Search Results

Search found 13191 results on 528 pages for 'unhandled exception'.

Page 163/528 | < Previous Page | 159 160 161 162 163 164 165 166 167 168 169 170  | Next Page >

  • webservice - unknown web method parameter name methodname

    - by ch3r1f
    I called a webservice for fetching items in fullcalendar. The method is never called and firebug gives this error: *"POST [http]://localhost:50536/FullCalendar/ServicioFullCalendar.asmx/GetEventosCalendario POST [http]://localhost:50536/FullCalendar/ServicioFullCalendar.asmx/GetEventosCalendario 500 Internal Server Error 1.01s" "unknown web method parameter name methodname"* Here is the asmx.vb code: <System.Web.Script.Services.ScriptService()> _ <System.Web.Services.WebService(Namespace:="http://localhost/uva/")> _ <System.Web.Services.WebServiceBinding(ConformsTo:=WsiProfiles.BasicProfile1_1)> _ <ToolboxItem(False)> _ Public Class ServicioFullCalendar Inherits System.Web.Services.WebService <ScriptMethod(ResponseFormat:=ResponseFormat.Json)> _ <WebMethod(MessageName:="ObtieneEventos")> _ Public Shared Function GetEventosCalendario(ByVal startDate As String, ByVal endDate As String) As String Try Return CalendarioMensualDAO.Instance.getEventos(startDate, endDate) Catch ex As Exception Throw New Exception("FullCalendar:GetEventos: " & ex.Message) Finally End Try End Function The webservice is "loaded" from the fullcalendar as follows: events: "ServicioFullCalendar.asmx/GetEventosCalendario",

    Read the article

  • JavaScript try/catch: errors or exceptions?

    - by Josh
    OK. I may be splitting hairs here, but my code isn't consistent and I'd like to make it so. But before I do, I want to make sure I'm going the right way. In practice this doesn't matter, but this has been bothering me for a while so I figured I'd ask my peers... Every time I use a try... catch statement, in the catch block I always log a message to my internal console. However my log messages are not consistent. They either look like: catch(err) { DFTools.console.log("someMethod caught an error: ",err.message); ... or: catch(ex) { DFTools.console.log("someMethod caught an exception: ",ex.message); ... Obviously the code functions properly either way but it's starting to bother me that I sometimes refer to "errors" and sometimes to "exceptions". Like I said, maybe I'm splitting hairs but which is the proper terminology? "Exception", or "Error"?

    Read the article

  • How to acces File over the Network

    - by Polo
    Hi! I am having a hard time on this one, I have à folder over the network wit public accès (no credential restriction). I am trying to do à File.Exist or Directory.Exist and I keep on having a exception. Can somewone tell me the good way to do IO over the network. EDIT 1 FOR DETAILS: if i do execture = \agoodip\Public\test.txt I get the file etc etc In my code it look like a basic Directory.Exist(@"\agoodip\Public") or File.exist(@"\agoodip\Public\test.txt") The exception I get is Path not found. Thanks!

    Read the article

  • How to add ACTIVE DOMAIN user to Sharepoint group

    - by standley-nguyen
    Hi all. I got an exception when executing this snippet code SPSecurity.RunWithElevatedPrivileges(delegate() { using (SPSite site = new SPSite(siteUrl.Trim())) { using (SPWeb web = site.OpenWeb()) { try { web.AllowUnsafeUpdates = true; SPUser spUser = web.AllUsers[userName]; if (spUser != null) { SPGroup spGroup = web.Groups[groupName]; if (spGroup != null) spGroup.AddUser(spUser); } } catch (Exception ex) { this.TraceData(LogLevel.Error, "Error at function Named [AddUserToSPGroupWidget.AddUserToGroup] . With Error Message: " + ex.ToString()); } finally { web.AllowUnsafeUpdates = false; } } } }); PLease guide me. Thanks in advance.

