Search Results

Search found 4222 results on 169 pages for 'dtd parsing'.

Page 165/169 | < Previous Page | 161 162 163 164 165 166 167 168 169  | Next Page >

  • HTML Tidy in NetBeans IDE

    - by Geertjan
    First step in integrating HTML Tidy (via its JTidy implementation) into NetBeans IDE: The reason why I started doing this is because I want to integrate this into the pluggable analyzer functionality of NetBeans IDE that I recently blogged about, i.e., where the FindBugs functionality is found. So a logical first step is to get it working in an Action class, after which I can port it into the analyzer infrastructure: import java.awt.event.ActionEvent; import java.awt.event.ActionListener; import java.io.IOException; import java.io.PrintWriter; import java.io.StringWriter; import org.openide.awt.ActionID; import org.openide.awt.ActionReference; import org.openide.awt.ActionReferences; import org.openide.awt.ActionRegistration; import org.openide.cookies.EditorCookie; import org.openide.cookies.LineCookie; import org.openide.loaders.DataObject; import org.openide.text.Line; import org.openide.text.Line.ShowOpenType; import org.openide.util.Exceptions; import org.openide.util.NbBundle.Messages; import org.openide.windows.IOProvider; import org.openide.windows.InputOutput; import org.openide.windows.OutputEvent; import org.openide.windows.OutputListener; import org.openide.windows.OutputWriter; import org.w3c.tidy.Tidy; @ActionID(     category = "Tools", id = "org.jtidy.TidyAction") @ActionRegistration(     displayName = "#CTL_TidyAction") @ActionReferences({     @ActionReference(path = "Loaders/text/html/Actions", position = 150),     @ActionReference(path = "Editors/text/html/Popup", position = 750) }) @Messages("CTL_TidyAction=Run HTML Tidy") public final class TidyAction implements ActionListener {     private final DataObject context;     private final OutputWriter writer;     private EditorCookie ec = null;     public TidyAction(DataObject context) {         this.context = context;         ec = context.getLookup().lookup(org.openide.cookies.EditorCookie.class);         InputOutput io = IOProvider.getDefault().getIO("HTML Tidy", false);         io.select();         writer = io.getOut();     }     @Override     public void actionPerformed(ActionEvent ev) {         Tidy tidy = new Tidy();         try {             writer.reset();             StringWriter stringWriter = new StringWriter();             PrintWriter errorWriter = new PrintWriter(stringWriter);             tidy.setErrout(errorWriter);             tidy.parse(context.getPrimaryFile().getInputStream(), System.out);             String[] split = stringWriter.toString().split("\n");             for (final String string : split) {                 final int end = string.indexOf(" c");                 if (string.startsWith("line")) {                     writer.println(string, new OutputListener() {                         @Override                         public void outputLineAction(OutputEvent oe) {                             LineCookie lc = context.getLookup().lookup(LineCookie.class);                             int lineNumber = Integer.parseInt(string.substring(0, end).replace("line ", ""));                             Line line = lc.getLineSet().getOriginal(lineNumber - 1);                             line.show(ShowOpenType.OPEN, Line.ShowVisibilityType.FOCUS);                         }                         @Override                         public void outputLineSelected(OutputEvent oe) {}                         @Override                         public void outputLineCleared(OutputEvent oe) {}                     });                 }             }         } catch (IOException ex) {             Exceptions.printStackTrace(ex);         }     } } The string parsing above is ugly but gets the job done for now. A problem integrating this into the pluggable analyzer functionality is the limitation of its scope. The analyzer lets you select one or more projects, or individual files, but not a folder. So it doesn't work on folders in the Favorites window, for example, which is where I'd like to apply HTML Tidy, across multiple folders via the analyzer functionality. That's a bit of a bummer that I'm hoping to get around somehow.

    Read the article

  • Configuring WCF to Handle a Signature on a SOAP Message from an Oracle Server

    - by AlEl
    I'm trying to use WCF to consume a web service provided by a third-party's Oracle Application Server. I pass a username and password and as part of the response the web service returns a standard security tag in the header which includes a digest and signature. With my current setup, I successfully send a request to the server and the web service sends the expected response data back. However, when parsing the response WCF throws a MessageSecurityException, with an InnerException.Message of "Supporting token signatures not expected." My guess is that WCF wants me to configure it to handle the signature and verify it. I have a certificate from the third party that hosts the web service that I should be able to use to verify the signature. It's in the form of -----BEGIN CERTIFICATE----- [certificate garble] -----END CERTIFICATE----- Here's a sample header from a response that makes WCF throw the exception: <?xml version="1.0" encoding="UTF-8"?> <soap:Envelope xmlns:soap="http://schemas.xmlsoap.org/soap/envelope/"> <soap:Header> <wsse:Security soap:mustUnderstand="1" xmlns:wsse="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-secext-1.0.xsd" xmlns="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-secext-1.0.xsd"> <dsig:Signature xmlns="http://www.w3.org/2000/09/xmldsig#" xmlns:dsig="http://www.w3.org/2000/09/xmldsig#"> <dsig:SignedInfo> <dsig:CanonicalizationMethod Algorithm="http://www.w3.org/2001/10/xml-exc-c14n#"/> <dsig:SignatureMethod Algorithm="http://www.w3.org/2000/09/xmldsig#rsa-sha1"/> <dsig:Reference URI="#_51IUwNWRVvPOcz12pZHLNQ22"> <dsig:Transforms> <dsig:Transform Algorithm="http://www.w3.org/2001/10/xml-exc-c14n#"/> </dsig:Transforms> <dsig:DigestMethod Algorithm="http://www.w3.org/2000/09/xmldsig#sha1"/> <dsig:DigestValue> [DigestValue here] </dsig:DigestValue> </dsig:Reference> <dsig:Reference URI="#_dI5j0EqxrVsj0e62J6vd6w22"> <dsig:Transforms> <dsig:Transform Algorithm="http://www.w3.org/2001/10/xml-exc-c14n#"/> </dsig:Transforms> <dsig:DigestMethod Algorithm="http://www.w3.org/2000/09/xmldsig#sha1"/> <dsig:DigestValue> [DigestValue here] </dsig:DigestValue> </dsig:Reference> </dsig:SignedInfo> <dsig:SignatureValue> [Signature Value Here] </dsig:SignatureValue> <dsig:KeyInfo> <wsse:SecurityTokenReference xmlns="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-secext-1.0.xsd"> <wsse:Reference URI="#BST-9nKWbrE4LRv6maqstrGuUQ22" ValueType="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-x509-token-profile-1.0#X509v3"/> </wsse:SecurityTokenReference> </dsig:KeyInfo> </dsig:Signature> <wsse:BinarySecurityToken ValueType="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-x509-token-profile-1.0#X509v3" EncodingType="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-soap-message-security-1.0#Base64Binary" wsu:Id="BST-9nKWbrE4LRv6maqstrGuUQ22" xmlns:wsu="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-utility-1.0.xsd"> [Security Token Here] </wsse:BinarySecurityToken> <wsu:Timestamp wsu:Id="_dI5j0EqxrVsj0e62J6vd6w22" xmlns:wsu="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-utility-1.0.xsd" xmlns="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-utility-1.0.xsd"> <wsu:Created>2010-05-26T18:46:30Z</wsu:Created> </wsu:Timestamp> </wsse:Security> </soap:Header> <soap:Body wsu:Id="_51IUwNWRVvPOcz12pZHLNQ22" xmlns:wsu="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-utility-1.0.xsd"> [Body content here] </soap:Body> </soap:Envelope> My binding configuration looks like: <basicHttpBinding> <binding name="myBinding" closeTimeout="00:01:00" openTimeout="00:01:00" receiveTimeout="00:10:00" sendTimeout="00:01:00" allowCookies="false" bypassProxyOnLocal="false" hostNameComparisonMode="StrongWildcard" maxBufferSize="65536" maxBufferPoolSize="524288" maxReceivedMessageSize="65536" messageEncoding="Text" textEncoding="utf-8" transferMode="Buffered" useDefaultWebProxy="true"> <readerQuotas maxDepth="32" maxStringContentLength="8192" maxArrayLength="16384" maxBytesPerRead="4096" maxNameTableCharCount="16384" /> <security mode="TransportWithMessageCredential"> <transport clientCredentialType="None" proxyCredentialType="None" realm="" /> <message clientCredentialType="UserName" algorithmSuite="Default" /> </security> </binding> </basicHttpBinding> I'm new at WCF, so I'm sorry if this is a bit of a dumb question. I've been trying to Google solutions, but there seem to be so many different ways to configure WCF that I'm getting overwhelmed. Thanks in advance!

    Read the article

  • How to include an external jar in gwt client side?

