Search Results

Search found 13006 results on 521 pages for 'exception'.

Page 160/521 | < Previous Page | 156 157 158 159 160 161 162 163 164 165 166 167  | Next Page >

  • Is it OK to open a DB4o file for query, insert, update multiple times?

    - by Khnle
    This is the way I am thinking of using DB4o. When I need to query, I would open the file, read and close: using (IObjectContainer db = Db4oFactory.OpenFile(Db4oFactory.NewConfiguration(), YapFileName)) { try { List<Pilot> pilots = db.Query<Pilot>().ToList<Pilot>(); } finally { try { db.Close(); } catch (Exception) { }; } } At some later time, when I need to insert, then using (IObjectContainer db = Db4oFactory.OpenFile(Db4oFactory.NewConfiguration(), YapFileName)) { try { Pilot pilot1 = new Pilot("Michael Schumacher", 100); db.Store(pilot1); } finally { try { db.Close(); } catch (Exception) { }; } } In this way, I thought I will keep the file more tidy by only having it open when needed, and have it closed most of the time. But I keep getting InvalidCastException Unable to cast object of type 'Db4objects.Db4o.Reflect.Generic.GenericObject' to type 'Pilot' What's the correct way to use DB4o?

    Read the article

  • Can't add domain users to Reporting Services 2008

    - by Jeremy
    I have SSRS 2008 setup on the database server. The server is part of the domain. Reporting Services is running under NetworkService. When I try to add a domain user using the web interface (Site Settings -- Security -- New Role Assignment), the page posts back but the user is not in the list. The server's log file contains the following Unhandled Exception: ui!ReportManager_0-1!954!01/12/2009-10:14:52:: Unhandled exception: System.Security.Principal.IdentityNotMappedException: Some or all identity references could not be translated. at System.Security.Principal.SecurityIdentifier.Translate(IdentityReferenceCollection sourceSids, Type targetType, Boolean forceSuccess) at System.Security.Principal.SecurityIdentifier.Translate(Type targetType) at System.Security.Principal.WindowsIdentity.GetName() at System.Security.Principal.WindowsIdentity.get_Name() at ReportingServicesHttpRuntime.RsWorkerRequest.GetServerVariable(String name) at System.Web.Security.WindowsAuthenticationModule.OnEnter(Object source, EventArgs eventArgs) at System.Web.HttpApplication.SyncEventExecutionStep.System.Web.HttpApplication.IExecutionStep.Execute() at System.Web.HttpApplication.ExecuteStep(IExecutionStep step, Boolean& completedSynchronously) Any one have an idea on how to fix this?

    Read the article

  • ASP.NET Connection time out after being idle for a while

    - by yazz
    My ASP.NET website while trying to connect to the database for first time after a period of inactivity throws an time out exception. I understand the connections in the connection pool get terminated after some idle time for some reason (Firewall or Oracle settings) and the pool or app doesn't have a clue about it. Is there any way to validate the connection beforehand so that the first try doesn't throw an exception? I don't have much control over the DB or Firewall settings. So I have to deal with this is my application.(would prefer if there is any web.config settings) I am using: ASP.NET 2.0. Oracle server 11g, Microsoft Enterprise Library DAAB to do all my DB operations. I did some search on this topic but didnt find any solid solution for this yet :(

    Read the article

  • Can't Instantiate Windsor Custom Component Activator

    - by jeffn825
    Hi, I'm getting an exception calling Resolve: KernelException: Could not instantiate custom activator Inner Exception: {"Constructor on type 'MyProj.MyAdapter`1[[MyProj.MyBusinessObject, MyAsm, Version=1.0.0.0, Culture=neutral, PublicKeyToken=null]]' not found."} There's definitely a public parameterless constructor there (and I've verified this using reflection at runtime)...so I figure the problem might have to do with the fact that it's generic? I've tried getting the component model object and setting RequiresGenericArguments to true, but that hasn't gotten me anywhere. Any help would be much appreciated! Thanks.

