Search Results

Search found 5919 results on 237 pages for 'io priority'.

Page 160/237 | < Previous Page | 156 157 158 159 160 161 162 163 164 165 166 167  | Next Page >

  • Naming convention for utility classes in Java

    - by Zarjay
    When writing utility classes in Java, what are some good guidelines to follow? Should packges be "util" or "utils"? Is it ClassUtil or ClassUtils? When is a class a "Helper" or a "Utility"? Utility or Utilities? Or do you use a mixture of them? The standard Java library uses both Utils and Utilities: javax.swing.Utilities javax.print.attribute.AttributeSetUtilities javax.swing.plaf.basic.BasicGraphicsUtils Apache uses a variety of Util and Utils, although mostly Utils: org.apache.commons.modeler.util.DomUtil org.apache.commons.modeler.util.IntrospectionUtils org.apache.commons.io.FileSystemUtils org.apache.lucene.wordnet.AnalyzerUtil org.apache.lucene.util.ArrayUtil org.apache.lucene.xmlparser.DOMUtils Spring uses a lot of Helper and Utils classes: org.springframework.web.util.UrlPathHelper org.springframework.core.ReflectiveVisitorHelper org.springframework.core.NestedExceptionUtils org.springframework.util.NumberUtils So, how do you name your utility classes?

    Read the article

  • Use DLL and have it be as trusted as my own application is

    - by Binary255
    Hi, I am using a port of GNU GetOpts, to be specific I am using the one at: http://getopt.codeplex.com I have added the DLL as a reference. But when I run my application I receive an exception: System.IO.FileLoadException was unhandled Message="Could not load file or assembly 'Gnu.Getopt, Version=0.9.1.24287, Culture=neutral, PublicKeyToken=d014b4ccdc53511a' or one of its dependencies. Failed to grant permission to execute. (Exception from HRESULT: 0x80131418)" If it is possible I would like my application to say, "trust this DLL as much as you trust me". Is there a way to do that so I won't have to fiddle with security settings? And if there is not. What is the cleanest way to get the DLL working?

    Read the article

  • Server returned HTTP response code: 500 for URL

    - by user617162
    java.io.IOException: Server returned HTTP response code: 500 for URL: http://ww .huadt.com.cn/zh-cn/i/l/@357671030745308@V500@0000@AUTOLOW@1@11d590f7$GPRMC,065 48.000,A,3959.8587,N,11617.2447,E,0.00,55.32,210311,,,A*56@@ at sun.net.www.protocol.http.HttpURLConnection.getInputStream(Unknown S urce) at hdt.SendCmdToP.Sendplatform(SendCmdToP.java:67) at hdt.SendCmdToP.process(SendCmdToP.java:198) at hdt.SendCmdToP.run(SendCmdToP.java:131) java.lang.NullPointerException at hdt.SendCmdToP.Sendplatform(SendCmdToP.java:91) at hdt.SendCmdToP.process(SendCmdToP.java:198) at hdt.SendCmdToP.run(SendCmdToP.java:131) Appeared pointer, and 500 wrong with the closure of the abnormal, a firewall relationship? If not is it code problems? Please help everybody see how to solve the problem. thanks?