    - by Sergio del Amo
    I would like to use the org.apache.commons.validator.GenericValidator class in a view class of my GWT web app. I have read that I have to implicitely tell that I intend to use this external library. I thought adding the next line into my App.gwt.xml would work. <inherits name='org.apache.commons.validator.GenericValidator'/> I get the next error: Loading inherited module 'org.apache.commons.validator.GenericValidator' [ERROR] Unable to find 'org/apache/commons/validator/GenericValidator.gwt.xml' on your classpath; could be a typo, or maybe you forgot to include a classpath entry for source? [ERROR] Line 13: Unexpected exception while processing element 'inherits' com.google.gwt.core.ext.UnableToCompleteException: (see previous log entries) at com.google.gwt.dev.cfg.ModuleDefLoader.nestedLoad(ModuleDefLoader.java:239) at com.google.gwt.dev.cfg.ModuleDefSchema$BodySchema.__inherits_begin(ModuleDefSchema.java:354) at sun.reflect.GeneratedMethodAccessor1.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at com.google.gwt.dev.util.xml.HandlerMethod.invokeBegin(HandlerMethod.java:223) at com.google.gwt.dev.util.xml.ReflectiveParser$Impl.startElement(ReflectiveParser.java:270) at com.sun.org.apache.xerces.internal.parsers.AbstractSAXParser.startElement(AbstractSAXParser.java:501) at com.sun.org.apache.xerces.internal.parsers.AbstractXMLDocumentParser.emptyElement(AbstractXMLDocumentParser.java:179) at com.sun.org.apache.xerces.internal.impl.XMLDocumentFragmentScannerImpl.scanStartElement(XMLDocumentFragmentScannerImpl.java:1339) at com.sun.org.apache.xerces.internal.impl.XMLDocumentFragmentScannerImpl$FragmentContentDriver.next(XMLDocumentFragmentScannerImpl.java:2747) at com.sun.org.apache.xerces.internal.impl.XMLDocumentScannerImpl.next(XMLDocumentScannerImpl.java:648) at com.sun.org.apache.xerces.internal.impl.XMLDocumentFragmentScannerImpl.scanDocument(XMLDocumentFragmentScannerImpl.java:510) at com.sun.org.apache.xerces.internal.parsers.XML11Configuration.parse(XML11Configuration.java:807) at com.sun.org.apache.xerces.internal.parsers.XML11Configuration.parse(XML11Configuration.java:737) at com.sun.org.apache.xerces.internal.parsers.XMLParser.parse(XMLParser.java:107) at com.sun.org.apache.xerces.internal.parsers.AbstractSAXParser.parse(AbstractSAXParser.java:1205) at com.sun.org.apache.xerces.internal.jaxp.SAXParserImpl$JAXPSAXParser.parse(SAXParserImpl.java:522) at com.google.gwt.dev.util.xml.ReflectiveParser$Impl.parse(ReflectiveParser.java:327) at com.google.gwt.dev.util.xml.ReflectiveParser$Impl.access$100(ReflectiveParser.java:48) at com.google.gwt.dev.util.xml.ReflectiveParser.parse(ReflectiveParser.java:398) at com.google.gwt.dev.cfg.ModuleDefLoader.nestedLoad(ModuleDefLoader.java:257) at com.google.gwt.dev.cfg.ModuleDefLoader$1.load(ModuleDefLoader.java:169) at com.google.gwt.dev.cfg.ModuleDefLoader.doLoadModule(ModuleDefLoader.java:283) at com.google.gwt.dev.cfg.ModuleDefLoader.loadFromClassPath(ModuleDefLoader.java:141) at com.google.gwt.dev.Compiler.run(Compiler.java:184) at com.google.gwt.dev.Compiler$1.run(Compiler.java:152) at com.google.gwt.dev.CompileTaskRunner.doRun(CompileTaskRunner.java:87) at com.google.gwt.dev.CompileTaskRunner.runWithAppropriateLogger(CompileTaskRunner.java:81) at com.google.gwt.dev.Compiler.main(Compiler.java:159) [ERROR] Failure while parsing XML com.google.gwt.core.ext.UnableToCompleteException: (see previous log entries) at com.google.gwt.dev.util.xml.DefaultSchema.onHandlerException(DefaultSchema.java:56) at com.google.gwt.dev.util.xml.Schema.onHandlerException(Schema.java:66) at com.google.gwt.dev.util.xml.Schema.onHandlerException(Schema.java:66) at com.google.gwt.dev.util.xml.HandlerMethod.invokeBegin(HandlerMethod.java:233) at com.google.gwt.dev.util.xml.ReflectiveParser$Impl.startElement(ReflectiveParser.java:270) at com.sun.org.apache.xerces.internal.parsers.AbstractSAXParser.startElement(AbstractSAXParser.java:501) at com.sun.org.apache.xerces.internal.parsers.AbstractXMLDocumentParser.emptyElement(AbstractXMLDocumentParser.java:179) at com.sun.org.apache.xerces.internal.impl.XMLDocumentFragmentScannerImpl.scanStartElement(XMLDocumentFragmentScannerImpl.java:1339) at com.sun.org.apache.xerces.internal.impl.XMLDocumentFragmentScannerImpl$FragmentContentDriver.next(XMLDocumentFragmentScannerImpl.java:2747) at com.sun.org.apache.xerces.internal.impl.XMLDocumentScannerImpl.next(XMLDocumentScannerImpl.java:648) at com.sun.org.apache.xerces.internal.impl.XMLDocumentFragmentScannerImpl.scanDocument(XMLDocumentFragmentScannerImpl.java:510) at com.sun.org.apache.xerces.internal.parsers.XML11Configuration.parse(XML11Configuration.java:807) at com.sun.org.apache.xerces.internal.parsers.XML11Configuration.parse(XML11Configuration.java:737) at com.sun.org.apache.xerces.internal.parsers.XMLParser.parse(XMLParser.java:107) at com.sun.org.apache.xerces.internal.parsers.AbstractSAXParser.parse(AbstractSAXParser.java:1205) at com.sun.org.apache.xerces.internal.jaxp.SAXParserImpl$JAXPSAXParser.parse(SAXParserImpl.java:522) at com.google.gwt.dev.util.xml.ReflectiveParser$Impl.parse(ReflectiveParser.java:327) at com.google.gwt.dev.util.xml.ReflectiveParser$Impl.access$100(ReflectiveParser.java:48) at com.google.gwt.dev.util.xml.ReflectiveParser.parse(ReflectiveParser.java:398) at com.google.gwt.dev.cfg.ModuleDefLoader.nestedLoad(ModuleDefLoader.java:257) at com.google.gwt.dev.cfg.ModuleDefLoader$1.load(ModuleDefLoader.java:169) at com.google.gwt.dev.cfg.ModuleDefLoader.doLoadModule(ModuleDefLoader.java:283) at com.google.gwt.dev.cfg.ModuleDefLoader.loadFromClassPath(ModuleDefLoader.java:141) at com.google.gwt.dev.Compiler.run(Compiler.java:184) at com.google.gwt.dev.Compiler$1.run(Compiler.java:152) at com.google.gwt.dev.CompileTaskRunner.doRun(CompileTaskRunner.java:87) at com.google.gwt.dev.CompileTaskRunner.runWithAppropriateLogger(CompileTaskRunner.java:81) at com.google.gwt.dev.Compiler.main(Compiler.java:159) [ERROR] Unexpected error while processing XML com.google.gwt.core.ext.UnableToCompleteException: (see previous log entries) at com.google.gwt.dev.util.xml.ReflectiveParser$Impl.parse(ReflectiveParser.java:351) at com.google.gwt.dev.util.xml.ReflectiveParser$Impl.access$100(ReflectiveParser.java:48) at com.google.gwt.dev.util.xml.ReflectiveParser.parse(ReflectiveParser.java:398) at com.google.gwt.dev.cfg.ModuleDefLoader.nestedLoad(ModuleDefLoader.java:257) at com.google.gwt.dev.cfg.ModuleDefLoader$1.load(ModuleDefLoader.java:169) at com.google.gwt.dev.cfg.ModuleDefLoader.doLoadModule(ModuleDefLoader.java:283) at com.google.gwt.dev.cfg.ModuleDefLoader.loadFromClassPath(ModuleDefLoader.java:141) at com.google.gwt.dev.Compiler.run(Compiler.java:184) at com.google.gwt.dev.Compiler$1.run(Compiler.java:152) at com.google.gwt.dev.CompileTaskRunner.doRun(CompileTaskRunner.java:87) at com.google.gwt.dev.CompileTaskRunner.runWithAppropriateLogger(CompileTaskRunner.java:81) at com.google.gwt.dev.Compiler.main(Compiler.java:159) Anyone knows how it works?

