonstrates reading an XML file using LINQ to XML and binding the result to a Silverlight DataGrid Stay in the 'Light! Twitter SilverlightNews | Twitter WynApse | WynApse.com | Tagged Posts | SilverlightCream Join me @ SilverlightCream | Phoenix Silverlight User Group Technorati Tags: Silverlight    Silverlight 3    Silverlight 4    Windows Phone MIX10

    Read the article

  • One codec to rule them all

    - by AngryHacker
    I am streaming videos in my house via Windows Media Player Streaming, which is basically DLNA. So theoretically any DLNA compliant device can pick up the stream. However, I've quickly found that this is only one part of the solution. Over the years I've accumulated a ton of video-capable devices. While all these devices can see the Windows Media Player stream, they all speak in different codecs. And frankly, I am confused by codecs. In the beginning, I thought that the codecs were defined by the filename extension they carried (e.g. avi, mp4, wmv, etc...), but after further research, it looks like the extensions are simply containers. Inside an .avi file could reside several different codecs. So my question is this: is there a format/codec that plays equally well on any device.

    Read the article

  • Silverlight Cream for March 07, 2011 -- #1055

    - by Dave Campbell
    In this Issue: Max Paulousky, Chris Rouw, David Anson, Jesse Liberty, Shawn Wildermuth, Simon Guindon, and Dhananjay Kumar. Above the Fold: Silverlight: "Faster Databinding in WPF and Silverlight using OptimizedObservableCollection" Simon Guindon WP7: "Phoney Tools Updated (WP7 Open Source Library)" Shawn Wildermuth From SilverlightCream.com: Problems With Sharing Windows Phone 7 Applications Within A Large Group Of Beta Testers Max Paulousky has a post up discussing the issues surrounding beta testing a WP7 app with a large group of testers... and how to pull it all off. WP7 Insights #1: Consuming REST APIs within a WP7 app Chris Rouw is beginning a WP7 series based on his recent experience of getting a client's app into the marketplace. This first in his series is on consuming REST APIs ... lots of good code and explanations. Improving Windows Phone 7 application performance is even easier with these LowProfileImageLoader and DeferredLoadListBox updates David Anson has an update to his LowProfileImageLoader and DeferredLoadListBox after issues brought up by readers... so we all win with the great feedback from alert devs. When Isolated Storage Isn’t Enough Jesse Liberty started looking at Jeremy Likness' Sterling with this post in the WP7 From Scratch series. He starts with downloading it from CodePlex ... great way to get into Sterling if you haven't already. Phoney Tools Updated (WP7 Open Source Library) Shawn Wildermuth has the latest drop of his Phoney Tools up... this is the last Alpha. I've added a tag for it as well. He's fixed some things, added others... check out the post and go grab the code. Faster Databinding in WPF and Silverlight using OptimizedObservableCollection Simon Guindon is a blogger I've not been following, but this post on an OptimizedObservableCollection caught my eye. He added an AddRange() to the ObservableCollection to get a speed enhancement when adding items... and a pretty good speed enhancement it is. Reading files asynchronously using WebClient class in Silverlight Dhananjay Kumar is another prolific blogger that I've not been following, so we'll start with his latest... a step-by-step guide to reading an XML file asynchronously. Stay in the 'Light! Twitter SilverlightNews | Twitter WynApse | WynApse.com | Tagged Posts | SilverlightCream Join me @ SilverlightCream | Phoenix Silverlight User Group Technorati Tags: Silverlight    Silverlight 3    Silverlight 4    Windows Phone MIX10

    Read the article

  • Problem with xvideoservice thief

    - by Nrew
    Xvideo service thief is an application that allows you to download and convert youtube videos into .avi format. The problem is when it tries to convert the .flv into a .avi. The audio in the video is not being played when you try to play the video. But the .flv works fine. I have also enabled Intel(R) speedstep feature in my processor(Pentium Dual core E5200) to decrease the power consumed by the processor with the help of Granola software. What might be the reason for the audio less video converter by xvideo service thief? Could it be the enabling of intel(R) speedstep? Because the software works fine when its not enabled. Is this possible?That the output some applications can be altered when enabling this processor feature?

    Read the article

facebook twitter digg google delicious technorati stumbleupon myspace wordpress linkedin gmail igoogle windows live tumblr viadeo yahoo buzz yahoo mail yahoo bookmarks favorites email print

< Previous Page | 12 13 14 15 16 17 18 19 20 21 22 23  | Next Page >