    Read the article

  • Loading embedded resource on Windows 7

    - by Flack
    Hello, I have an app that works just fine on my WinXP machine. However, when I try running it on my Win7 machine, it fails whenever it tries to load an embedded resource. The resources are all there (I can see them using Reflector). The lines that fail are all of the form: Splash.Image = new Bitmap(typeof(ContainerForm).Assembly.GetManifestResourceStream("SplashTest.Resources.Logo.gif")); And they all fail with the same exception: Exception='System.ArgumentException: Parameter is not valid. at System.Drawing.Bitmap..ctor(Stream stream) I don't understand why this is not working on my Win7 machine but does on my usual WinXP dev machine. Any ideas?

    Read the article

  • Handling exceptions raised in observers

    - by sparky
    I have a Rails (2.3.5) application where there are many groups, and each Group has_many People. I have a Group edit form where users can create new people. When a new person is created, they are sent an email (the email address is user entered on the form). This is accomplished with an observer on the Person model. The problem comes when ActionMailer throws an exception - for example if the domain does not exist. Clearly that cannot be weeded out with a validation. There would seem to be 2 ways to deal with this: A begin...rescue...end block in the observer around the mailer. The problem with this is that the only way to pass any feedback to the user would be to set a global variable - as the observer is out of the MVC flow, I can't even set a flash[:error] there. A rescue_from in the Groups controller. This works fine, but has 2 problems. Firstly, there is no way to know which person threw the exception (all I can get is the 503 exception, no way to know which person caused the problem). This would be useful information to be able to pass back to the user - at the moment, there is no way for me to let them know which email address is the problem - at the moment, I just have to chuck the lot back at them, and issue an unhelpful message saying that one of them is not correct. Secondly (and to a certain extent this make the first point moot) it seems that it is necessary to call a render in the rescue_from, or it dies with a rather bizarre "can't convert Array into String" error from webbrick, with no stack trace & nothing in the log. Thus, I have to throw it back to the user when I come across the first error and have to stop processing the rest of the emails. Neither of the solutions are optimal. It would seem that the only way to get Rails to do what I want is option 1, and loathsome global variables. This would also rely on Rails being single threaded. Can anyone suggest a better solution to this problem?

    Read the article

  • Sending the files (At least 11 files) from folder through web service to android app.