    Read the article

  • MS Build Server 2010 - Buffer Overflow

    - by user329005
    Hey everybody, I try to build an solution in MS Build Server (MS Visual Studio 2010 ver 10.0.30319.1) about ServerTasks - Builds - Server Task Builder - Queue new Built and go, 47 seconds later I get an error output: CSC: Unexpected error creating debug information file 'c:\Builds\1\ServerTasks\Server-Tasks Builder\Sources\ThirdParty\Sources\samus-mongodb-csharp-2b8934f\MongoDB.Linq\obj\Debug\MongoDB.Linq.PDB' -- 'c:\Builds\1\ServerTasks\Server-Tasks Builder\Sources\ThirdParty\Sources\samus-mongodb-csharp-2b8934f\MongoDB.Linq\obj\Debug\MongoDB.Linq.pdb: Access denied I checked the permissions of directory and set it (for debug purposes only) to grant access for all users, but still having an issue. Running the Procmon and filter file access for directory: 'c:\Builds\1\ServerTasks\Server-Tasks Builder\Sources\ThirdParty\Sources\samus-mongodb-csharp-2b8934f\MongoDB.Linq\obj\Debug\' tells me: 16:41:00,5449813 TFSBuildServiceHost.exe 3528 QuerySecurityFile C:\Builds\1\ServerTasks\Server-Tasks Builder\Sources\ThirdParty\Sources\samus-mongodb-csharp-2b8934f\MongoDB.Linq\obj\Debug BUFFER OVERFLOW Information: DACL, 0x20000000 and 16:41:00,5462119 TFSBuildServiceHost.exe 3528 QueryOpen C:\Builds\1\ServerTasks\Server-Tasks Builder\Sources\ThirdParty\Sources\samus-mongodb-csharp-2b8934f\MongoDB.Linq\obj\Debug FAST IO DISALLOWED Any ideas?

    Read the article

  • how to feed a file to telnet

    - by knittl
    hello community, understanding http and headers i played around with telnet to send requests. to not type everything again and again and again i thought i'd write a small textfile with all the commands i need. my file is as simple as follows: GET /somefile.php HTTP/1.1 Host: localhost i then try to feed it to telnet with io-redirection: $ telnet localhost 80 < telnet.txt but all output i get is Trying ::1... Connected to localhost. Escape character is '^]'. Connection closed by foreign host. what am i doing wrong?

    Read the article

  • Map the physical file path in asp.net mvc

    - by rmassart
    Hi, I am trying to read an XSLT file from disk in my ASP.Net MVC controller. What I am doing is the following: string filepath = HttpContext.Request.PhysicalApplicationPath; filepath += "/Content/Xsl/pubmed.xslt"; string xsl = System.IO.File.ReadAllText(filepath); However, half way down this thread on forums.asp.net there is the following quote HttpContext.Current is evil and if you use it anywhere in your mvc app you are doing something wrong because you do not need it. Whilst I am not using "Current", I am wondering what is the best way to determine the absolute physical path of a file in MVC? For some reason (I don't know why!) HttpContext doesn't feel right for me. Is there a better (or recommended/best practice) way of reading files from disk in ASP.Net MVC? Thanks for your help, Robin

    Read the article

  • Java: conditional initialization?

    - by HH
    Ruby has conditional initialization. Apparently, Java does not or does it? I try to write more succintly, to limit the range as small as possible. import java.io.*; import java.util.*; public class InitFor{ public static void main(String[] args){ for(int i=7,k=999;i+((String h="hello").size())<10;i++){} System.out.println("It should be: hello = "+h); } } Errors Press ENTER or type command to continue InitFor.java:8: ')' expected for(int i=7,k=999;i+((String h="hello").size())<10;i++){} ^

    Read the article

  • "Ant all" not working for me

    - by bobjink
    I have got involved in a project. This project uses ant which is not something I am comfortable with. I have checked out the source code and tried running ant on the most outer directory. Running 'ant' in commando prompt takes 1 sec and I get a BUILD SUCCESFULL message. If I run 'ant all' I get a BUILD FAILED. Java.io.IOExceptio: Cannot run program "ant": CreateProcess=2, the system cannot find the file specified and then a long stacktrace. Most of the people on the project runs OS-X while I use Windows XP. Any help or information is appreciated :)

    Read the article

  • Java object caching, which is faster, reading from a file or from a remote machine?

    - by Kumar225
    I am at a point where I need to take the decision on what to do when caching of objects reaches the configured threshold. Should I store the objects in a indexed file (like provided by JCS) and read them from the file (file IO) when required or have the object stored in a distributed cache (network, serialization, deserialization) We are using Solaris as OS. ============================ Adding some more information. I have this question so as to determine if I can switch to distributed caching. The remote server which will have cache will have more memory and better disk and this remote server will only be used for caching. One of the problems we cannot increase the locally cached objects is , it stores the cached objects in JVM heap which has limited memory(using 32bit JVM). ======================================================================== Thanks, we finally ended up choosing Coherence as our Cache product. This provides many cache configuration topologies, in process vs remote vs disk ..etc.