    Read the article

  • Error deploying Spring application to Jboss due to ClassCastException

    - by Rafael
    When I try to deploy a spring application in Jboss, I get this error: 11:32:34,045 ERROR [AbstractKernelController] Error installing to Start: name=persistence.unit:unitName=#ehr-punit state=Create java.lang.RuntimeException: Specification violation [EJB3 JPA 6.2.1.2] - You have not defined a jta-data-source for a JTA enabled persistence context named: ehr-punit at org.jboss.jpa.deployment.PersistenceUnitInfoImpl.(PersistenceUnitInfoImpl.java:115) at org.jboss.jpa.deployment.PersistenceUnitDeployment.start(PersistenceUnitDeployment.java:275) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at org.jboss.reflect.plugins.introspection.ReflectionUtils.invoke(ReflectionUtils.java:59) at org.jboss.reflect.plugins.introspection.ReflectMethodInfoImpl.invoke(ReflectMethodInfoImpl.java:150) at org.jboss.joinpoint.plugins.BasicMethodJoinPoint.dispatch(BasicMethodJoinPoint.java:66) at org.jboss.kernel.plugins.dependency.KernelControllerContextAction$JoinpointDispatchWrapper.execute(KernelControllerContextAction.java:241) at org.jboss.kernel.plugins.dependency.ExecutionWrapper.execute(ExecutionWrapper.java:47) at org.jboss.kernel.plugins.dependency.KernelControllerContextAction.dispatchExecutionWrapper(KernelControllerContextAction.java:109) at org.jboss.kernel.plugins.dependency.KernelControllerContextAction.dispatchJoinPoint(KernelControllerContextAction.java:70) at org.jboss.kernel.plugins.dependency.LifecycleAction.installActionInternal(LifecycleAction.java:221) at org.jboss.kernel.plugins.dependency.InstallsAwareAction.installAction(InstallsAwareAction.java:54) at org.jboss.kernel.plugins.dependency.InstallsAwareAction.installAction(InstallsAwareAction.java:42) at org.jboss.dependency.plugins.action.SimpleControllerContextAction.simpleInstallAction(SimpleControllerContextAction.java:62) at org.jboss.dependency.plugins.action.AccessControllerContextAction.install(AccessControllerContextAction.java:71) at org.jboss.dependency.plugins.AbstractControllerContextActions.install(AbstractControllerContextActions.java:51) at org.jboss.dependency.plugins.AbstractControllerContext.install(AbstractControllerContext.java:348) at org.jboss.dependency.plugins.AbstractController.install(AbstractController.java:1631) at org.jboss.dependency.plugins.AbstractController.incrementState(AbstractController.java:934) at org.jboss.dependency.plugins.AbstractController.resolveContexts(AbstractController.java:1082) at org.jboss.dependency.plugins.AbstractController.resolveContexts(AbstractController.java:984) at org.jboss.dependency.plugins.AbstractController.install(AbstractController.java:774) at org.jboss.dependency.plugins.AbstractController.install(AbstractController.java:540) at org.jboss.deployers.vfs.deployer.kernel.BeanMetaDataDeployer.deploy(BeanMetaDataDeployer.java:121) at org.jboss.deployers.vfs.deployer.kernel.BeanMetaDataDeployer.deploy(BeanMetaDataDeployer.java:51) at org.jboss.deployers.spi.deployer.helpers.AbstractSimpleRealDeployer.internalDeploy(AbstractSimpleRealDeployer.java:62) at org.jboss.deployers.spi.deployer.helpers.AbstractRealDeployer.deploy(AbstractRealDeployer.java:50) at org.jboss.deployers.plugins.deployers.DeployerWrapper.deploy(DeployerWrapper.java:171) at org.jboss.deployers.plugins.deployers.DeployersImpl.doDeploy(DeployersImpl.java:1439) at org.jboss.deployers.plugins.deployers.DeployersImpl.doInstallParentFirst(DeployersImpl.java:1157) at org.jboss.deployers.plugins.deployers.DeployersImpl.doInstallParentFirst(DeployersImpl.java:1178) at org.jboss.deployers.plugins.deployers.DeployersImpl.install(DeployersImpl.java:1098) at org.jboss.dependency.plugins.AbstractControllerContext.install(AbstractControllerContext.java:348) at org.jboss.dependency.plugins.AbstractController.install(AbstractController.java:1631) at org.jboss.dependency.plugins.AbstractController.incrementState(AbstractController.java:934) at org.jboss.dependency.plugins.AbstractController.resolveContexts(AbstractController.java:1082) at org.jboss.dependency.plugins.AbstractController.resolveContexts(AbstractController.java:984) at org.jboss.dependency.plugins.AbstractController.change(AbstractController.java:822) at org.jboss.dependency.plugins.AbstractController.change(AbstractController.java:553) at org.jboss.deployers.plugins.deployers.DeployersImpl.process(DeployersImpl.java:781) at org.jboss.deployers.plugins.main.MainDeployerImpl.process(MainDeployerImpl.java:702) at org.jboss.system.server.profileservice.repository.MainDeployerAdapter.process(MainDeployerAdapter.java:117) at org.jboss.system.server.profileservice.repository.ProfileDeployAction.install(ProfileDeployAction.java:70) at org.jboss.system.server.profileservice.repository.AbstractProfileAction.install(AbstractProfileAction.java:53) at org.jboss.system.server.profileservice.repository.AbstractProfileService.install(AbstractProfileService.java:361) at org.jboss.dependency.plugins.AbstractControllerContext.install(AbstractControllerContext.java:348) at org.jboss.dependency.plugins.AbstractController.install(AbstractController.java:1631) at org.jboss.dependency.plugins.AbstractController.incrementState(AbstractController.java:934) at org.jboss.dependency.plugins.AbstractController.resolveContexts(AbstractController.java:1082) at org.jboss.dependency.plugins.AbstractController.resolveContexts(AbstractController.java:984) at org.jboss.dependency.plugins.AbstractController.change(AbstractController.java:822) at org.jboss.dependency.plugins.AbstractController.change(AbstractController.java:553) at org.jboss.system.server.profileservice.repository.AbstractProfileService.activateProfile(AbstractProfileService.java:306) at org.jboss.system.server.profileservice.ProfileServiceBootstrap.start(ProfileServiceBootstrap.java:271) at org.jboss.bootstrap.AbstractServerImpl.start(AbstractServerImpl.java:461) at org.jboss.Main.boot(Main.java:221) at org.jboss.Main$1.run(Main.java:556) at java.lang.Thread.run(Thread.java:619) 11:32:35,615 INFO [TomcatDeployment] deploy, ctxPath=/ehr-web 11:32:35,986 INFO [[/ehr-web]] Initializing Spring root WebApplicationContext 11:32:35,986 INFO [ContextLoader] Root WebApplicationContext: initialization started 11:32:36,046 INFO [XmlWebApplicationContext] Refreshing org.springframework.web.context.support.XmlWebApplicationContext@1392743: display name [Root WebApplicationContext]; startup date [Mon Jul 20 11:32:36 BRT 2009]; root of context hierarchy 11:32:36,184 INFO [XmlBeanDefinitionReader] Loading XML bean definitions from ServletContext resource [/WEB-INF/applicationContext.xml] 11:32:36,189 ERROR [ContextLoader] Context initialization failed org.springframework.beans.factory.BeanDefinitionStoreException: Unexpected exception parsing XML document from ServletContext resource [/WEB-INF/applicationContext.xml]; nested exception is java.lang.ClassCastException: org.apache.xerces.jaxp.DocumentBuilderFactoryImpl cannot be cast to javax.xml.parsers.DocumentBuilderFactory at org.springframework.beans.factory.xml.XmlBeanDefinitionReader.doLoadBeanDefinitions(XmlBeanDefinitionReader.java:420) at org.springframework.beans.factory.xml.XmlBeanDefinitionReader.loadBeanDefinitions(XmlBeanDefinitionReader.java:342) at org.springframework.beans.factory.xml.XmlBeanDefinitionReader.loadBeanDefinitions(XmlBeanDefinitionReader.java:310) at org.springframework.beans.factory.support.AbstractBeanDefinitionReader.loadBeanDefinitions(AbstractBeanDefinitionReader.java:143) at org.springframework.beans.factory.support.AbstractBeanDefinitionReader.loadBeanDefinitions(AbstractBeanDefinitionReader.java:178) at org.springframework.beans.factory.support.AbstractBeanDefinitionReader.loadBeanDefinitions(AbstractBeanDefinitionReader.java:149) at org.springframework.web.context.support.XmlWebApplicationContext.loadBeanDefinitions(XmlWebApplicationContext.java:124) at org.springframework.web.context.support.XmlWebApplicationContext.loadBeanDefinitions(XmlWebApplicationContext.java:92) at org.springframework.context.support.AbstractRefreshableApplicationContext.refreshBeanFactory(AbstractRefreshableApplicationContext.java:123) at org.springframework.context.support.AbstractApplicationContext.obtainFreshBeanFactory(AbstractApplicationContext.java:422) at org.springframework.context.support.AbstractApplicationContext.refresh(AbstractApplicationContext.java:352) at org.springframework.web.context.ContextLoader.createWebApplicationContext(ContextLoader.java:255) at org.springframework.web.context.ContextLoader.initWebApplicationContext(ContextLoader.java:199) at org.springframework.web.context.ContextLoaderListener.contextInitialized(ContextLoaderListener.java:45) at org.apache.catalina.core.StandardContext.listenerStart(StandardContext.java:3910) at org.apache.catalina.core.StandardContext.start(StandardContext.java:4393) at org.jboss.web.tomcat.service.deployers.TomcatDeployment.performDeployInternal(TomcatDeployment.java:310) at org.jboss.web.tomcat.service.deployers.TomcatDeployment.performDeploy(TomcatDeployment.java:142) at org.jboss.web.deployers.AbstractWarDeployment.start(AbstractWarDeployment.java:461) at org.jboss.web.deployers.WebModule.startModule(WebModule.java:118) at org.jboss.web.deployers.WebModule.start(WebModule.java:97) at sun.reflect.NativeMethodAccessorImpl.invoke0(Native Method) at sun.reflect.NativeMethodAccessorImpl.invoke(NativeMethodAccessorImpl.java:39) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at org.jboss.mx.interceptor.ReflectedDispatcher.invoke(ReflectedDispatcher.java:157) at org.jboss.mx.server.Invocation.dispatch(Invocation.java:96) at org.jboss.mx.server.Invocation.invoke(Invocation.java:88) at org.jboss.mx.server.AbstractMBeanInvoker.invoke(AbstractMBeanInvoker.java:264) at org.jboss.mx.server.MBeanServerImpl.invoke(MBeanServerImpl.java:668) at org.jboss.system.microcontainer.ServiceProxy.invoke(ServiceProxy.java:206) at $Proxy38.start(Unknown Source) at org.jboss.system.microcontainer.StartStopLifecycleAction.installAction(StartStopLifecycleAction.java:42) at org.jboss.system.microcontainer.StartStopLifecycleAction.installAction(StartStopLifecycleAction.java:37) at org.jboss.dependency.plugins.action.SimpleControllerContextAction.simpleInstallAction(SimpleControllerContextAction.java:62) at org.jboss.dependency.plugins.action.AccessControllerContextAction.install(AccessControllerContextAction.java:71) at org.jboss.dependency.plugins.AbstractControllerContextActions.install(AbstractControllerContextActions.java:51) at org.jboss.dependency.plugins.AbstractControllerContext.install(AbstractControllerContext.java:348) at org.jboss.system.microcontainer.ServiceControllerContext.install(ServiceControllerContext.java:286) at org.jboss.dependency.plugins.AbstractController.install(AbstractController.java:1631) at org.jboss.dependency.plugins.AbstractController.incrementState(AbstractController.java:934) at org.jboss.dependency.plugins.AbstractController.resolveContexts(AbstractController.java:1082) at org.jboss.dependency.plugins.AbstractController.resolveContexts(AbstractController.java:984) at org.jboss.dependency.plugins.AbstractController.change(AbstractController.java:822) at org.jboss.dependency.plugins.AbstractController.change(AbstractController.java:553) at org.jboss.system.ServiceController.doChange(ServiceController.java:688) at org.jboss.system.ServiceController.start(ServiceController.java:460) at org.jboss.system.deployers.ServiceDeployer.start(ServiceDeployer.java:163) at org.jboss.system.deployers.ServiceDeployer.deploy(ServiceDeployer.java:99) at org.jboss.system.deployers.ServiceDeployer.deploy(ServiceDeployer.java:46) at org.jboss.deployers.spi.deployer.helpers.AbstractSimpleRealDeployer.internalDeploy(AbstractSimpleRealDeployer.java:62) at org.jboss.deployers.spi.deployer.helpers.AbstractRealDeployer.deploy(AbstractRealDeployer.java:50) at org.jboss.deployers.plugins.deployers.DeployerWrapper.deploy(DeployerWrapper.java:171) at org.jboss.deployers.plugins.deployers.DeployersImpl.doDeploy(DeployersImpl.java:1439) at org.jboss.deployers.plugins.deployers.DeployersImpl.doInstallParentFirst(DeployersImpl.java:1157) at org.jboss.deployers.plugins.deployers.DeployersImpl.doInstallParentFirst(DeployersImpl.java:1178) at org.jboss.deployers.plugins.deployers.DeployersImpl.install(DeployersImpl.java:1098) at org.jboss.dependency.plugins.AbstractControllerContext.install(AbstractControllerContext.java:348) at org.jboss.dependency.plugins.AbstractController.install(AbstractController.java:1631) at org.jboss.dependency.plugins.AbstractController.incrementState(AbstractController.java:934) at org.jboss.dependency.plugins.AbstractController.resolveContexts(AbstractController.java:1082) at org.jboss.dependency.plugins.AbstractController.resolveContexts(AbstractController.java:984) at org.jboss.dependency.plugins.AbstractController.change(AbstractController.java:822) at org.jboss.dependency.plugins.AbstractController.change(AbstractController.java:553) at org.jboss.deployers.plugins.deployers.DeployersImpl.process(DeployersImpl.java:781) at org.jboss.deployers.plugins.main.MainDeployerImpl.process(MainDeployerImpl.java:702) at org.jboss.system.server.profileservice.repository.MainDeployerAdapter.process(MainDeployerAdapter.java:117) at org.jboss.system.server.profileservice.repository.ProfileDeployAction.install(ProfileDeployAction.java:70) at org.jboss.system.server.profileservice.repository.AbstractProfileAction.install(AbstractProfileAction.java:53) at org.jboss.system.server.profileservice.repository.AbstractProfileService.install(AbstractProfileService.java:361) at org.jboss.dependency.plugins.AbstractControllerContext.install(AbstractControllerContext.java:348) at org.jboss.dependency.plugins.AbstractController.install(AbstractController.java:1631) at org.jboss.dependency.plugins.AbstractController.incrementState(AbstractController.java:934) at org.jboss.dependency.plugins.AbstractController.resolveContexts(AbstractController.java:1082) at org.jboss.dependency.plugins.AbstractController.resolveContexts(AbstractController.java:984) at org.jboss.dependency.plugins.AbstractController.change(AbstractController.java:822) at org.jboss.dependency.plugins.AbstractController.change(AbstractController.java:553) at org.jboss.system.server.profileservice.repository.AbstractProfileService.activateProfile(AbstractProfileService.java:306) at org.jboss.system.server.profileservice.ProfileServiceBootstrap.start(ProfileServiceBootstrap.java:271) at org.jboss.bootstrap.AbstractServerImpl.start(AbstractServerImpl.java:461) at org.jboss.Main.boot(Main.java:221) at org.jboss.Main$1.run(Main.java:556) at java.lang.Thread.run(Thread.java:619) Caused by: java.lang.ClassCastException: org.apache.xerces.jaxp.DocumentBuilderFactoryImpl cannot be cast to javax.xml.parsers.DocumentBuilderFactory at javax.xml.parsers.DocumentBuilderFactory.newInstance(Unknown Source) at org.springframework.beans.factory.xml.DefaultDocumentLoader.createDocumentBuilderFactory(DefaultDocumentLoader.java:89) at org.springframework.beans.factory.xml.DefaultDocumentLoader.loadDocument(DefaultDocumentLoader.java:70) at org.springframework.beans.factory.xml.XmlBeanDefinitionReader.doLoadBeanDefinitions(XmlBeanDefinitionReader.java:396) Does someone know what can I do to deploy this? Thanks

    Read the article

  • How to include an external jar in a GWT module?