    Read the article

  • Mysql: ROLLBACK for multiple queries

    - by Raj
    Hi I have more than three MySql queiries in a PHP script triggered by scheduled task. If a query catch an error, script throw an exception and rollback that Mysql query. It works fine. However if first query works fine, but not 2nd query, throw an exception, it rollback 2nd one but not 1st query. I am using begin_trans(), commit and rollback() for individual queries because Sometimes i need to rollback one query, sometimes all queries. Is there any way to rollback one query or all queries? Thanks in advance UPDATE: I got it working, there was no problem with in begin_trans(), commit and rollback(), the database connection config was different for one query from other queries, crazy code without any comments!!!

    Read the article

  • How to get the place name by latitude and longitude using openstreetmap in android

    - by Gaurav kumar
    In my app i am using osm rather than google map.I have latitude and longitude.So from here how i will query to get the city name from osm database..please help me. final String requestString = "http://nominatim.openstreetmap.org/reverse?format=json&lat=" + Double.toString(lat) + "&lon=" + Double.toString(lon) + "&zoom=18&addressdetails=1"; RequestBuilder builder = new RequestBuilder(RequestBuilder.GET, URL.encode(requestString)); try { @SuppressWarnings("unused") Request request = builder.sendRequest(null, new RequestCallback() { @Override public void onResponseReceived(Request request, Response response) { if (response.getStatusCode() == 200) { String city = ""; try { JSONValue json = JSONParser.parseStrict(response); JSONObject address = json.isObject().get("address").isObject(); final String quotes = "^\"|\"$"; if (address.get("city") != null) { city = address.get("city").toString().replaceAll(quotes, ""); } else if (address.get("village") != null) { city = address.get("village").toString().replaceAll(quotes, ""); } } catch (Exception e) { } } } }); } catch (Exception e1) { }

    Read the article

  • Fleunt NHibernate not working outside of nunit test fixtures

    - by thorkia
    Okay, here is my problem... I created a Data Layer using the RTM Fluent Nhibernate. My create session code looks like this: _session = Fluently.Configure(). Database(SQLiteConfiguration.Standard.UsingFile("Data.s3db")) .Mappings( m => { m.FluentMappings.AddFromAssemblyOf<ProductMap>(); m.FluentMappings.AddFromAssemblyOf<ProductLogMap>(); }) .ExposeConfiguration(BuildSchema) .BuildSessionFactory(); When I reference the module in a test project, then create a test fixture that looks something like this: [Test] public void CanAddProduct() { var product = new Product {Code = "9", Name = "Test 9"}; IProductRepository repository = new ProductRepository(); repository.AddProduct(product); using (ISession session = OrmHelper.OpenSession()) { var fromDb = session.Get<Product>(product.Id); Assert.IsNotNull(fromDb); Assert.AreNotSame(fromDb, product); Assert.AreEqual(fromDb.Id, product.Id); } My tests pass. When I open up the created SQLite DB, the new Product with Code 9 is in it. the tables for Product and ProductLog are there. Now, when I create a new console application, and reference the same library, do something like this: Product product = new Product() {Code = "10", Name = "Hello"}; IProductRepository repository = new ProductRepository(); repository.AddProduct(product); Console.WriteLine(product.Id); Console.ReadLine(); It doesn't work. I actually get pretty nasty exception chain. To save you lots of head aches, here is the summary: Top Level exception: An invalid or incomplete configuration was used while creating a SessionFactory. Check PotentialReasons collection, and InnerException for more detail.\r\n\r\n The PotentialReasons collection is empty The Inner exception: The IDbCommand and IDbConnection implementation in the assembly System.Data.SQLite could not be found. Ensure that the assembly System.Data.SQLite is located in the application directory or in the Global Assembly Cache. If the assembly is in the GAC, use element in the application configuration file to specify the full name of the assembly. Both the unit test library and the console application reference the exact same version of System.Data.SQLite. Both projects have the exact same DLLs in the debug folder. I even tried copying SQLite DB the unit test library created into the debug directory of the console app, and removed the build schema lines and it still fails If anyone can help me figure out why this won't work outside of my unit tests it would be greatly appreciated. This crazy bug has me at a stand still.