    - by Shashank_Itmaster
    Hello All, I stuck in middle of this situation,Please help me out. My question is that I want to send files (Total 11 PDF Files) to android app using web service. I tried it with below code.Main Class from which web service is created public class MultipleFilesImpl implements MultipleFiles { public FileData[] sendPDFs() { FileData fileData = null; // List<FileData> filesDetails = new ArrayList<FileData>(); File fileFolder = new File( "C:/eclipse/workspace/AIPWebService/src/pdfs/"); // File fileTwo = new File( // "C:/eclipse/workspace/AIPWebService/src/simple.pdf"); File sendFiles[] = fileFolder.listFiles(); // sendFiles[0] = fileOne; // sendFiles[1] = fileTwo; DataHandler handler = null; char[] readLine = null; byte[] data = null; int offset = 0; int numRead = 0; InputStream stream = null; FileOutputStream outputStream = null; FileData[] filesData = null; try { System.out.println("Web Service Called Successfully"); for (int i = 0; i < sendFiles.length; i++) { handler = new DataHandler(new FileDataSource(sendFiles[i])); fileData = new FileData(); data = new byte[(int) sendFiles[i].length()]; stream = handler.getInputStream(); while (offset < data.length && (numRead = stream.read(data, offset, data.length - offset)) >= 0) { offset += numRead; } readLine = Base64Coder.encode(data); offset = 0; numRead = 0; System.out.println("'Reading File............................"); System.out.println("\n"); System.out.println(readLine); System.out.println("Data Reading Successful"); fileData.setFileName(sendFiles[i].getName()); fileData.setFileData(String.valueOf(readLine)); readLine = null; System.out.println("Data from bean " + fileData.getFileData()); outputStream = new FileOutputStream("D:/" + sendFiles[i].getName()); outputStream.write(Base64Coder.decode(fileData.getFileData())); outputStream.flush(); outputStream.close(); stream.close(); // FileData fileDetails = new FileData(); // fileDetails = fileData; // filesDetails.add(fileData); filesData = new FileData[(int) sendFiles[i].length()]; } // return fileData; } catch (FileNotFoundException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } catch (Exception e) { e.printStackTrace(); } return filesData; } } Also The Interface MultipleFiles:- public interface MultipleFiles extends Remote { public FileData[] sendPDFs() throws FileNotFoundException, IOException, Exception; } Here I am sending an array of bean "File Data",having properties viz. FileData & FileName. FileData- contains file data in encoded. FileName- encoded file name. The Bean:- (FileData) public class FileData { private String fileName; private String fileData; public String getFileName() { return fileName; } public void setFileName(String fileName) { this.fileName = fileName; } public String getFileData() { return fileData; } public void setFileData(String string) { this.fileData = string; } } The android DDMS gives out of memory exception when tried below code & when i tried to send two files then only first file is created. public class PDFActivity extends Activity { private final String METHOD_NAME = "sendPDFs"; private final String NAMESPACE = "http://webservice.uks.com/"; private final String SOAP_ACTION = NAMESPACE + METHOD_NAME; private final String URL = "http://192.168.1.123:8080/AIPWebService/services/MultipleFilesImpl"; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); TextView textViewOne = (TextView) findViewById(R.id.textViewOne); try { SoapObject soapObject = new SoapObject(NAMESPACE, METHOD_NAME); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope( SoapEnvelope.VER11); envelope.setOutputSoapObject(soapObject); textViewOne.setText("Web Service Started"); AndroidHttpTransport httpTransport = new AndroidHttpTransport(URL); httpTransport.call(SOAP_ACTION, envelope); // SoapObject result = (SoapObject) envelope.getResponse(); Object result = envelope.getResponse(); Log.i("Result", result.toString()); // String fileName = result.getProperty("fileName").toString(); // String fileData = result.getProperty("fileData").toString(); // Log.i("File Name", fileName); // Log.i("File Data", fileData); // File pdfFile = new File(fileName); // FileOutputStream outputStream = // openFileOutput(pdfFile.toString(), // MODE_PRIVATE); // outputStream.write(Base64Coder.decode(fileData)); Log.i("File", "File Created"); // textViewTwo.setText(result); // Object result = envelope.getResponse(); // FileOutputStream outputStream = openFileOutput(name, mode) } catch (Exception e) { e.printStackTrace(); } } } Please help with some explanation or changes in my code. Thanks in Advance.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Out-of-the-box Eclipse PDT (PHP Development Tool) not capable of debugging PHP, why?

    - by Alex R
    I just finished reinstalling the "All-In-One Eclipse PDT" from zend.com. It's unable to debug even the simplest "Hello World" PHP script. How can such a major open-source app be released in such a bad shape? What am I doing wrong? This is the result of doing a "Debug As...": Problem signature: Problem Event Name: APPCRASH Application Name: php.exe Application Version: 5.2.9.9 Application Timestamp: 49dda267 Fault Module Name: ntdll.dll Fault Module Version: 6.0.6002.18005 Fault Module Timestamp: 49e03824 Exception Code: c0000130 Exception Offset: 0006f04e OS Version: 6.0.6002.2.2.0.768.3 Locale ID: 1033 Additional Information 1: 9d13 Additional Information 2: 1abee00edb3fc1158f9ad6f44f0f6be8 Additional Information 3: 9d13 Additional Information 4: 1abee00edb3fc1158f9ad6f44f0f6be8 Read our privacy statement: http://go.microsoft.com/fwlink/?linkid=50163&clcid=0x0409 I think it wants me to configure some additional stuff, but I have no clue what exactly to do.

    Read the article

  • Why do I get a nullpointerexception at line ds.getPort in class L1?