    - by Sergio del Amo
    I would like to use the org.apache.commons.validator.GenericValidator class in a view class of my GWT web app. I have read that I have to implicitely tell that I intend to use this external library. I thought adding the next line into my App.gwt.xml would work. <inherits name='org.apache.commons.validator.GenericValidator'/> I get the next error: Loading inherited module 'org.apache.commons.validator.GenericValidator' [ERROR] Unable to find 'org/apache/commons/validator/GenericValidator.gwt.xml' on your classpath; could be a typo, or maybe you forgot to include a classpath entry for source? [ERROR] Line 13: Unexpected exception while processing element 'inherits' com.google.gwt.core.ext.UnableToCompleteException: (see previous log entries) at com.google.gwt.dev.cfg.ModuleDefLoader.nestedLoad(ModuleDefLoader.java:239) at com.google.gwt.dev.cfg.ModuleDefSchema$BodySchema.__inherits_begin(ModuleDefSchema.java:354) at sun.reflect.GeneratedMethodAccessor1.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:25) at java.lang.reflect.Method.invoke(Method.java:597) at com.google.gwt.dev.util.xml.HandlerMethod.invokeBegin(HandlerMethod.java:223) at com.google.gwt.dev.util.xml.ReflectiveParser$Impl.startElement(ReflectiveParser.java:270) at com.sun.org.apache.xerces.internal.parsers.AbstractSAXParser.startElement(AbstractSAXParser.java:501) at com.sun.org.apache.xerces.internal.parsers.AbstractXMLDocumentParser.emptyElement(AbstractXMLDocumentParser.java:179) at com.sun.org.apache.xerces.internal.impl.XMLDocumentFragmentScannerImpl.scanStartElement(XMLDocumentFragmentScannerImpl.java:1339) at com.sun.org.apache.xerces.internal.impl.XMLDocumentFragmentScannerImpl$FragmentContentDriver.next(XMLDocumentFragmentScannerImpl.java:2747) at com.sun.org.apache.xerces.internal.impl.XMLDocumentScannerImpl.next(XMLDocumentScannerImpl.java:648) at com.sun.org.apache.xerces.internal.impl.XMLDocumentFragmentScannerImpl.scanDocument(XMLDocumentFragmentScannerImpl.java:510) at com.sun.org.apache.xerces.internal.parsers.XML11Configuration.parse(XML11Configuration.java:807) at com.sun.org.apache.xerces.internal.parsers.XML11Configuration.parse(XML11Configuration.java:737) at com.sun.org.apache.xerces.internal.parsers.XMLParser.parse(XMLParser.java:107) at com.sun.org.apache.xerces.internal.parsers.AbstractSAXParser.parse(AbstractSAXParser.java:1205) at com.sun.org.apache.xerces.internal.jaxp.SAXParserImpl$JAXPSAXParser.parse(SAXParserImpl.java:522) at com.google.gwt.dev.util.xml.ReflectiveParser$Impl.parse(ReflectiveParser.java:327) at com.google.gwt.dev.util.xml.ReflectiveParser$Impl.access$100(ReflectiveParser.java:48) at com.google.gwt.dev.util.xml.ReflectiveParser.parse(ReflectiveParser.java:398) at com.google.gwt.dev.cfg.ModuleDefLoader.nestedLoad(ModuleDefLoader.java:257) at com.google.gwt.dev.cfg.ModuleDefLoader$1.load(ModuleDefLoader.java:169) at com.google.gwt.dev.cfg.ModuleDefLoader.doLoadModule(ModuleDefLoader.java:283) at com.google.gwt.dev.cfg.ModuleDefLoader.loadFromClassPath(ModuleDefLoader.java:141) at com.google.gwt.dev.Compiler.run(Compiler.java:184) at com.google.gwt.dev.Compiler$1.run(Compiler.java:152) at com.google.gwt.dev.CompileTaskRunner.doRun(CompileTaskRunner.java:87) at com.google.gwt.dev.CompileTaskRunner.runWithAppropriateLogger(CompileTaskRunner.java:81) at com.google.gwt.dev.Compiler.main(Compiler.java:159) [ERROR] Failure while parsing XML com.google.gwt.core.ext.UnableToCompleteException: (see previous log entries) at com.google.gwt.dev.util.xml.DefaultSchema.onHandlerException(DefaultSchema.java:56) at com.google.gwt.dev.util.xml.Schema.onHandlerException(Schema.java:66) at com.google.gwt.dev.util.xml.Schema.onHandlerException(Schema.java:66) at com.google.gwt.dev.util.xml.HandlerMethod.invokeBegin(HandlerMethod.java:233) at com.google.gwt.dev.util.xml.ReflectiveParser$Impl.startElement(ReflectiveParser.java:270) at com.sun.org.apache.xerces.internal.parsers.AbstractSAXParser.startElement(AbstractSAXParser.java:501) at com.sun.org.apache.xerces.internal.parsers.AbstractXMLDocumentParser.emptyElement(AbstractXMLDocumentParser.java:179) at com.sun.org.apache.xerces.internal.impl.XMLDocumentFragmentScannerImpl.scanStartElement(XMLDocumentFragmentScannerImpl.java:1339) at com.sun.org.apache.xerces.internal.impl.XMLDocumentFragmentScannerImpl$FragmentContentDriver.next(XMLDocumentFragmentScannerImpl.java:2747) at com.sun.org.apache.xerces.internal.impl.XMLDocumentScannerImpl.next(XMLDocumentScannerImpl.java:648) at com.sun.org.apache.xerces.internal.impl.XMLDocumentFragmentScannerImpl.scanDocument(XMLDocumentFragmentScannerImpl.java:510) at com.sun.org.apache.xerces.internal.parsers.XML11Configuration.parse(XML11Configuration.java:807) at com.sun.org.apache.xerces.internal.parsers.XML11Configuration.parse(XML11Configuration.java:737) at com.sun.org.apache.xerces.internal.parsers.XMLParser.parse(XMLParser.java:107) at com.sun.org.apache.xerces.internal.parsers.AbstractSAXParser.parse(AbstractSAXParser.java:1205) at com.sun.org.apache.xerces.internal.jaxp.SAXParserImpl$JAXPSAXParser.parse(SAXParserImpl.java:522) at com.google.gwt.dev.util.xml.ReflectiveParser$Impl.parse(ReflectiveParser.java:327) at com.google.gwt.dev.util.xml.ReflectiveParser$Impl.access$100(ReflectiveParser.java:48) at com.google.gwt.dev.util.xml.ReflectiveParser.parse(ReflectiveParser.java:398) at com.google.gwt.dev.cfg.ModuleDefLoader.nestedLoad(ModuleDefLoader.java:257) at com.google.gwt.dev.cfg.ModuleDefLoader$1.load(ModuleDefLoader.java:169) at com.google.gwt.dev.cfg.ModuleDefLoader.doLoadModule(ModuleDefLoader.java:283) at com.google.gwt.dev.cfg.ModuleDefLoader.loadFromClassPath(ModuleDefLoader.java:141) at com.google.gwt.dev.Compiler.run(Compiler.java:184) at com.google.gwt.dev.Compiler$1.run(Compiler.java:152) at com.google.gwt.dev.CompileTaskRunner.doRun(CompileTaskRunner.java:87) at com.google.gwt.dev.CompileTaskRunner.runWithAppropriateLogger(CompileTaskRunner.java:81) at com.google.gwt.dev.Compiler.main(Compiler.java:159) [ERROR] Unexpected error while processing XML com.google.gwt.core.ext.UnableToCompleteException: (see previous log entries) at com.google.gwt.dev.util.xml.ReflectiveParser$Impl.parse(ReflectiveParser.java:351) at com.google.gwt.dev.util.xml.ReflectiveParser$Impl.access$100(ReflectiveParser.java:48) at com.google.gwt.dev.util.xml.ReflectiveParser.parse(ReflectiveParser.java:398) at com.google.gwt.dev.cfg.ModuleDefLoader.nestedLoad(ModuleDefLoader.java:257) at com.google.gwt.dev.cfg.ModuleDefLoader$1.load(ModuleDefLoader.java:169) at com.google.gwt.dev.cfg.ModuleDefLoader.doLoadModule(ModuleDefLoader.java:283) at com.google.gwt.dev.cfg.ModuleDefLoader.loadFromClassPath(ModuleDefLoader.java:141) at com.google.gwt.dev.Compiler.run(Compiler.java:184) at com.google.gwt.dev.Compiler$1.run(Compiler.java:152) at com.google.gwt.dev.CompileTaskRunner.doRun(CompileTaskRunner.java:87) at com.google.gwt.dev.CompileTaskRunner.runWithAppropriateLogger(CompileTaskRunner.java:81) at com.google.gwt.dev.Compiler.main(Compiler.java:159) I have commons.validator-1.3.1.jar in war/WEB-INF/lib I am using eclipse with Google Plugin. Anyone knows how it works?