    Read the article

  • Loading embedded resource on Windows 7

    - by Flack
    Hello, I have an app that works just fine on my WinXP machine. However, when I try running it on my Win7 machine, it fails whenever it tries to load an embedded resource. The resources are all there (I can see them using Reflector). The lines that fail are all of the form: Splash.Image = new Bitmap(typeof(ContainerForm).Assembly.GetManifestResourceStream("SplashTest.Resources.Logo.gif")); And they all fail with the same exception: Exception='System.ArgumentException: Parameter is not valid. at System.Drawing.Bitmap..ctor(Stream stream) I don't understand why this is not working on my Win7 machine but does on my usual WinXP dev machine. Any ideas?

    Read the article

  • Handling exceptions raised in observers

    - by sparky
    I have a Rails (2.3.5) application where there are many groups, and each Group has_many People. I have a Group edit form where users can create new people. When a new person is created, they are sent an email (the email address is user entered on the form). This is accomplished with an observer on the Person model. The problem comes when ActionMailer throws an exception - for example if the domain does not exist. Clearly that cannot be weeded out with a validation. There would seem to be 2 ways to deal with this: A begin...rescue...end block in the observer around the mailer. The problem with this is that the only way to pass any feedback to the user would be to set a global variable - as the observer is out of the MVC flow, I can't even set a flash[:error] there. A rescue_from in the Groups controller. This works fine, but has 2 problems. Firstly, there is no way to know which person threw the exception (all I can get is the 503 exception, no way to know which person caused the problem). This would be useful information to be able to pass back to the user - at the moment, there is no way for me to let them know which email address is the problem - at the moment, I just have to chuck the lot back at them, and issue an unhelpful message saying that one of them is not correct. Secondly (and to a certain extent this make the first point moot) it seems that it is necessary to call a render in the rescue_from, or it dies with a rather bizarre "can't convert Array into String" error from webbrick, with no stack trace & nothing in the log. Thus, I have to throw it back to the user when I come across the first error and have to stop processing the rest of the emails. Neither of the solutions are optimal. It would seem that the only way to get Rails to do what I want is option 1, and loathsome global variables. This would also rely on Rails being single threaded. Can anyone suggest a better solution to this problem?

    Read the article

  • ASP.NET Connection time out after being idle for a while

    - by yazz
    My ASP.NET website while trying to connect to the database for first time after a period of inactivity throws an time out exception. I understand the connections in the connection pool get terminated after some idle time for some reason (Firewall or Oracle settings) and the pool or app doesn't have a clue about it. Is there any way to validate the connection beforehand so that the first try doesn't throw an exception? I don't have much control over the DB or Firewall settings. So I have to deal with this is my application.(would prefer if there is any web.config settings) I am using: ASP.NET 2.0. Oracle server 11g, Microsoft Enterprise Library DAAB to do all my DB operations. I did some search on this topic but didnt find any solid solution for this yet :(

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • Out-of-the-box Eclipse PDT (PHP Development Tool) not capable of debugging PHP, why?

    - by Alex R
    I just finished reinstalling the "All-In-One Eclipse PDT" from zend.com. It's unable to debug even the simplest "Hello World" PHP script. How can such a major open-source app be released in such a bad shape? What am I doing wrong? This is the result of doing a "Debug As...": Problem signature: Problem Event Name: APPCRASH Application Name: php.exe Application Version: 5.2.9.9 Application Timestamp: 49dda267 Fault Module Name: ntdll.dll Fault Module Version: 6.0.6002.18005 Fault Module Timestamp: 49e03824 Exception Code: c0000130 Exception Offset: 0006f04e OS Version: 6.0.6002.2.2.0.768.3 Locale ID: 1033 Additional Information 1: 9d13 Additional Information 2: 1abee00edb3fc1158f9ad6f44f0f6be8 Additional Information 3: 9d13 Additional Information 4: 1abee00edb3fc1158f9ad6f44f0f6be8 Read our privacy statement: http://go.microsoft.com/fwlink/?linkid=50163&clcid=0x0409 I think it wants me to configure some additional stuff, but I have no clue what exactly to do.