    Read the article

  • Can't Use Path in ASP MVC Action

    - by user1477388
    I am trying to use Path() but it has a blue line under it and says, "local variable (path) cannot be referred to until it is declared." How can I use Path()? Imports System.Globalization Imports System.IO Public Class MessageController Inherits System.Web.Mvc.Controller <EmployeeAuthorize()> <HttpPost()> Function SendReply(ByVal id As Integer, ByVal message As String, ByVal files As IEnumerable(Of HttpPostedFileBase)) As JsonResult ' upload files For Each i In files If (i.ContentLength > 0) Then Dim fileName = path.GetFileName(i.FileName) Dim path = path.Combine(Server.MapPath("~/App_Data/uploads"), fileName) i.SaveAs(path) End If Next End Function End Class

    Read the article

  • StackExchange API key

    - by user21289
    I am working on a project with the StackExchange API, the problem is at a moment I have this Exception on eclipse console: java.io.IOException: Server returned HTTP response code: 400 for URL: https://api.stackexchange.com/2.1/questions?order=desc&sort=votes&tagged=OSM&site=stackoverflow at sun.net.www.protocol.http.HttpURLConnection.getInputStream(Unknown Source) at sun.net.www.protocol.https.HttpsURLConnectionImpl.getInputStream(Unknown Source) atbr.inf.pucrio.sog.StackOverflowAcessor.getQuestionsIds(StackOverflowAcessor.java:41) After verifying on the browser with the same link, I have this error message: {"error_id":502,"error_name":"throttle_violation","error_message":"too many requests from this IP, more requests available in 74089 seconds"} I am wondering if this is dur to the limited numbers of the queries per day, if it is the case, how can I do to have the key? if it is not, how can I do to resolve the problem?

    Read the article

  • /clr option in c++

    - by muhammad-aslam
    hello friendzz plz give me a solution for this error "fatal error C1190: managed targeted code requires a '/clr' option" HOw can i resolve this problem?? My configuration is .. Visual studio 2008 windows 7 Here is the code (i got by using net resources) using using namespace System; using namespace System::IO; int main() { // Create a reference to the current directory. DirectoryInfo* di = new DirectoryInfo(Environment::CurrentDirectory); // Create an array representing the files in the current directory. FileInfo* fi[] = di-GetFiles(); Console::WriteLine(S"The following files exist in the current directory:"); // Print out the names of the files in the current directory. Collections::IEnumerator* myEnum = fi-GetEnumerator(); while (myEnum-MoveNext()) { FileInfo* fiTemp = __try_cast(myEnum-Current); Console::WriteLine(fiTemp-Name); } } PLZZZZZZZZ

    Read the article

  • Program to call other programs

    - by Evil
    hello. I am writing a program that will solve a type of min. spanning tree problem. i have 2 different algorithms that I've gotten working in two separate .cpp files i've named kruskels.cpp and prims.cpp. my question is this: each file takes the following command line to run it . time ./FILENAME INPUTFILE FACTOR i would like to make a program that, depending on what inputfile is entered, will run either kruskels.cpp or prims.cpp. how can i do this? this program must pass those command line arguments to kruskels or prims. each file (kruskels.cpp and prims.cpp) are designed to be run using those command line arugments (so they take in INPUTFILE and FACTOR as variables to do file io). this should be for c++.