    Read the article

  • Where do I find scripts generated by SharePoint MCMS Migration Profiles

    - by HipCzeck
    I am attempting to migrate data from an Microsoft Content Management Server (MCMS) 2002 instance into a new Microsoft Office Sharepoint Server (MOSS) 2007 installation using the Manage Microsoft Content Management Server Migration Profiles tool in the Operations space of MOSS Central Administration. When analyzing the profile, I receive 4 warnings, all of which may be safely ignored, but when I actually execute the migration profile, I get the same warnings and an additional error with a description of: Line 6: Incorrect syntax near ';'. I have seen this error numerous times when mucking about in SQL Server and recognize it as a Transact SQL error message, but can't find the actual SQL statement that is being executed so that I may determine the source of the error. EDIT: After enabling verbose logging on the MCMS 2002 Migration category, and poring through the Unified Logging Service (ULS) logs, I received a more complete stack trace at the point of the error, and a couple more anomalies listed below. Anomalies: The following is an abbreviated listing from the ULS logs around the time of the pre-migration analysis. 01 MCMS 2002 Migration Verbose Start ConnectionCheck 02 MCMS 2002 Migration Verbose End ConnectionCheck 03 MCMS 2002 Migration Verbose Start DatabaseCheck 04 MCMS 2002 Migration High Extra table SiteDeployLock will not be migrated 05 MCMS 2002 Migration High Analysis: Extra index PK__SiteDeployLock__05D8E0BE 06 MCMS 2002 Migration Verbose End DatabaseCheck 07 MCMS 2002 Migration Medium Pre-migration analysis: RootCheckTask is skipped because database check is blocked. 08 MCMS 2002 Migration Medium Pre-migration analysis: RightsGroupNameCheckTask is skipped because database check is blocked. 09 MCMS 2002 Migration Medium Pre-migration analysis: InvalidNameCheckTask is skipped because database check is blocked. 10 MCMS 2002 Migration Medium Pre-migration analysis: LeafNameCheckTask is skipped because database check is blocked. 11 MCMS 2002 Migration Medium Pre-migration analysis: LeafLengthCheckTask is skipped because database check is blocked. 12 MCMS 2002 Migration Medium Pre-migration analysis: TemplateNameCheckTask is skipped because database check is blocked. 13 MCMS 2002 Migration Medium Pre-migration analysis: TemplateCollisionCheckTask is skipped because database check is blocked. 14 MCMS 2002 Migration Medium Pre-migration analysis: PlaceholderCheckTask is skipped because database check is blocked. 15 MCMS 2002 Migration Medium Pre-migration analysis: CheckedOutItemsCheckTask is skipped because database check is blocked. 16 MCMS 2002 Migration Medium Pre-migration analysis: SubmittedItemsCheckTask is skipped because database check is blocked. 17 MCMS 2002 Migration Medium Pre-migration analysis: DeletedItemsCheckTask is skipped because database check is blocked. 18 MCMS 2002 Migration Medium Pre-migration analysis: UserCheckTask is skipped because database check is blocked. 19 MCMS 2002 Migration Medium Pre-migration analysis: FileSizeCheckTask is skipped because database check is blocked. 20 MCMS 2002 Migration Medium Pre-migration analysis: HostHeaderMapCheckTask is skipped because database check is blocked. 21 MCMS 2002 Migration Verbose Start Server check 22 MCMS 2002 Migration Verbose End Server check 23 MCMS 2002 Migration Verbose Start Server emptyness check 24 MCMS 2002 Migration Verbose End Server emptyness check 25 MCMS 2002 Migration Medium PreMigrationAnalyzer: Dry run starts 26 MCMS 2002 Migration Verbose CleanLockProcedure: start. 27 MCMS 2002 Migration High CleanLockProcedure: connection system lock is null 28 MCMS 2002 Migration Verbose Finished all tasks 29 MCMS 2002 Migration High PreMigrationAnalyzer ends with True 30 MCMS 2002 Migration Verbose Migration profile status is changed to AnalysisPassed Specifically, the two High level alerts on lines 4 and 5 are reflected in the migration report as warnings when running Pre-migration Analysis or running the migration profile. In addition, two other warnings appear in the migration report indicating two tables containing data (LayoutProperty and NodeLayout) that should be empty. According to the documentation, warnings are not sufficient cause to stop migration from occurring. Other anomalies are on lines 7-20 indicating a series of tests that are skipped because database check is blocked. The ULS doesn't give any additional warnings to indicate that the database check was blocked or exited in exceptional circumstances. After switching the profile from pre-migration analysis to exporting, there is one medium level warning that LastChangeTime is not set or incorrect. (null). As with all the skipped test names and SQL table names from the warnings, the major search engines are unable (with the exception of LayoutProperty) to find any reference to these objects or tests. Finally, the section of the log indicating the actual live migration attempt is appended below: 01 MCMS 2002 Migration Medium LastChangeTime is not set or incorrect. (null) 02 MCMS 2002 Migration Verbose Set export lock 03 MCMS 2002 Migration Verbose CleanLockProcedure: start. 04 MCMS 2002 Migration Verbose CleanLockProcedure: end. 05 MCMS 2002 Migration Verbose Prepare for export 06 MCMS 2002 Migration Verbose Open connection... 07 MCMS 2002 Migration Verbose Create temporary stored procedures 08 MCMS 2002 Migration Verbose Create temporary tables... 09 MCMS 2002 Migration Verbose Initialize temporary tables... 10 MCMS 2002 Migration Verbose InitializeTemporaryTables: start 11 MCMS 2002 Migration Verbose Initialize export table... 12 MCMS 2002 Migration Verbose InitializeExportTable: start 13 MCMS 2002 Migration Verbose CleanLockProcedure: start. 14 MCMS 2002 Migration Verbose CleanLockProcedure: end. 15 MCMS 2002 Migration High Migration throws exception: Line 6: Incorrect syntax near ';'.. Stacktrace: at System.Data.SqlClient.SqlConnection.OnError(SqlException exception, Boolean breakConnection) at System.Data.SqlClient.TdsParser.ThrowExceptionAndWarning(TdsParserStateObject stateObj) at System.Data.SqlClient.TdsParser.Run(RunBehavior runBehavior, SqlCommand cmdHandler, SqlDataReader dataStream, BulkCopySimpleResultSet bulkCopyHandler, TdsParserStateObject stateObj) at System.Data.SqlClient.SqlCommand.RunExecuteNonQueryTds(String methodName, Boolean async) at System.Data.SqlClient.SqlCommand.InternalExecuteNonQuery(DbAsyncResult result, String methodName, Boolean sendToPipe) at System.Data.SqlClient.SqlCommand.ExecuteNonQuery() at Microsoft.SharePoint.Publishing.Internal.Administration... 16 MCMS 2002 Migration High ....MigrationBatchCommand.ExecuteImmediate(String command) at Microsoft.SharePoint.Publishing.Internal.Administration.MigrationBatchCommand.ExecuteWaitingCommands() at Microsoft.SharePoint.Publishing.Internal.Administration.MigrationDBSerializer.SerializeSelectedExportObject(StringCollection objectAttribs) at Microsoft.SharePoint.Publishing.Internal.Administration.MigrationDataAccess.InitializeExportTable(ScopeType scopeType) at Microsoft.SharePoint.Publishing.Internal.Administration.MigrationDataAccess.InitializeTemporaryTables(DateTime lastChangeTime) at Microsoft.SharePoint.Publishing.Internal.Administration.MigrationDataAccess.InitializeDatabase(DateTime lastChangeTime, Boolean isAnalysis, SqlConnection connection) at Microsoft.SharePoint.Publishing.Internal.Admin... 17 MCMS 2002 Migration High ...stration.MigrationDataAccess.InitializeDatabase(DateTime lastChangeTime, Boolean isAnalysis) at Microsoft.SharePoint.Publishing.Administration.ContentMigration.Export(MigrationDataAccess dataAccess) at Microsoft.SharePoint.Publishing.Administration.ContentMigration.MigrateInternal(). 18 MCMS 2002 Migration Verbose MigrationProfile: GetInstance. Start. 19 MCMS 2002 Migration Verbose MigrationProfile: GetInstance. End. 20 MCMS 2002 Migration Verbose Migration profile status is changed to Failed The stack trace of the failed parsing of the SQL command appear on lines 15-17. A cleaner version of the stack trace is appended below. Full Stack Trace: Migration throws exception: Line 6: Incorrect syntax near ';'.. at System.Data.SqlClient.SqlConnection.OnError(SqlException exception, Boolean breakConnection) at System.Data.SqlClient.TdsParser.ThrowExceptionAndWarning( TdsParserStateObject stateObj) at System.Data.SqlClient.TdsParser.Run(RunBehavior runBehavior, SqlCommand cmdHandler, SqlDataReader dataStream, BulkCopySimpleResultSet bulkCopyHandler, TdsParserStateObject stateObj) at System.Data.SqlClient.SqlCommand.RunExecuteNonQueryTds(String methodName, Boolean async) at System.Data.SqlClient.SqlCommand.InternalExecuteNonQuery(DbAsyncResult result, String methodName, Boolean sendToPipe) at System.Data.SqlClient.SqlCommand.ExecuteNonQuery() at Microsoft.SharePoint.Publishing.Internal.Administration.MigrationBatchCommand .ExecuteImmediate(String command) at Microsoft.SharePoint.Publishing.Internal.Administration.MigrationBatchCommand .ExecuteWaitingCommands() at Microsoft.SharePoint.Publishing.Internal.Administration.MigrationDBSerializer .SerializeSelectedExportObject(StringCollection objectAttribs) at Microsoft.SharePoint.Publishing.Internal.Administration.MigrationDataAccess .InitializeExportTable(ScopeType scopeType) at Microsoft.SharePoint.Publishing.Internal.Administration.MigrationDataAccess .InitializeTemporaryTables(DateTime lastChangeTime) at Microsoft.SharePoint.Publishing.Internal.Administration.MigrationDataAccess .InitializeDatabase(DateTime lastChangeTime, Boolean isAnalysis, SqlConnection connection) at Microsoft.SharePoint.Publishing.Internal.Administration.MigrationDataAccess .InitializeDatabase(DateTime lastChangeTime, Boolean isAnalysis) at Microsoft.SharePoint.Publishing.Administration.ContentMigration.Export (MigrationDataAccess dataAccess) at Microsoft.SharePoint.Publishing.Administration.ContentMigration .MigrateInternal(). None of this log information indicates the SQL command that is failing a parser check. I've checked the SQL servers hosting the source and destination databases for a trace of the query, but neither seems to have triggered the parse failure condition. That appears to have happened on the SharePoint server. Are there any other locations I should investigate that might tell me where to find the source of the error?

    Read the article

  • General type conversion without risking Exceptions

    - by Mongus Pong
    I am working on a control that can take a number of different datatypes (anything that implements IComparable). I need to be able to compare these with another variable passed in. If the main datatype is a DateTime, and I am passed a String, I need to attempt to convert the String to a DateTime to perform a Date comparison. if the String cannot be converted to a DateTime then do a String comparison. So I need a general way to attempt to convert from any type to any type. Easy enough, .Net provides us with the TypeConverter class. Now, the best I can work out to do to determine if the String can be converted to a DateTime is to use exceptions. If the ConvertFrom raises an exception, I know I cant do the conversion and have to do the string comparison. The following is the best I got : string theString = "99/12/2009"; DateTime theDate = new DateTime ( 2009, 11, 1 ); IComparable obj1 = theString as IComparable; IComparable obj2 = theDate as IComparable; try { TypeConverter converter = TypeDescriptor.GetConverter ( obj2.GetType () ); if ( converter.CanConvertFrom ( obj1.GetType () ) ) { Console.WriteLine ( obj2.CompareTo ( converter.ConvertFrom ( obj1 ) ) ); Console.WriteLine ( "Date comparison" ); } } catch ( FormatException ) { Console.WriteLine ( obj1.ToString ().CompareTo ( obj2.ToString () ) ); Console.WriteLine ( "String comparison" ); } Part of our standards at work state that : Exceptions should only be raised when an Exception situation - ie. an error is encountered. But this is not an exceptional situation. I need another way around it. Most variable types have a TryParse method which returns a boolean to allow you to determine if the conversion has succeeded or not. But there is no TryConvert method available to TypeConverter. CanConvertFrom only dermines if it is possible to convert between these types and doesnt consider the actual data to be converted. The IsValid method is also useless. Any ideas? EDIT I cannot use AS and IS. I do not know either data types at compile time. So I dont know what to As and Is to!!! EDIT Ok nailed the bastard. Its not as tidy as Marc Gravells, but it works (I hope). Thanks for the inpiration Marc. Will work on tidying it up when I get the time, but I've got a bit stack of bugfixes that I have to get on with. public static class CleanConverter { /// <summary> /// Stores the cache of all types that can be converted to all types. /// </summary> private static Dictionary<Type, Dictionary<Type, ConversionCache>> _Types = new Dictionary<Type, Dictionary<Type, ConversionCache>> (); /// <summary> /// Try parsing. /// </summary> /// <param name="s"></param> /// <param name="value"></param> /// <returns></returns> public static bool TryParse ( IComparable s, ref IComparable value ) { // First get the cached conversion method. Dictionary<Type, ConversionCache> type1Cache = null; ConversionCache type2Cache = null; if ( !_Types.ContainsKey ( s.GetType () ) ) { type1Cache = new Dictionary<Type, ConversionCache> (); _Types.Add ( s.GetType (), type1Cache ); } else { type1Cache = _Types[s.GetType ()]; } if ( !type1Cache.ContainsKey ( value.GetType () ) ) { // We havent converted this type before, so create a new conversion type2Cache = new ConversionCache ( s.GetType (), value.GetType () ); // Add to the cache type1Cache.Add ( value.GetType (), type2Cache ); } else { type2Cache = type1Cache[value.GetType ()]; } // Attempt the parse return type2Cache.TryParse ( s, ref value ); } /// <summary> /// Stores the method to convert from Type1 to Type2 /// </summary> internal class ConversionCache { internal bool TryParse ( IComparable s, ref IComparable value ) { if ( this._Method != null ) { // Invoke the cached TryParse method. object[] parameters = new object[] { s, value }; bool result = (bool)this._Method.Invoke ( null, parameters); if ( result ) value = parameters[1] as IComparable; return result; } else return false; } private MethodInfo _Method; internal ConversionCache ( Type type1, Type type2 ) { // Use reflection to get the TryParse method from it. this._Method = type2.GetMethod ( "TryParse", new Type[] { type1, type2.MakeByRefType () } ); } } }