    Read the article

  • Is it OK to open a DB4o file for query, insert, update multiple times?

    - by Khnle
    This is the way I am thinking of using DB4o. When I need to query, I would open the file, read and close: using (IObjectContainer db = Db4oFactory.OpenFile(Db4oFactory.NewConfiguration(), YapFileName)) { try { List<Pilot> pilots = db.Query<Pilot>().ToList<Pilot>(); } finally { try { db.Close(); } catch (Exception) { }; } } At some later time, when I need to insert, then using (IObjectContainer db = Db4oFactory.OpenFile(Db4oFactory.NewConfiguration(), YapFileName)) { try { Pilot pilot1 = new Pilot("Michael Schumacher", 100); db.Store(pilot1); } finally { try { db.Close(); } catch (Exception) { }; } } In this way, I thought I will keep the file more tidy by only having it open when needed, and have it closed most of the time. But I keep getting InvalidCastException Unable to cast object of type 'Db4objects.Db4o.Reflect.Generic.GenericObject' to type 'Pilot' What's the correct way to use DB4o?

    Read the article

  • unique_ptr boost equivalent?

    - by wowus
    Is there some equivalent class for C++1x's std::unique_ptr in the boost libraries? The behavior I'm looking for is being able to have an exception-safe factory function, like so... std::unique_ptr<Base> create_base() { return std::unique_ptr<Base>(new Derived); } void some_other_function() { std::unique_ptr<Base> b = create_base(); // Do some stuff with b that may or may not throw an exception... // Now b is destructed automagically. }

    Read the article

  • Why do I get a nullpointerexception at line ds.getPort in class L1?

    - by Fred
    import java.awt.; import java.awt.event.; import javax.swing.; import java.io.; import java.net.; import java.util.; public class Draw extends JFrame { /* * Socket stuff */ static String host; static int port; static int localport; DatagramSocket ds; Socket socket; Draw d; Paper p = new Paper(ds); public Draw(int localport, String host, int port) { d = this; this.localport = localport; this.host = host; this.port = port; try { ds = new DatagramSocket(localport); InetAddress ia = InetAddress.getByName(host); System.out.println("Attempting to connect DatagramSocket. Local port " + localport + " , foreign host " + host + ", foreign port " + port + "..."); ds.connect(ia, port); System.out.println("Success, ds.localport: " + ds.getLocalPort() + ", ds.port: " + ds.getPort() + ", address: " + ds.getInetAddress()); Reciever r = new Reciever(ds); r.start(); } catch (Exception e) { e.printStackTrace(); } setDefaultCloseOperation(EXIT_ON_CLOSE); getContentPane().add(p, BorderLayout.CENTER); setSize(640, 480); setVisible(true); } public static void main(String[] args) { int x = 0; for (String s : args){ if (x==0){ localport = Integer.parseInt(s); x++; } else if (x==1){ host = s; x++; } else if (x==2){ port = Integer.parseInt(s); } } Draw d = new Draw(localport, host, port); } } class Paper extends JPanel { DatagramSocket ds; private HashSet hs = new HashSet(); public Paper(DatagramSocket ds) { this.ds=ds; setBackground(Color.white); addMouseListener(new L1(ds)); addMouseMotionListener(new L2()); } public void paintComponent(Graphics g) { super.paintComponent(g); g.setColor(Color.black); Iterator i = hs.iterator(); while(i.hasNext()) { Point p = (Point)i.next(); g.fillOval(p.x, p.y, 2, 2); } } private void addPoint(Point p) { hs.add(p); repaint(); } class L1 extends MouseAdapter { DatagramSocket ds; public L1(DatagramSocket ds){ this.ds=ds; } public void mousePressed(MouseEvent me) { addPoint(me.getPoint()); Point p = me.getPoint(); String message = Integer.toString(p.x) + " " + Integer.toString(p.y); System.out.println(message); try{ byte[] data = message.getBytes("UTF-8"); //InetAddress ia = InetAddress.getByName(ds.host); String convertedMessage = new String(data, "UTF-8"); System.out.println("The converted string is " + convertedMessage); DatagramPacket dp = new DatagramPacket(data, data.length); System.out.println(ds.getPort()); //System.out.println(message); //System.out.println(ds.toString()); //ds.send(dp); /*System.out.println("2Sending a packet containing data: " +data +" to " + ia + ":" + d.port + "...");*/ } catch (Exception e){ e.printStackTrace(); } } } class L2 extends MouseMotionAdapter { public void mouseDragged(MouseEvent me) { addPoint(me.getPoint()); Point p = me.getPoint(); String message = Integer.toString(p.x) + " " + Integer.toString(p.y); //System.out.println(message); } } } class Reciever extends Thread{ DatagramSocket ds; byte[] buffer; Reciever(DatagramSocket ds){ this.ds = ds; buffer = new byte[65507]; } public void run(){ try { DatagramPacket packet = new DatagramPacket(buffer, buffer.length); while(true){ try { ds.receive(packet); String s = new String(packet.getData()); System.out.println(s); } catch (Exception e) { e.printStackTrace(); } } } catch (Exception e) { e.printStackTrace(); } } }