    Read the article

  • WiX: Extracting Binary-string in Custom Action yields string like "???good data"

    - by leiflundgren
    I just found a weird behaviour when attempting to extract a string from the Binary-table in the MSI. I have a file containing "Hello world", the data I get is "???Hello world". (Literary question mark.) Is this as intended? Will it always be exactly 3 characters in the beginning? Regards Leif Sample code: [CustomAction] public static ActionResult CustomAction2(Session session) { View v = session.Database.OpenView("SELECT `Name`,`Data` FROM `Binary`"); v.Execute(); Record r = v.Fetch(); int datalen = r.GetDataSize("Data"); System.IO.Stream strm = r.GetStream("Data"); byte[] rawData = new byte[datalen]; int res = strm.Read(rawData, 0, datalen); strm.Close(); String s = System.Text.Encoding.ASCII.GetString(rawData); // s == "???Hello World" return ActionResult.Success; }

    Read the article

  • java checked exception in a catch clause compilation error

    - by srandpersonia
    Hi, I was expecting an compilation error in the following program because of the throw statement in the catch block as IOException is a checked exception and it is not caught by another try block within the catch block. But I am getting "Hurray!" printed. Any explanation would be much appreciated. According to JLS 11.2.3, http://java.sun.com/docs/books/jls/third_edition/html/exceptions.html It is a compile-time error if a method or constructor body can throw some exception type E when both of the following hold: * E is a checked exception type * E is not a subtype of some type declared in the throws clause of the method or constructor. import java.io.*; public class Test{ public static void main(String args[]) { System.out.println(method()); } public static int method() { try{ throw new Exception(); } catch(Exception e){ throw new IOException(); //No compile time error } finally{ System.out.println("Hurray!"); } } } Thanks in advance.

    Read the article

  • Why is there a seemingly identical copy of the JDK 1.5 core runtime in org.osgi.foundation-1.0.0.jar?

    - by Jonathan Neufeld
    I am maintaining a web application that depends on OSGi and Maven pulls-in a jar called org.osgi-foundation-1.0.0.jar that seems to contain the same classes as part of the JDK core runtime such as: java.util.*; java.io.*; etc. and so on. This seems very strange and I have to ask why this is necessary. More-over, my web-application fails to deploy on JBoss 6 because these are "illegal package names" for a third-party library. What is the purpose of org.osgi-foundation-1.0.0.jar ? is it necessary?

    Read the article

  • How to acces File over the Network

    - by Polo
    Hi! I am having a hard time on this one, I have à folder over the network wit public accès (no credential restriction). I am trying to do à File.Exist or Directory.Exist and I keep on having a exception. Can somewone tell me the good way to do IO over the network. EDIT 1 FOR DETAILS: if i do execture = \agoodip\Public\test.txt I get the file etc etc In my code it look like a basic Directory.Exist(@"\agoodip\Public") or File.exist(@"\agoodip\Public\test.txt") The exception I get is Path not found. Thanks!

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Better data stream reading in Haskell

    - by Tim Perry
    I am trying to parse an input stream where the first line tells me how many lines of data there are. I'm ending up with the following code, and it works, but I think there is a better way. Is there? main = do numCases <- getLine proc $ read numCases proc :: Integer -> IO () proc numCases | numCases == 0 = return () | otherwise = do str <- getLine putStrLn $ findNextPalin str proc (numCases - 1) Note: The code solves the Sphere problem https://www.spoj.pl/problems/PALIN/ but I didn't think posting the rest of the code would impact the discussion of what to do here.

    Read the article

  • Why doesn't this code using the ruby-mbox gem parse mbox files?

    - by cartoonfox
    I installed ruby-mbox by doing gem install ruby-mbox Running this: #!/usr/bin/ruby require 'rubygems' require 'mbox' m = IO.read('test.eml') puts m.size m = Mbox.new(m) puts m produces this: 71309505 /Library/Ruby/Gems/1.8/gems/ruby-mbox-0.0.2/lib/mbox/mbox.rb:45:in `initialize': uninitialized constant Mbox::StringIO (NameError) from r.rb:7:in `new' from r.rb:7 I have proved that "m" is assigned a string containing the contents of the file, just before Mbox.new(m) is called. It looks as though the Mbox::StringIO should have been defined by hasn't been. What's going wrong here? Ruby version: ruby 1.8.7 (2009-06-12 patchlevel 174) [universal-darwin10.0] (That's the default ruby installed on OS X 10.6.6)

    Read the article

  • how do I get the IP of incoming ICMP due to UDP-send to dead client in Ruby?