    Read the article

  • Configuring a WCF Client to Use UserName Credentials On the Request and Check Certificate Credential

    - by AlEl
    I'm trying to use WCF to consume a web service provided by a third-party's Oracle Application Server. I pass a username and password in a UsernameToken as part of the request and as part of the response the web service returns a standard security tag in the header which includes a digest and signature. With my current setup, I successfully send a request to the server and the web service sends the expected response data back. However, when parsing the response WCF throws a MessageSecurityException, with an InnerException.Message of "Supporting token signatures not expected." My guess is that WCF wants me to configure it to handle the signature and verify it. I have a certificate from the third party that hosts the web service that I should be able to use to verify the signature, although I'm not sure if I'll need it. Here's a sample header from a response that makes WCF throw the exception: <?xml version="1.0" encoding="UTF-8"?> <soap:Envelope xmlns:soap="http://schemas.xmlsoap.org/soap/envelope/"> <soap:Header> <wsse:Security soap:mustUnderstand="1" xmlns:wsse="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-secext-1.0.xsd" xmlns="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-secext-1.0.xsd"> <dsig:Signature xmlns="http://www.w3.org/2000/09/xmldsig#" xmlns:dsig="http://www.w3.org/2000/09/xmldsig#"> <dsig:SignedInfo> <dsig:CanonicalizationMethod Algorithm="http://www.w3.org/2001/10/xml-exc-c14n#"/> <dsig:SignatureMethod Algorithm="http://www.w3.org/2000/09/xmldsig#rsa-sha1"/> <dsig:Reference URI="#_51IUwNWRVvPOcz12pZHLNQ22"> <dsig:Transforms> <dsig:Transform Algorithm="http://www.w3.org/2001/10/xml-exc-c14n#"/> </dsig:Transforms> <dsig:DigestMethod Algorithm="http://www.w3.org/2000/09/xmldsig#sha1"/> <dsig:DigestValue> [DigestValue here] </dsig:DigestValue> </dsig:Reference> <dsig:Reference URI="#_dI5j0EqxrVsj0e62J6vd6w22"> <dsig:Transforms> <dsig:Transform Algorithm="http://www.w3.org/2001/10/xml-exc-c14n#"/> </dsig:Transforms> <dsig:DigestMethod Algorithm="http://www.w3.org/2000/09/xmldsig#sha1"/> <dsig:DigestValue> [DigestValue here] </dsig:DigestValue> </dsig:Reference> </dsig:SignedInfo> <dsig:SignatureValue> [Signature Value Here] </dsig:SignatureValue> <dsig:KeyInfo> <wsse:SecurityTokenReference xmlns="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-secext-1.0.xsd"> <wsse:Reference URI="#BST-9nKWbrE4LRv6maqstrGuUQ22" ValueType="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-x509-token-profile-1.0#X509v3"/> </wsse:SecurityTokenReference> </dsig:KeyInfo> </dsig:Signature> <wsse:BinarySecurityToken ValueType="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-x509-token-profile-1.0#X509v3" EncodingType="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-soap-message-security-1.0#Base64Binary" wsu:Id="BST-9nKWbrE4LRv6maqstrGuUQ22" xmlns:wsu="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-utility-1.0.xsd"> [Security Token Here] </wsse:BinarySecurityToken> <wsu:Timestamp wsu:Id="_dI5j0EqxrVsj0e62J6vd6w22" xmlns:wsu="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-utility-1.0.xsd" xmlns="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-utility-1.0.xsd"> <wsu:Created>2010-05-26T18:46:30Z</wsu:Created> </wsu:Timestamp> </wsse:Security> </soap:Header> <soap:Body wsu:Id="_51IUwNWRVvPOcz12pZHLNQ22" xmlns:wsu="http://docs.oasis-open.org/wss/2004/01/oasis-200401-wss-wssecurity-utility-1.0.xsd"> [Body content here] </soap:Body> </soap:Envelope> My binding configuration looks like: <basicHttpBinding> <binding name="myBinding" closeTimeout="00:01:00" openTimeout="00:01:00" receiveTimeout="00:10:00" sendTimeout="00:01:00" allowCookies="false" bypassProxyOnLocal="false" hostNameComparisonMode="StrongWildcard" maxBufferSize="65536" maxBufferPoolSize="524288" maxReceivedMessageSize="65536" messageEncoding="Text" textEncoding="utf-8" transferMode="Buffered" useDefaultWebProxy="true"> <readerQuotas maxDepth="32" maxStringContentLength="8192" maxArrayLength="16384" maxBytesPerRead="4096" maxNameTableCharCount="16384" /> <security mode="TransportWithMessageCredential"> <transport clientCredentialType="None" proxyCredentialType="None" realm="" /> <message clientCredentialType="UserName" algorithmSuite="Default" /> </security> </binding> </basicHttpBinding> I think that basically what I have to do is configure WCF to use UserName client credentials in the request and Certificate client credentials in the response. I don't know how to do this though. I'm new at WCF, so I'm sorry if this is a bit of a dumb question. I've been trying to Google solutions, but there seem to be so many different ways to configure WCF that I'm getting overwhelmed. Thanks in advance!

    Read the article

  • OpenSwan IPsec connection drops after 30 seconds

    - by drcore
    I'm trying to connection from my Linux Mint 16 box to a CloudStack server. Building up the connection works (pings work across the tunnel). However 30 seconds later the IPsec tunnel gets terminated out of the blue. What could cause this consistent behaviour and how to fix it? The tunnel is setup using OpenSwan (U2.6.38/K(no kernel code presently loaded)) with the L2TP IPsec VPN manager from Werner Jaeger 1.0.9. The client is behind a NAT'ed router and the server is on public IP (CloudStack 4.2) Running ipsec verify complains about IPsec support in kernel. Not sure if this is a problem as the connection is being build up: Checking your system to see if IPsec got installed and started correctly: Version check and ipsec on-path [OK] Linux Openswan U2.6.38/K(no kernel code presently loaded) Checking for IPsec support in kernel [FAILED] SAref kernel support [N/A] Checking that pluto is running [FAILED] whack: Pluto is not running (no "/var/run/pluto/pluto.ctl") Checking for 'ip' command [OK] Checking /bin/sh is not /bin/dash [WARNING] Checking for 'iptables' command [OK] Opportunistic Encryption Support [DISABLED] Tunnel config: version 2.0 # conforms to second version of ipsec.conf specification config setup # plutodebug="parsing emitting control private" plutodebug=none strictcrlpolicy=no nat_traversal=yes interfaces=%defaultroute oe=off # which IPsec stack to use. netkey,klips,mast,auto or none protostack=netkey conn %default keyingtries=3 pfs=no rekey=yes type=transport left=%defaultroute leftprotoport=17/1701 rightprotoport=17/1701 conn Tunnel1 authby=secret right=37.48.75.97 rightid="" auto=add Log file of VPN connection build up: aug. 23 17:12:54.708 ipsec_setup: Starting Openswan IPsec U2.6.38/K3.11.0-12-generic... aug. 23 17:12:55.155 ipsec_setup: multiple ip addresses, using 192.168.178.32 on eth0 aug. 23 17:12:55.165 ipsec__plutorun: Starting Pluto subsystem... aug. 23 17:12:55.174 ipsec__plutorun: adjusting ipsec.d to /etc/ipsec.d aug. 23 17:12:55.177 recvref[30]: Protocol not available aug. 23 17:12:55.177 xl2tpd[14339]: This binary does not support kernel L2TP. aug. 23 17:12:55.178 Starting xl2tpd: xl2tpd. aug. 23 17:12:55.178 xl2tpd[14345]: xl2tpd version xl2tpd-1.3.1 started on desktopmint PID:14345 aug. 23 17:12:55.178 xl2tpd[14345]: Written by Mark Spencer, Copyright (C) 1998, Adtran, Inc. aug. 23 17:12:55.179 xl2tpd[14345]: Forked by Scott Balmos and David Stipp, (C) 2001 aug. 23 17:12:55.179 xl2tpd[14345]: Inherited by Jeff McAdams, (C) 2002 aug. 23 17:12:55.179 xl2tpd[14345]: Forked again by Xelerance (www.xelerance.com) (C) 2006 aug. 23 17:12:55.180 xl2tpd[14345]: Listening on IP address 0.0.0.0, port 1701 aug. 23 17:12:55.214 ipsec__plutorun: 002 added connection description "Tunnel1" aug. 23 17:13:15.532 104 "Tunnel1" #1: STATE_MAIN_I1: initiate aug. 23 17:13:15.532 003 "Tunnel1" #1: ignoring unknown Vendor ID payload [4f45755c645c6a795c5c6170] aug. 23 17:13:15.532 003 "Tunnel1" #1: received Vendor ID payload [Dead Peer Detection] aug. 23 17:13:15.533 003 "Tunnel1" #1: received Vendor ID payload [RFC 3947] method set to=115 aug. 23 17:13:15.533 106 "Tunnel1" #1: STATE_MAIN_I2: sent MI2, expecting MR2 aug. 23 17:13:15.534 003 "Tunnel1" #1: NAT-Traversal: Result using draft-ietf-ipsec-nat-t-ike (MacOS X): i am NATed aug. 23 17:13:15.534 108 "Tunnel1" #1: STATE_MAIN_I3: sent MI3, expecting MR3 aug. 23 17:13:15.534 010 "Tunnel1" #1: STATE_MAIN_I3: retransmission; will wait 20s for response aug. 23 17:13:15.545 003 "Tunnel1" #1: received Vendor ID payload [CAN-IKEv2] aug. 23 17:13:15.547 004 "Tunnel1" #1: STATE_MAIN_I4: ISAKMP SA established {auth=OAKLEY_PRESHARED_KEY cipher=aes_128 prf=oakley_sha group=modp2048} aug. 23 17:13:15.547 117 "Tunnel1" #2: STATE_QUICK_I1: initiate aug. 23 17:13:15.547 010 "Tunnel1" #2: STATE_QUICK_I1: retransmission; will wait 20s for response aug. 23 17:13:15.548 004 "Tunnel1" #2: STATE_QUICK_I2: sent QI2, IPsec SA established transport mode {ESP=>0x0ecef28b <0x3e1fbe3b xfrm=AES_128-HMAC_SHA1 NATOA=none NATD=none DPD=none} aug. 23 17:13:16.549 xl2tpd[14345]: Connecting to host <VPN gateway>, port 1701 aug. 23 17:13:18.576 xl2tpd[14345]: Connection established to <VPN gateway>, 1701. Local: 21163, Remote: 12074 (ref=0/0). aug. 23 17:13:18.576 xl2tpd[14345]: Calling on tunnel 21163 aug. 23 17:13:18.577 xl2tpd[14345]: check_control: Received out of order control packet on tunnel 12074 (got 0, expected 1) aug. 23 17:13:18.577 xl2tpd[14345]: handle_packet: bad control packet! aug. 23 17:13:18.577 xl2tpd[14345]: check_control: Received out of order control packet on tunnel 12074 (got 0, expected 1) aug. 23 17:13:18.577 xl2tpd[14345]: handle_packet: bad control packet! aug. 23 17:13:18.599 xl2tpd[14345]: Call established with <VPN gateway>, Local: 39035, Remote: 57266, Serial: 1 (ref=0/0) aug. 23 17:13:18.605 xl2tpd[14345]: start_pppd: I'm running: aug. 23 17:13:18.605 xl2tpd[14345]: "/usr/sbin/pppd" aug. 23 17:13:18.606 xl2tpd[14345]: "passive" aug. 23 17:13:18.606 xl2tpd[14345]: "nodetach" aug. 23 17:13:18.606 xl2tpd[14345]: ":" aug. 23 17:13:18.606 xl2tpd[14345]: "file" aug. 23 17:13:18.606 xl2tpd[14345]: "/etc/ppp/Tunnel1.options.xl2tpd" aug. 23 17:13:18.606 xl2tpd[14345]: "ipparam" aug. 23 17:13:18.607 xl2tpd[14345]: "<VPN gateway>" aug. 23 17:13:18.607 xl2tpd[14345]: "/dev/pts/4" aug. 23 17:13:18.607 pppd[14438]: Plugin passprompt.so loaded. aug. 23 17:13:18.607 pppd[14438]: pppd 2.4.5 started by root, uid 0 aug. 23 17:13:18.608 pppd[14438]: Using interface ppp0 aug. 23 17:13:18.608 pppd[14438]: Connect: ppp0 <--> /dev/pts/4 aug. 23 17:13:21.650 pppd[14438]: CHAP authentication succeeded: Access granted aug. 23 17:13:21.651 pppd[14438]: CHAP authentication succeeded aug. 23 17:13:21.692 pppd[14438]: local IP address 10.1.2.2 aug. 23 17:13:21.693 pppd[14438]: remote IP address 10.1.2.1 aug. 23 17:13:21.693 pppd[14438]: primary DNS address 10.1.2.1 aug. 23 17:13:21.694 pppd[14438]: secondary DNS address 10.1.2.1 aug. 23 17:13:46.528 Stopping xl2tpd: xl2tpd. aug. 23 17:13:46.528 xl2tpd[14345]: death_handler: Fatal signal 15 received aug. 23 17:13:46.529 pppd[14438]: Modem hangup aug. 23 17:13:46.529 pppd[14438]: Connect time 0.5 minutes. aug. 23 17:13:46.529 pppd[14438]: Sent 1866 bytes, received 1241 bytes. aug. 23 17:13:46.529 pppd[14438]: Connection terminated. aug. 23 17:13:46.562 ipsec_setup: Stopping Openswan IPsec... aug. 23 17:13:46.576 pppd[14438]: Exit.