    Read the article

  • Can't Instantiate Windsor Custom Component Activator

    - by jeffn825
    Hi, I'm getting an exception calling Resolve: KernelException: Could not instantiate custom activator Inner Exception: {"Constructor on type 'MyProj.MyAdapter`1[[MyProj.MyBusinessObject, MyAsm, Version=1.0.0.0, Culture=neutral, PublicKeyToken=null]]' not found."} There's definitely a public parameterless constructor there (and I've verified this using reflection at runtime)...so I figure the problem might have to do with the fact that it's generic? I've tried getting the component model object and setting RequiresGenericArguments to true, but that hasn't gotten me anywhere. Any help would be much appreciated! Thanks.

    Read the article

  • Sending the files (At least 11 files) from folder through web service to android app.

    - by Shashank_Itmaster
    Hello All, I stuck in middle of this situation,Please help me out. My question is that I want to send files (Total 11 PDF Files) to android app using web service. I tried it with below code.Main Class from which web service is created public class MultipleFilesImpl implements MultipleFiles { public FileData[] sendPDFs() { FileData fileData = null; // List<FileData> filesDetails = new ArrayList<FileData>(); File fileFolder = new File( "C:/eclipse/workspace/AIPWebService/src/pdfs/"); // File fileTwo = new File( // "C:/eclipse/workspace/AIPWebService/src/simple.pdf"); File sendFiles[] = fileFolder.listFiles(); // sendFiles[0] = fileOne; // sendFiles[1] = fileTwo; DataHandler handler = null; char[] readLine = null; byte[] data = null; int offset = 0; int numRead = 0; InputStream stream = null; FileOutputStream outputStream = null; FileData[] filesData = null; try { System.out.println("Web Service Called Successfully"); for (int i = 0; i < sendFiles.length; i++) { handler = new DataHandler(new FileDataSource(sendFiles[i])); fileData = new FileData(); data = new byte[(int) sendFiles[i].length()]; stream = handler.getInputStream(); while (offset < data.length && (numRead = stream.read(data, offset, data.length - offset)) >= 0) { offset += numRead; } readLine = Base64Coder.encode(data); offset = 0; numRead = 0; System.out.println("'Reading File............................"); System.out.println("\n"); System.out.println(readLine); System.out.println("Data Reading Successful"); fileData.setFileName(sendFiles[i].getName()); fileData.setFileData(String.valueOf(readLine)); readLine = null; System.out.println("Data from bean " + fileData.getFileData()); outputStream = new FileOutputStream("D:/" + sendFiles[i].getName()); outputStream.write(Base64Coder.decode(fileData.getFileData())); outputStream.flush(); outputStream.close(); stream.close(); // FileData fileDetails = new FileData(); // fileDetails = fileData; // filesDetails.add(fileData); filesData = new FileData[(int) sendFiles[i].length()]; } // return fileData; } catch (FileNotFoundException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } catch (Exception e) { e.printStackTrace(); } return filesData; } } Also The Interface MultipleFiles:- public interface MultipleFiles extends Remote { public FileData[] sendPDFs() throws FileNotFoundException, IOException, Exception; } Here I am sending an array of bean "File Data",having properties viz. FileData & FileName. FileData- contains file data in encoded. FileName- encoded file name. The Bean:- (FileData) public class FileData { private String fileName; private String fileData; public String getFileName() { return fileName; } public void setFileName(String fileName) { this.fileName = fileName; } public String getFileData() { return fileData; } public void setFileData(String string) { this.fileData = string; } } The android DDMS gives out of memory exception when tried below code & when i tried to send two files then only first file is created. public class PDFActivity extends Activity { private final String METHOD_NAME = "sendPDFs"; private final String NAMESPACE = "http://webservice.uks.com/"; private final String SOAP_ACTION = NAMESPACE + METHOD_NAME; private final String URL = "http://192.168.1.123:8080/AIPWebService/services/MultipleFilesImpl"; /** Called when the activity is first created. */ @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); TextView textViewOne = (TextView) findViewById(R.id.textViewOne); try { SoapObject soapObject = new SoapObject(NAMESPACE, METHOD_NAME); SoapSerializationEnvelope envelope = new SoapSerializationEnvelope( SoapEnvelope.VER11); envelope.setOutputSoapObject(soapObject); textViewOne.setText("Web Service Started"); AndroidHttpTransport httpTransport = new AndroidHttpTransport(URL); httpTransport.call(SOAP_ACTION, envelope); // SoapObject result = (SoapObject) envelope.getResponse(); Object result = envelope.getResponse(); Log.i("Result", result.toString()); // String fileName = result.getProperty("fileName").toString(); // String fileData = result.getProperty("fileData").toString(); // Log.i("File Name", fileName); // Log.i("File Data", fileData); // File pdfFile = new File(fileName); // FileOutputStream outputStream = // openFileOutput(pdfFile.toString(), // MODE_PRIVATE); // outputStream.write(Base64Coder.decode(fileData)); Log.i("File", "File Created"); // textViewTwo.setText(result); // Object result = envelope.getResponse(); // FileOutputStream outputStream = openFileOutput(name, mode) } catch (Exception e) { e.printStackTrace(); } } } Please help with some explanation or changes in my code. Thanks in Advance.

    Read the article

  • jQuery effect on iframe parent document

    - by Jabes88
    Just wondering if anyone else has experienced this or knows why I am getting an error. I'm using javascript from within an iframe to call a parent dom element then use jQuery UI's effect core to shake it. Here is an example: $(document).ready(function(){ if ($("form").length>0) { $("form").submit(function(){ var oParentDoc = $(parent.document).find("div#element"); var action = $(this).attr("action"); var postdata = $(this).serialize(); $(oParentDoc).addClass("loading"); $.post(action,postdata,function(data){ $(oParentDoc).removeClass("loading").effect("shake",{"times":3,"distance":10},60); }); return false; }); } }); It works without the effect, but when I use an effect it gives me this error: uncaught exception: [Exception... "Component returned failure code: 0x80040111 (NS_ERROR_NOT_AVAILABLE) [nsIDOMCSSStyleDeclaration.getPropertyValue]" nsresult: "0x80040111 (NS_ERROR_NOT_AVAILABLE)" Thanks in advance for any insight :)

    Read the article

  • Destructor - does it get called if the app crashes

    - by Antonio Nakic Alfirevic
    Does a destructor get called if the app crashes? If it's an unhandled exception I'm guessing it does, but what about more serious errors, or something like a user killing the application process? And a few more potentially dumb questions: what happens to all the objects in an app when the app exits and all finalizers have been executed - do the objects get garbage collected or are they somehow all "unloaded" with the process or appdomain? is the garbage collector part of each application (runs in the same process) or is it independent?