    - by Fred
    import java.awt.; import java.awt.event.; import javax.swing.; import java.io.; import java.net.; import java.util.; public class Draw extends JFrame { /* * Socket stuff */ static String host; static int port; static int localport; DatagramSocket ds; Socket socket; Draw d; Paper p = new Paper(ds); public Draw(int localport, String host, int port) { d = this; this.localport = localport; this.host = host; this.port = port; try { ds = new DatagramSocket(localport); InetAddress ia = InetAddress.getByName(host); System.out.println("Attempting to connect DatagramSocket. Local port " + localport + " , foreign host " + host + ", foreign port " + port + "..."); ds.connect(ia, port); System.out.println("Success, ds.localport: " + ds.getLocalPort() + ", ds.port: " + ds.getPort() + ", address: " + ds.getInetAddress()); Reciever r = new Reciever(ds); r.start(); } catch (Exception e) { e.printStackTrace(); } setDefaultCloseOperation(EXIT_ON_CLOSE); getContentPane().add(p, BorderLayout.CENTER); setSize(640, 480); setVisible(true); } public static void main(String[] args) { int x = 0; for (String s : args){ if (x==0){ localport = Integer.parseInt(s); x++; } else if (x==1){ host = s; x++; } else if (x==2){ port = Integer.parseInt(s); } } Draw d = new Draw(localport, host, port); } } class Paper extends JPanel { DatagramSocket ds; private HashSet hs = new HashSet(); public Paper(DatagramSocket ds) { this.ds=ds; setBackground(Color.white); addMouseListener(new L1(ds)); addMouseMotionListener(new L2()); } public void paintComponent(Graphics g) { super.paintComponent(g); g.setColor(Color.black); Iterator i = hs.iterator(); while(i.hasNext()) { Point p = (Point)i.next(); g.fillOval(p.x, p.y, 2, 2); } } private void addPoint(Point p) { hs.add(p); repaint(); } class L1 extends MouseAdapter { DatagramSocket ds; public L1(DatagramSocket ds){ this.ds=ds; } public void mousePressed(MouseEvent me) { addPoint(me.getPoint()); Point p = me.getPoint(); String message = Integer.toString(p.x) + " " + Integer.toString(p.y); System.out.println(message); try{ byte[] data = message.getBytes("UTF-8"); //InetAddress ia = InetAddress.getByName(ds.host); String convertedMessage = new String(data, "UTF-8"); System.out.println("The converted string is " + convertedMessage); DatagramPacket dp = new DatagramPacket(data, data.length); System.out.println(ds.getPort()); //System.out.println(message); //System.out.println(ds.toString()); //ds.send(dp); /*System.out.println("2Sending a packet containing data: " +data +" to " + ia + ":" + d.port + "...");*/ } catch (Exception e){ e.printStackTrace(); } } } class L2 extends MouseMotionAdapter { public void mouseDragged(MouseEvent me) { addPoint(me.getPoint()); Point p = me.getPoint(); String message = Integer.toString(p.x) + " " + Integer.toString(p.y); //System.out.println(message); } } } class Reciever extends Thread{ DatagramSocket ds; byte[] buffer; Reciever(DatagramSocket ds){ this.ds = ds; buffer = new byte[65507]; } public void run(){ try { DatagramPacket packet = new DatagramPacket(buffer, buffer.length); while(true){ try { ds.receive(packet); String s = new String(packet.getData()); System.out.println(s); } catch (Exception e) { e.printStackTrace(); } } } catch (Exception e) { e.printStackTrace(); } } }

    Read the article

  • jQuery effect on iframe parent document

    - by Jabes88
    Just wondering if anyone else has experienced this or knows why I am getting an error. I'm using javascript from within an iframe to call a parent dom element then use jQuery UI's effect core to shake it. Here is an example: $(document).ready(function(){ if ($("form").length>0) { $("form").submit(function(){ var oParentDoc = $(parent.document).find("div#element"); var action = $(this).attr("action"); var postdata = $(this).serialize(); $(oParentDoc).addClass("loading"); $.post(action,postdata,function(data){ $(oParentDoc).removeClass("loading").effect("shake",{"times":3,"distance":10},60); }); return false; }); } }); It works without the effect, but when I use an effect it gives me this error: uncaught exception: [Exception... "Component returned failure code: 0x80040111 (NS_ERROR_NOT_AVAILABLE) [nsIDOMCSSStyleDeclaration.getPropertyValue]" nsresult: "0x80040111 (NS_ERROR_NOT_AVAILABLE)" Thanks in advance for any insight :)

    Read the article

  • unique_ptr boost equivalent?