    Read the article

  • Perl, LibXML and Schemas

    - by Xetius
    I have an example Perl script which I am trying to load and validate a file against a schema, them interrogate various nodes. #!/usr/bin/env perl use strict; use warnings; use XML::LibXML; my $filename = 'source.xml'; my $xml_schema = XML::LibXML::Schema->new(location=>'library.xsd'); my $parser = XML::LibXML->new (); my $doc = $parser->parse_file ($filename); eval { $xml_schema->validate ($doc); }; if ($@) { print "File failed validation: $@" if $@; } eval { print "Here\n"; foreach my $book ($doc->findnodes('/library/book')) { my $title = $book->findnodes('./title'); print $title->to_literal(), "\n"; } }; if ($@) { print "Problem parsing data : $@\n"; } Unfortunately, although it is validating the XML file fine, it is not finding any $book items and therefore not printing out anything. If I remove the schema from the XML file and the validation from the PL file then it works fine. I am using the default namespace. If I change it to not use the default namespace (xmlns:lib="http://libs.domain.com" and prefix all items in the XML file with lib and change the XPath expressions to include the namespace prefix (/lib:library/lib:book) then it again works file. Why? and what am I missing? XML: <?xml version="1.0" encoding="utf-8"?> <library xmlns="http://lib.domain.com" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xsi:schemaLocation="http://lib.domain.com .\library.xsd"> <book> <title>Perl Best Practices</title> <author>Damian Conway</author> <isbn>0596001738</isbn> <pages>542</pages> <image src="http://www.oreilly.com/catalog/covers/perlbp.s.gif" width="145" height="190"/> </book> <book> <title>Perl Cookbook, Second Edition</title> <author>Tom Christiansen</author> <author>Nathan Torkington</author> <isbn>0596003137</isbn> <pages>964</pages> <image src="http://www.oreilly.com/catalog/covers/perlckbk2.s.gif" width="145" height="190"/> </book> <book> <title>Guitar for Dummies</title> <author>Mark Phillips</author> <author>John Chappell</author> <isbn>076455106X</isbn> <pages>392</pages> <image src="http://media.wiley.com/product_data/coverImage/6X/07645510/076455106X.jpg" width="100" height="125"/> </book> </library> XSD: <?xml version="1.0" encoding="utf-8"?> <xs:schema xmlns="http://lib.domain.com" xmlns:xs="http://www.w3.org/2001/XMLSchema" elementFormDefault="qualified" targetNamespace="http://lib.domain.com"> <xs:attributeGroup name="imagegroup"> <xs:attribute name="src" type="xs:string"/> <xs:attribute name="width" type="xs:integer"/> <xs:attribute name="height" type="xs:integer"/> </xs:attributeGroup> <xs:element name="library"> <xs:complexType> <xs:sequence> <xs:element maxOccurs="unbounded" name="book"> <xs:complexType> <xs:sequence> <xs:element name="title" type="xs:string"/> <xs:element maxOccurs="unbounded" name="author" type="xs:string"/> <xs:element name="isbn" type="xs:string"/> <xs:element name="pages" type="xs:integer"/> <xs:element name="image"> <xs:complexType> <xs:attributeGroup ref="imagegroup"/> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> </xs:sequence> </xs:complexType> </xs:element> </xs:schema>

    Read the article

  • Rails, gmail: howto get plain/text from body

    - by atmorell
    Hello, I am loading am email with IMAP and parsing it with mail. This works very well, however the mail.body.decoded field contains a lot of formatting. How do I dig out the plain/txt body of the email - ignore attachements, formatting etc. It works fine if I try with an email without html. source = imap.uid_fetch(uid, ['RFC822']).first.attr['RFC822'] mail = Mail.new(source) This body content looks like this: Mail::Body:0x7f36ed468270 @epilogue="", @boundary="_004_4C49171DCB8C4540844E69DD39FDD98Ffirm_", @encoding="7bit", @raw_source="--_004_4C49171DCB8C4540844E69DD39FDD98Ffirm_\r\nContent-Type: multipart/alternative;\r\n\tboundary=\"_000_4C49171DCB8C4540844E69DD39FDD98Ffirm_\"\r\n\r\n--_000_4C49171DCB8C4540844E69DD39FDD98Ffirm_\r\nContent-Type: text/plain; charset=\"iso-8859-1\"\r\nContent-Transfer-Encoding: quoted-printable\r\n\r\ndasdsasda\r\n\r\n\r\n\r\nMed venlig hilsen / Med V=E4nlig H=E4lsning / Best Regards\r\r\nAsbj=F8rn Toke Morell. .\r\n+45 7020 0160\r\n+45 2152 0015\r\n[cid:[email protected]]\r\nhttp://www..dk\r\n\r\n\r\n--_000_4C49171DCB8C4540844E69DD39FDD98Ffirm_\r\nContent-Type: text/html; charset=\"iso-8859-1\"\r\nContent-Transfer-Encoding: quoted-printable\r\n\r\n<html>headheadbody style3D"word-wrap: break-word; -webkit-nbsp-mode:=\r\n space; -webkit-line-break: after-white-space; ">dasdsasda<br><div apple-co=\r\nntent-edited=3D"true">\r\n<span class=3D"Apple-style-span" style=3D"border-collapse: separate; color:=\r\n rgb(0, 0, 0); font-family: Helvetica; font-size: medium; font-style: norma=\r\nl; font-variant: normal; font-weight: normal; letter-spacing: normal; line-=\r\nheight: normal; orphans: 2; text-align: auto; text-indent: 0px; text-transf=\r\norm: none; white-space: normal; widows: 2; word-spacing: 0px; -webkit-borde=\r\nr-horizontal-spacing: 0px; -webkit-border-vertical-spacing: 0px; -webkit-te=\r\nxt-decorations-in-effect: none; -webkit-text-size-adjust: auto; -webkit-tex=\r\nt-stroke-width: 0px; "><span class=3D"Apple-style-span" style=3D"font-famil=\r\ny: Calibri, sans-serif; font-size: 15px; "><span class=3D"Apple-style-span"=\r\n style=3D"border-collapse: separate; color: rgb(0, 0, 0); font-family: Helv=\r\netica; font-size: medium; font-style: normal; font-variant: normal; font-we=\r\night: normal; letter-spacing: normal; line-height: normal; orphans: 2; text=\r\n-indent: 0px; text-transform: none; white-space: normal; widows: 2; word-sp=\r\nacing: 0px; -webkit-border-horizontal-spacing: 0px; -webkit-border-vertical=\r\n-spacing: 0px; -webkit-text-decorations-in-effect: none; -webkit-text-size-=\r\nadjust: auto; -webkit-text-stroke-width: 0px; "><span class=3D"Apple-style-=\r\nspan" style=3D"font-family: Calibri, sans-serif; font-size: 15px; "><div st=\r\nyle=3D"margin-top: 0cm; margin-right: 0cm; margin-bottom: 0.0001pt; margin-=\r\nleft: 0cm; font-size: 11pt; font-family: Calibri, sans-serif; "><font class=\r\n=3D"Apple-style-span" color=3D"#000080" face=3D"'Times New Roman', serif" s=\r\nize=3D"3"><span class=3D"Apple-style-span" style=3D"font-size: 13px; "><br =\r\nclass=3D"Apple-interchange-newline"><br></span></font></div><div style=3D"m=\r\nargin-top: 0cm; margin-right: 0cm; margin-bottom: 0.0001pt; margin-left: 0c=\r\nm; font-size: 11pt; font-family: Calibri, sans-serif; "><font class=3D"Appl=\r\ne-style-span" color=3D"#000080" face=3D"'Times New Roman', serif" size=3D"3=\r\n"><span class=3D"Apple-style-span" style=3D"font-size: 13px; "><br></span><=\r\n/font></div><div style=3D"margin-top: 0cm; margin-right: 0cm; margin-bottom=\r\n: 0.0001pt; margin-left: 0cm; font-size: 11pt; font-family: Calibri, sans-s=\r\nerif; "><span style=3D"font-size: 10pt; font-family: 'Times New Roman', ser=\r\nif; color: navy; ">Med venlig hilsen / Med V=E4nlig H=E4lsning / Best Regar=\r\nds&nbsp;<br>firm<br>Asbj=F8rn Toke Morell... This is the ony relevant from information from the body: 'ndasdsasda\r\n\r\n\r\n\r\nMed venlig hilsen / Med V=E4nlig H=E4lsning / Best Regards\r\r\nAsbj=F8rn Toke Morell' Any ideas?