    Read the article

  • Class Destructor Problem

    - by user279691
    I am making a simple class that contains a StreamWrite class Logger { private StreamWriter sw; private DateTime LastTime; public Logger(string filename) { LastTime = DateTime.Now; sw = new StreamWriter(filename); } public void Write(string s) { sw.WriteLine((DateTime.Now-LastTime).Ticks/10000+":"+ s); LastTime = DateTime.Now; } public void Flush() { sw.Flush(); } ~Logger() { sw.Close();//Raises Exception! } } But when I close this StreamWriter in the destructor, it raises an exception that the StreamWriter was already deleted? Why? And how to make it work such that when the Logger class is deleted, the StreamWriter is closed before deletion? Thanks!

    Read the article

  • Adding/removing session variables on Page OnInit/OnLoad in C#

    - by MKS
    Hi Guys, I am using C#. I am having below code in C#: protected override void OnInit(EventArgs e) { try { if (Session["boolSignOn"].ToString() == "true".ToString()) { lblPanelOpen.Text = Session["panelOpen"].ToString(); } else { lblPanelOpen.Text = Session["panelOpen"].ToString(); } } catch (Exception ex) { Logger.Error("Error processing request:" + ex.Message); } } protected override void OnLoad(EventArgs e) { try { if (!string.IsNullOrEmpty(Session["panelOpen"].ToString())) { lblPanelOpen.Text = string.Empty; Session.Remove("panelOpen"); } } catch (Exception ex) { Logger.Error("Unable to remove the session variable:" + ex.Message); } } In above code I am having a Session["panelOpen"] variable which is created from another user control and once my page is trying to render, I am storing Session["panelOpen"] in my hidden lblPanelOpen.Text on page OnInit() method, however when page is loaded completely then I am trying to remove the session variable. Please suggest!

    Read the article

  • SWT Composite consructor throws IllegalArgumentException on a non-null argument

    - by Alexey Romanov
    This piece of code (in Scala) val contents = { assert(mainWindow.detailsPane != null) new Composite(mainWindow.detailsPane, SWT.NONE) } throws an exception: Exception occurred java.lang.IllegalArgumentException: Argument not valid at org.eclipse.swt.SWT.error(Unknown Source) at org.eclipse.swt.SWT.error(Unknown Source) at org.eclipse.swt.SWT.error(Unknown Source) at org.eclipse.swt.widgets.Widget.error(Unknown Source) at org.eclipse.swt.widgets.Widget.checkParent(Unknown Source) at org.eclipse.swt.widgets.Widget.<init>(Unknown Source) at org.eclipse.swt.widgets.Control.<init>(Unknown Source) at org.eclipse.swt.widgets.Scrollable.<init>(Unknown Source) at org.eclipse.swt.widgets.Composite.<init>(Unknown Source) at main.scala.NodeViewPresenter$NodeViewImpl.<init>(NodeViewPresenter.scala:41) According to the documentation, IllegalArgumentException should only be thrown when the parent is null, but I am checking for that. detailsPane is a CTabFolder. Can anybody say why this could happen?