    - by wowus
    Is there some equivalent class for C++1x's std::unique_ptr in the boost libraries? The behavior I'm looking for is being able to have an exception-safe factory function, like so... std::unique_ptr<Base> create_base() { return std::unique_ptr<Base>(new Derived); } void some_other_function() { std::unique_ptr<Base> b = create_base(); // Do some stuff with b that may or may not throw an exception... // Now b is destructed automagically. }

    Read the article

  • Adding/removing session variables on Page OnInit/OnLoad in C#

    - by MKS
    Hi Guys, I am using C#. I am having below code in C#: protected override void OnInit(EventArgs e) { try { if (Session["boolSignOn"].ToString() == "true".ToString()) { lblPanelOpen.Text = Session["panelOpen"].ToString(); } else { lblPanelOpen.Text = Session["panelOpen"].ToString(); } } catch (Exception ex) { Logger.Error("Error processing request:" + ex.Message); } } protected override void OnLoad(EventArgs e) { try { if (!string.IsNullOrEmpty(Session["panelOpen"].ToString())) { lblPanelOpen.Text = string.Empty; Session.Remove("panelOpen"); } } catch (Exception ex) { Logger.Error("Unable to remove the session variable:" + ex.Message); } } In above code I am having a Session["panelOpen"] variable which is created from another user control and once my page is trying to render, I am storing Session["panelOpen"] in my hidden lblPanelOpen.Text on page OnInit() method, however when page is loaded completely then I am trying to remove the session variable. Please suggest!

    Read the article

  • SWT Composite consructor throws IllegalArgumentException on a non-null argument

    - by Alexey Romanov
    This piece of code (in Scala) val contents = { assert(mainWindow.detailsPane != null) new Composite(mainWindow.detailsPane, SWT.NONE) } throws an exception: Exception occurred java.lang.IllegalArgumentException: Argument not valid at org.eclipse.swt.SWT.error(Unknown Source) at org.eclipse.swt.SWT.error(Unknown Source) at org.eclipse.swt.SWT.error(Unknown Source) at org.eclipse.swt.widgets.Widget.error(Unknown Source) at org.eclipse.swt.widgets.Widget.checkParent(Unknown Source) at org.eclipse.swt.widgets.Widget.<init>(Unknown Source) at org.eclipse.swt.widgets.Control.<init>(Unknown Source) at org.eclipse.swt.widgets.Scrollable.<init>(Unknown Source) at org.eclipse.swt.widgets.Composite.<init>(Unknown Source) at main.scala.NodeViewPresenter$NodeViewImpl.<init>(NodeViewPresenter.scala:41) According to the documentation, IllegalArgumentException should only be thrown when the parent is null, but I am checking for that. detailsPane is a CTabFolder. Can anybody say why this could happen?

    Read the article

  • How to document thrown exceptions in c#/.net

    - by Arnold Zokas
    I am currently writing a small framework that will be used internally by other developers within the company. I want to provide good Intellisense information, but I am not sure how to document thrown exceptions. In the following example: public void MyMethod1() { MyMethod2(); // also may throw InvalidOperationException } public void MyMethod2() { System.IO.File.Open(somepath...); // this may throw FileNotFoundException // also may throw DivideByZeroException } I know the markup for documenting exceptions is: /// <exception cref="SomeException">when things go wrong.</exception> What I don't understand is how to document exceptions thrown by code called by MyMethod1()? Should I document exceptions thrown by MyMethod2() Should I document exceptions thrown by File.Open() ? What would be the best way to document possible exceptions?