    - by banister
    so.. I'm doing a small multiplayer game with blocking UDP and IO.select. To my problem.. (In the server) reading from a UDP socket (packet, sender = @socket.recvfrom(1000)) which have just sent a packet to a dead client results in a ICMP unreachable (and exception Errno::ECONNRESET in ruby). The problem is that I can't find any way whatsoever to extract the IP of that ICMP.. so I can clean out that dead client. Anyone know how to achieve this? thanks

    Read the article

  • How to capture a screen shot in .NET from a webapplication?

    - by CodeToGlory
    In Java we can do it as follows: import java.awt.Dimension; import java.awt.Rectangle; import java.awt.Robot; import java.awt.Toolkit; import java.awt.image.BufferedImage; import javax.imageio.ImageIO; import java.io.File; ... public void captureScreen(String fileName) throws Exception { Dimension screenSize = Toolkit.getDefaultToolkit().getScreenSize(); Rectangle screenRectangle = new Rectangle(screenSize); Robot robot = new Robot(); BufferedImage image = robot.createScreenCapture(screenRectangle); ImageIO.write(image, "png", new File(fileName)); } ... How do we do this in .NET from a webapplication? Capturing the client's screen and sending it to the server all from within the application.

    Read the article

  • Need help with displaying the message correctly in the pole display

    - by SA
    Hi, I am using an HP RS232 pole display with the following setting: Char type: USA/Europe (default) Command mode: EPSON (default) Baud rate: 9600, n , 8, 1 (default?) Passthru None (Default) Here's the code using System.IO.Ports; private SerialPort port; port = new SerialPort("COM2", 9600, Parity.None, 8, StopBits.One); port.Handshake = Handshake.None; Port.WriteLine("Welocome to something something"); It has 2 lines consisting of 20 characters each with a total of 40 characters. I have no control how and where the characters get displayed. I have set it to accept ASCII char set and so I am able to type as is visble in the Writeline message

    Read the article

  • Writing my own iostream utility class: Is this a good idea?

    - by Alex
    I have an application that wants to read word by word, delimited by whitespace, from a file. I am using code along these lines: std::istream in; string word; while (in.good()) { in>>word; // Processing, etc. ... } My issue is that the processing on the words themselves is actually rather light. The major time consumer is a set of mySQL queries I run. What I was thinking is writing a buffered class that reads something like a kilobyte from the file, initializes a stringstream as a buffer, and performs extraction from that transparently to avoid a great many IO operations. Thoughts and advice?

    Read the article

  • How can I get to the value of my WPF UserControl DependencyProperty from UI Automation Framework?

    - by Surfbutler
    Hi, I'm having trouble getting access to my WPF UserControl DependencyProperty values through the UI Automation Framework. I've used James McCaffreys article in MSDN as a starting point (Automating IO Tests in WPF Applications, MSDN March 2009), but I can only see properties etc in standard controls such as buttons. I'm assuming there's some Automation interface I have to implement on my UserControl, but what and how? I can already see my control fine e.g. in UISpy, but I can't see the dependency properties within it. Here's what my usercontrol looks like currently in UISpy: AutomationElement General Accessibility AccessKey: "" AcceleratorKey: "" IsKeyboardFocusable: "False" LabeledBy: "(null)" HelpText: "Switches 48v Phantom Power On/Off (for Mic inputs only)." State IsEnabled: "True" HasKeyboardFocus: "False" Identification ClassName: "" ControlType: "ControlType.Custom" Culture: "(null)" AutomationId: "V48SwL" LocalizedControlType: "custom" Name: "" ProcessId: "5684 (VirtualSix)" RuntimeId: "7 5684 40026340" IsPassword: "False" IsControlElement: "True" IsContentElement: "True" Visibility BoundingRectangle: "(140, 457, 31, 20)" ClickablePoint: "155,467" IsOffscreen: "False" ControlPatterns

    Read the article

< Previous Page | 156 157 158 159 160 161 162 163 164 165 166 167  | Next Page >