    Read the article

  • closing MQ connection

    - by OakvilleWork
    Good afternoon, I wrote a project to Get Park Queue Info from the IBM MQ, it has producing an error when attempting to close the connection though. It is written in java. Under application in Event Viewer on the MQ machine it displays two errors. They are: “Channel program ended abnormally. Channel program ‘system.def.surconn’ ended abnormally. Look at previous error messages for channel program ‘system.def.surconn’ in the error files to determine the cause of the failure. The other message states: “Error on receive from host rnanaj (10.10.12.34) An error occurred receiving data from rnanaj (10.10.12.34) over tcp/ip. This may be due to a communications failure. The return code from tcp/ip recv() call was 10054 (X’2746’). Record these values.” This must be something how I try to connect or close the connection, below I have my code to connect and close, any ideas?? Connect: _logger.info("Start"); File outputFile = new File(System.getProperty("PROJECT_HOME"), "run/" + this.getClass().getSimpleName() + "." + System.getProperty("qmgr") + ".txt"); FileUtils.mkdirs(outputFile.getParentFile()); Connection jmsConn = null; Session jmsSession = null; QueueBrowser queueBrowser = null; BufferedWriter commandsBw = null; try { // get queue connection MQConnectionFactory MQConn = new MQConnectionFactory(); MQConn.setHostName(System.getProperty("host")); MQConn.setPort(Integer.valueOf(System.getProperty("port"))); MQConn.setQueueManager(System.getProperty("qmgr")); MQConn.setChannel("SYSTEM.DEF.SVRCONN"); MQConn.setTransportType(JMSC.MQJMS_TP_CLIENT_MQ_TCPIP); jmsConn = (Connection) MQConn.createConnection(); jmsSession = jmsConn.createSession(false, Session.AUTO_ACKNOWLEDGE); Queue jmsQueue = jmsSession.createQueue("PARK"); // browse thru messages queueBrowser = jmsSession.createBrowser(jmsQueue); Enumeration msgEnum = queueBrowser.getEnumeration(); commandsBw = new BufferedWriter(new FileWriter(outputFile)); // String line = "DateTime\tMsgID\tOrigMsgID\tCorrelationID\tComputerName\tSubsystem\tDispatcherName\tProcessor\tJobID\tErrorMsg"; commandsBw.write(line); commandsBw.newLine(); while (msgEnum.hasMoreElements()) { Message message = (Message) msgEnum.nextElement(); line = dateFormatter.format(new Date(message.getJMSTimestamp())) + "\t" + message.getJMSMessageID() + "\t" + message.getStringProperty("pkd_orig_jms_msg_id") + "\t" + message.getJMSCorrelationID() + "\t" + message.getStringProperty("pkd_computer_name") + "\t" + message.getStringProperty("pkd_subsystem") + "\t" + message.getStringProperty("pkd_dispatcher_name") + "\t" + message.getStringProperty("pkd_processor") + "\t" + message.getStringProperty("pkd_job_id") + "\t" + message.getStringProperty("pkd_sysex_msg"); _logger.info(line); commandsBw.write(line); commandsBw.newLine(); } } Close: finally { IO.close(commandsBw); if (queueBrowser != null) { try { queueBrowser.close();} catch (Exception ignore) {}} if (jmsSession != null) { try { jmsSession.close();} catch (Exception ignore) {}} if (jmsConn != null) { try { jmsConn.stop();} catch (Exception ignore) {}} }

    Read the article

  • Is there anything wrong with my Factory class?

    - by Alex
    class PieceFactory { @SuppressWarnings("rawtypes") public Piece createPiece(String pieceType) throws Throwable{ Class pieceClass = Class.forName(pieceType); Piece piece = (Piece) pieceClass.newInstance(); return piece; } } I'm not all used to handling exceptions yet therefore I'm just throwing them, but everywhere I use a method that uses this factory it tells me I have to throw exceptions like throwable. For example, in one of my classes I have a method that instantiates a lot of objects using the method that uses the factory. I can use the method in that class by just throwing the exception, however it won't work if I try to pass a reference to that class to another class and then use the method from there. Then it forces me to try catch the exception. I probably don't need a factory but it seemed interesting and I'd like to try to use patterns. The reason I created the factory was that I have 6 subclasses of Piece and I wan't to use a method to instantiate them by passing the type of subclass I want as an argument to the method.

    Read the article

< Previous Page | 159 160 161 162 163 164 165 166 167 168 169 170  | Next Page >