    Read the article

  • Is there anything wrong with my Factory class?

    - by Alex
    class PieceFactory { @SuppressWarnings("rawtypes") public Piece createPiece(String pieceType) throws Throwable{ Class pieceClass = Class.forName(pieceType); Piece piece = (Piece) pieceClass.newInstance(); return piece; } } I'm not all used to handling exceptions yet therefore I'm just throwing them, but everywhere I use a method that uses this factory it tells me I have to throw exceptions like throwable. For example, in one of my classes I have a method that instantiates a lot of objects using the method that uses the factory. I can use the method in that class by just throwing the exception, however it won't work if I try to pass a reference to that class to another class and then use the method from there. Then it forces me to try catch the exception. I probably don't need a factory but it seemed interesting and I'd like to try to use patterns. The reason I created the factory was that I have 6 subclasses of Piece and I wan't to use a method to instantiate them by passing the type of subclass I want as an argument to the method.

    Read the article

  • Class Destructor Problem

    - by user279691
    I am making a simple class that contains a StreamWrite class Logger { private StreamWriter sw; private DateTime LastTime; public Logger(string filename) { LastTime = DateTime.Now; sw = new StreamWriter(filename); } public void Write(string s) { sw.WriteLine((DateTime.Now-LastTime).Ticks/10000+":"+ s); LastTime = DateTime.Now; } public void Flush() { sw.Flush(); } ~Logger() { sw.Close();//Raises Exception! } } But when I close this StreamWriter in the destructor, it raises an exception that the StreamWriter was already deleted? Why? And how to make it work such that when the Logger class is deleted, the StreamWriter is closed before deletion? Thanks!

    Read the article

  • how to filter data from xml file for displaying only selected as nodes in treeview

    - by michale
    I have an xml file named "books.xml" provided in the link "http://msdn.microsoft.com/en-us/library/windows/desktop/ms762271(v=vs.85).aspx". What my requirement was to disaplay only the <title> from xml information as nodes in tree view. But when i did the following coding its displaying all the values as nodes like "catalog" as rootnode, book as parent node for all then author,title,genre etc as nodes but i want only root node catalogue and title as nodes not even book. Can any body guide me what modification i need to do in the exisitng logic for displaying title as nodes OpenFileDialog dlg = new OpenFileDialog(); dlg.Title = "Open XML document"; dlg.Filter = "XML Files (*.xml)|*.xml"; dlg.FileName = Application.StartupPath + "\\..\\..\\Sample.xml"; if (dlg.ShowDialog() == DialogResult.OK) { try { //Just a good practice -- change the cursor to a //wait cursor while the nodes populate this.Cursor = Cursors.WaitCursor; //First, we'll load the Xml document XmlDocument xDoc = new XmlDocument(); xDoc.Load(dlg.FileName); //Now, clear out the treeview, //and add the first (root) node treeView1.Nodes.Clear(); treeView1.Nodes.Add(new TreeNode(xDoc.DocumentElement.Name)); TreeNode tNode = new TreeNode(); tNode = (TreeNode)treeView1.Nodes[0]; //We make a call to addTreeNode, //where we'll add all of our nodes addTreeNode(xDoc.DocumentElement, tNode); //Expand the treeview to show all nodes treeView1.ExpandAll(); } catch (XmlException xExc) //Exception is thrown is there is an error in the Xml { MessageBox.Show(xExc.Message); } catch (Exception ex) //General exception { MessageBox.Show(ex.Message); } finally { this.Cursor = Cursors.Default; //Change the cursor back } }} //This function is called recursively until all nodes are loaded private void addTreeNode(XmlNode xmlNode, TreeNode treeNode) { XmlNode xNode; TreeNode tNode; XmlNodeList xNodeList; if (xmlNode.HasChildNodes) //The current node has children { xNodeList = xmlNode.ChildNodes; for (int x = 0; x <= xNodeList.Count - 1; x++) //Loop through the child nodes { xNode = xmlNode.ChildNodes[x]; treeNode.Nodes.Add(new TreeNode(xNode.Name)); tNode = treeNode.Nodes[x]; addTreeNode(xNode, tNode); } } else //No children, so add the outer xml (trimming off whitespace) treeNode.Text = xmlNode.OuterXml.Trim(); }

    Read the article

  • System.MissingMemberException was unhandled by user code

    - by AmRoSH
    I'm using this code: Dim VehiclesTable1 = dsVehicleList.Tables(0) Dim VT1 = (From d In VehiclesTable1.AsEnumerable _ Select VehicleTypeName = d.Item("VehicleTypeName") _ , VTypeID = d.Item("VTypeID") _ , ImageURL = d.Item("ImageURL") _ , DailyRate = d.Item("DailyRate") _ , RateID = d.Item("RateID")).Distinct its linq to dataset and I Take Data on THis Rotator: <telerik:RadRotator ID="RadRotatorVehicleType" runat="server" Width="620px" Height="145" ItemWidth="155" ItemHeight="145" ScrollDirection="Left" FrameDuration="1" RotatorType="Buttons"> <ItemTemplate> <div style="text-align: center; cursor: pointer; width: 150px"> <asp:Image ID="ImageVehicleType" runat="server" Width="150" ImageUrl='<%# Container.DataItem("ImageURL") %>' /> <asp:Label ID="lblVehicleType" runat="server" Text='<%# Container.DataItem("VehicleTypeName") %>' Font-Bold="true"></asp:Label> <br /> <asp:Label ID="lblDailyRate" runat="server" Text='<%# Container.DataItem("DailyRate") %>' Visible="False"></asp:Label> <input id="HiddenVehicleTypeID" type="hidden" value='<%# Container.DataItem("VTypeID") %>' name="HiddenVehicleTypeID" runat="server" /> <input id="HiddenRateID" type="hidden" value='<%# Container.DataItem("RateID") %>' name="HiddenRateID" runat="server" /> </div> </ItemTemplate> <ControlButtons LeftButtonID="img_left" RightButtonID="img_right" /> </telerik:RadRotator> and I got this Exception: No default member found for type 'VB$AnonymousType_0(Of Object,Object,Object,Object,Object)'. Description: An unhandled exception occurred during the execution of the current web request. Please review the stack trace for more information about the error and where it originated in the code. Exception Details: System.MissingMemberException: No default member found for type 'VB$AnonymousType_0(Of Object,Object,Object,Object,Object)'. I don't know whats up ? Any help please. Thanks for who tried to solve this but I got solution: using '<%# DataBinder.Eval(Container.DataItem,"ImageURL") %>' instead of '<%# Container.DataItem("RateID") %>' Thanks,

    Read the article

  • CouchDB Map/Reduce raises execption in reduce function?

    - by fuzzy lollipop
    my view generates keys in this format ["job_id:1234567890", 1271430291000] where the first key element is a unique key and the second is a timestamp in milliseconds. I run my view with this elapsed_time?startkey=["123"]&endkey=["123",{}]&group=true&group_level=1 and here is my reduce function, the intention is to reduce the output to get the earliest and latest timestamps and return the difference between them and now function(keys,values,rereduce) { var now = new Date().valueOf(); var first = Number.MIN_VALUE; var last = Number.MAX_VALUE; if (rereduce) { first = Math.max(first,values[0].first); last = Math.min(last,values[0].last); } else { first = keys[0][0][1]; last = keys[keys.length-1][0][1]; } return {first:now - first, last:now - last}; } and when processing a query it constantly raises the following execption: function raised exception (new TypeError("keys has no properties", "", 1)) I am making sure not to reference keys inside my rereduce block. Why does this function constantly raise this exception?

    Read the article

  • Resizing uploaded files in django using PIL

    - by Nikunj
    I am using PIL to resize an uploaded file using this method: def resize_uploaded_image(buf): imagefile = StringIO.StringIO(buf.read()) imageImage = Image.open(imagefile) (width, height) = imageImage.size (width, height) = scale_dimensions(width, height, longest_side=240) resizedImage = imageImage.resize((width, height)) return resizedImage I then use this method to get the resizedImage in my main view method: image = request.FILES['avatar'] resizedImage = resize_uploaded_image(image) content = django.core.files.File(resizedImage) acc = Account.objects.get(account=request.user) acc.avatar.save(image.name, content) However, this gives me the 'read' error. Trace: Exception Type: AttributeError at /myapp/editAvatar Exception Value: read Any idea how to fix this? I have been at it for hours! Thanks! Nikunj

    Read the article

  • Different kinds of doubles in vb.net?

    - by Jonathan
    Hey all- I'm using QBFC to generate invoices in a Quickbooks integrating app. I'm getting an exception thrown for lineItem.Amount.SetValue(val as Double) when I try to enter a programmatically generated double. The following does not work: lineItem = invoice.ORInvoiceLineAddList.Append.InvoiceLineAdd Dim amount as Double amount = summary.dailySold * summary.dailyRate loggingTxtBox.AppendText("Amount is " & amount & vbNewLine) lineItem.Amount.SetValue(amount) The exception I receive is System.Runtime.InteropServices.COMException (0x80040305): Invalid Amount format. at Interop.QBFC8.IQBAmountType.SetValue(Double val) The following works: lineItem.Amount.SetValue(20.3) Any suggestions? Is .NET interpretting a hard-coded double differently than a programmatically calculated one? Thanks- Jonathan

    Read the article

  • How to translate,use JSON in GWT?

    - by graybow
    I'm new in gwt. and need to know how to use JSON in gwt so i try this simple data loader but i'm still confuse. I create a project named 'tesdb3' in eclipse. I create the PHP side to access the database, and made the output as JSON.. I create the userdata.php in folder war. then I compile tesdb3 project. Folder tesdb3 and the userdata.php in war moved in local server(I use WAMP). I put the PHP in folder tesdb3. This is the result from my localhost/phpmyadmin/tesdb3/userdata.php [{"kode":"002","nama":"bambang gentolet"}{"kode":"012","nama":"Algiz"}] From that result I think the PHP side was working good.Then I create UserData.java as JSNI overlay like this: package com.tesdb3.client; import com.google.gwt.core.client.JavaScriptObject; class UserData extends JavaScriptObject{ protected UserData() {} public final native String getKode() /*-{ return this.kode; }-*/; public final native String getNama() /*-{ return this.nama; }-*/; public final String getFullData() { return getKode() + ":" + getNama(); } } Then Finally in the tesdb3.java: public class Tesdb3 implements EntryPoint { String url= "http://localhost/phpmyadmin/tesdb3/datauser.php"; private native JsArray<UserData> getuserdata(String Json) /*-{ return eval(json); }-*/; public void LoadData() throws RequestException{ RequestBuilder builder = new RequestBuilder(RequestBuilder.POST, URL.encode(url)); builder.sendRequest(null, new RequestCallback(){ @Override public void onError(Request request, Throwable exception) { Window.alert("error " + exception); } public void onResponseReceived(Request request, Response response) { getuserdata(response.getText()); //this is how i use the userdata json(is this already translated?) UserData UD = null; String LKode =UD.getKode(); String LName =UD.getNama(); Label L = new Label(LKode+""+LName); RootPanel.get().add(L); } }); } public void onModuleLoad() { try { LoadData(); } catch (RequestException e) { e.printStackTrace(); } } } The result is blank(i use development mode). and there was an eror like this:(I show it just some part) 10:46:29.984 [ERROR] [tesdb3] Uncaught exception escaped com.google.gwt.core.client.JavaScriptException: (ReferenceError): json is not defined fileName: http://localhost:1092 lineNumber: 2 stack: ("")@http://localhost:1092:2 My question is: How I use the translated Json in right way?? Is there any wrong use from my code? Is that necessary to move the compiled project to local server folder?(i do it following a tutorial from google). Sorry too many ask. but i'm really really confused.

    Read the article

< Previous Page | 156 157 158 159 160 161 162 163 164 165 166 167  | Next Page >