    Read the article

  • Need help in setting lighttpd on Ubuntu 9.10

    - by hap497
    Hi, I am trying to run lighttpd on Ubuntu 9.10. I get the conf file from the doc directory of lighttpd source. $ sudo ./lighttpd -f lighttpd.conf $ ps -ef | grep lighttpd root 2094 1 0 19:40 ? 00:00:00 ./lighttpd -f lighttpd.conf This is my lighttpd.conf: $ more lighttpd.conf # lighttpd configuration file # # use it as a base for lighttpd 1.0.0 and above # # $Id: lighttpd.conf,v 1.7 2004/11/03 22:26:05 weigon Exp $ ############ Options you really have to take care of #################### ## modules to load # at least mod_access and mod_accesslog should be loaded # all other module should only be loaded if really neccesary # - saves some time # - saves memory server.modules = ( # "mod_rewrite", # "mod_redirect", # "mod_alias", "mod_access", # "mod_trigger_b4_dl", # "mod_auth", # "mod_status", # "mod_setenv", # "mod_fastcgi", # "mod_proxy", # "mod_simple_vhost", # "mod_evhost", # "mod_userdir", # "mod_cgi", # "mod_compress", # "mod_ssi", # "mod_usertrack", # "mod_expire", # "mod_secdownload", # "mod_rrdtool", "mod_accesslog" ) ## A static document-root. For virtual hosting take a look at the ## mod_simple_vhost module. server.document-root = "/srv/www/htdocs/" ## where to send error-messages to server.errorlog = "/var/log/lighttpd/error.log" # files to check for if .../ is requested index-file.names = ( "index.php", "index.html", "index.htm", "default.htm" ) ## set the event-handler (read the performance section in the manual) # server.event-handler = "freebsd-kqueue" # needed on OS X # mimetype mapping mimetype.assign = ( ".pdf" => "application/pdf", ".sig" => "application/pgp-signature", ".spl" => "application/futuresplash", ".class" => "application/octet-stream", ".ps" => "application/postscript", ".torrent" => "application/x-bittorrent", ".dvi" => "application/x-dvi", ".gz" => "application/x-gzip", ".pac" => "application/x-ns-proxy-autoconfig", ".swf" => "application/x-shockwave-flash", ".tar.gz" => "application/x-tgz", ".tgz" => "application/x-tgz", ".tar" => "application/x-tar", ".zip" => "application/zip", ".mp3" => "audio/mpeg", ".m3u" => "audio/x-mpegurl", ".wma" => "audio/x-ms-wma", ".wax" => "audio/x-ms-wax", ".ogg" => "application/ogg", ".wav" => "audio/x-wav", ".gif" => "image/gif", ".jar" => "application/x-java-archive", ".jpg" => "image/jpeg", ".jpeg" => "image/jpeg", ".png" => "image/png", ".xbm" => "image/x-xbitmap", ".xpm" => "image/x-xpixmap", ".xwd" => "image/x-xwindowdump", ".css" => "text/css", ".html" => "text/html", ".htm" => "text/html", ".js" => "text/javascript", ".asc" => "text/plain", ".c" => "text/plain", ".cpp" => "text/plain", ".log" => "text/plain", ".conf" => "text/plain", ".text" => "text/plain", ".txt" => "text/plain", ".dtd" => "text/xml", ".xml" => "text/xml", ".mpeg" => "video/mpeg", ".mpg" => "video/mpeg", ".mov" => "video/quicktime", ".qt" => "video/quicktime", ".avi" => "video/x-msvideo", ".asf" => "video/x-ms-asf", ".asx" => "video/x-ms-asf", ".wmv" => "video/x-ms-wmv", ".bz2" => "application/x-bzip", ".tbz" => "application/x-bzip-compressed-tar", ".tar.bz2" => "application/x-bzip-compressed-tar", # default mime type "" => "application/octet-stream", ) # Use the "Content-Type" extended attribute to obtain mime type if possible #mimetype.use-xattr = "enable" ## send a different Server: header ## be nice and keep it at lighttpd # server.tag = "lighttpd" #### accesslog module accesslog.filename = "/var/log/lighttpd/access.log" ## deny access the file-extensions # # ~ is for backupfiles from vi, emacs, joe, ... # .inc is often used for code includes which should in general not be part # of the document-root url.access-deny = ( "~", ".inc" ) $HTTP["url"] =~ "\.pdf$" { server.range-requests = "disable" } ## # which extensions should not be handle via static-file transfer # # .php, .pl, .fcgi are most often handled by mod_fastcgi or mod_cgi static-file.exclude-extensions = ( ".php", ".pl", ".fcgi" ) ######### Options that are good to be but not neccesary to be changed ####### ## bind to port (default: 80) #server.port = 81 ## bind to localhost (default: all interfaces) #server.bind = "127.0.0.1" ## error-handler for status 404 #server.error-handler-404 = "/error-handler.html" #server.error-handler-404 = "/error-handler.php" ## to help the rc.scripts #server.pid-file = "/var/run/lighttpd.pid" ###### virtual hosts ## ## If you want name-based virtual hosting add the next three settings and load ## mod_simple_vhost ## ## document-root = ## virtual-server-root + virtual-server-default-host + virtual-server-docroot ## or ## virtual-server-root + http-host + virtual-server-docroot ## #simple-vhost.server-root = "/srv/www/vhosts/" #simple-vhost.default-host = "www.example.org" #simple-vhost.document-root = "/htdocs/" ## ## Format: <errorfile-prefix><status-code>.html ## -> ..../status-404.html for 'File not found' #server.errorfile-prefix = "/usr/share/lighttpd/errors/status-" #server.errorfile-prefix = "/srv/www/errors/status-" ## virtual directory listings #dir-listing.activate = "enable" ## select encoding for directory listings #dir-listing.encoding = "utf-8" ## enable debugging #debug.log-request-header = "enable" #debug.log-response-header = "enable" #debug.log-request-handling = "enable" #debug.log-file-not-found = "enable" ### only root can use these options # # chroot() to directory (default: no chroot() ) #server.chroot = "/" ## change uid to <uid> (default: don't care) #server.username = "wwwrun" ## change uid to <uid> (default: don't care) #server.groupname = "wwwrun" #### compress module #compress.cache-dir = "/var/cache/lighttpd/compress/" #compress.filetype = ("text/plain", "text/html") #### proxy module ## read proxy.txt for more info #proxy.server = ( ".php" => # ( "localhost" => # ( # "host" => "192.168.0.101", # "port" => 80 # ) # ) # ) #### fastcgi module ## read fastcgi.txt for more info ## for PHP don't forget to set cgi.fix_pathinfo = 1 in the php.ini #fastcgi.server = ( ".php" => # ( "localhost" => # ( # "socket" => "/var/run/lighttpd/php-fastcgi.s ocket", # "bin-path" => "/usr/local/bin/php-cgi" # ) # ) # ) #### CGI module #cgi.assign = ( ".pl" => "/usr/bin/perl", # ".cgi" => "/usr/bin/perl" ) # #### SSL engine #ssl.engine = "enable" #ssl.pemfile = "/etc/ssl/private/lighttpd.pem" #### status module #status.status-url = "/server-status" #status.config-url = "/server-config" #### auth module ## read authentication.txt for more info #auth.backend = "plain" #auth.backend.plain.userfile = "lighttpd.user" #auth.backend.plain.groupfile = "lighttpd.group" #auth.backend.ldap.hostname = "localhost" #auth.backend.ldap.base-dn = "dc=my-domain,dc=com" #auth.backend.ldap.filter = "(uid=$)" #auth.require = ( "/server-status" => # ( # "method" => "digest", # "realm" => "download archiv", # "require" => "user=jan" # ), # "/server-config" => # ( # "method" => "digest", # "realm" => "download archiv", # "require" => "valid-user" # ) # ) #### url handling modules (rewrite, redirect, access) #url.rewrite = ( "^/$" => "/server-status" ) #url.redirect = ( "^/wishlist/(.+)" => "http://www.123.org/$1" ) #### both rewrite/redirect support back reference to regex conditional using %n #$HTTP["host"] =~ "^www\.(.*)" { # url.redirect = ( "^/(.*)" => "http://%1/$1" ) #} # # define a pattern for the host url finding # %% => % sign # %0 => domain name + tld # %1 => tld # %2 => domain name without tld # %3 => subdomain 1 name # %4 => subdomain 2 name # #evhost.path-pattern = "/srv/www/vhosts/%3/htdocs/" #### expire module #expire.url = ( "/buggy/" => "access 2 hours", "/asdhas/" => "ac cess plus 1 seconds 2 minutes") #### ssi #ssi.extension = ( ".shtml" ) #### rrdtool #rrdtool.binary = "/usr/bin/rrdtool" #rrdtool.db-name = "/var/lib/lighttpd/lighttpd.rrd" #### setenv #setenv.add-request-header = ( "TRAV_ENV" => "mysql://user@host/db" ) #setenv.add-response-header = ( "X-Secret-Message" => "42" ) ## for mod_trigger_b4_dl # trigger-before-download.gdbm-filename = "/var/lib/lighttpd/trigger.db" # trigger-before-download.memcache-hosts = ( "127.0.0.1:11211" ) # trigger-before-download.trigger-url = "^/trigger/" # trigger-before-download.download-url = "^/download/" # trigger-before-download.deny-url = "http://127.0.0.1/index.html" # trigger-before-download.trigger-timeout = 10 #### variable usage: ## variable name without "." is auto prefixed by "var." and becomes "var.bar" #bar = 1 #var.mystring = "foo" ## integer add #bar += 1 ## string concat, with integer cast as string, result: "www.foo1.com" #server.name = "www." + mystring + var.bar + ".com" ## array merge #index-file.names = (foo + ".php") + index-file.names #index-file.names += (foo + ".php") #### include #include /etc/lighttpd/lighttpd-inc.conf ## same as above if you run: "lighttpd -f /etc/lighttpd/lighttpd.conf" #include "lighttpd-inc.conf" #### include_shell #include_shell "echo var.a=1" ## the above is same as: #var.a=1 When I go to browser and hit 'http://127.0.0.1', I get link not found. Any idea?

    Read the article

  • How to configure fastcgi to work with ligttpd in ubuntu

    - by michael
    I am able to run lighttpd on ubuntu 9.10. But when i tried to setup fastcgi with lighttpd by putting this in the ligttpd.conf file: #### fastcgi module fastcgi.server = ( "/fastcgi_scripts/" => (( "host" => "127.0.0.1", "port" => "9098", "check-local" => "disable", "bin-path" => "/usr/local/bin/cgi-fcgi", "docroot" => "/" # remote server may use # it's own docroot )) ) This is what I get in the error.log in ligttpd: 2010-03-07 21:00:11: (log.c.166) server started 2010-03-07 21:00:11: (mod_fastcgi.c.1104) the fastcgi-backend /usr/local/bin/cgi-fcgi failed to start: 2010-03-07 21:00:11: (mod_fastcgi.c.1108) child exited with status 1 /usr/local/bin/cgi-fcgi 2010-03-07 21:00:11: (mod_fastcgi.c.1111) If you're trying to run your app as a FastCGI backend, make sure you're using the FastCGI-enabled version. If this is PHP on Gentoo, add 'fastcgi' to the USE flags. 2010-03-07 21:00:11: (mod_fastcgi.c.1399) [ERROR]: spawning fcgi failed. 2010-03-07 21:00:11: (server.c.931) Configuration of plugins failed. Going down. I do have cgi-fcgi in /usr/local/bin: $ which cgi-fcgi /usr/local/bin/cgi-fcgi '/usr/local/bin/cgi-fcgi' is the executable after I download and compile fast-cgi. Here is my lighttpd conf file: $ more lighttpd.conf # lighttpd configuration file # # use it as a base for lighttpd 1.0.0 and above # # $Id: lighttpd.conf,v 1.7 2004/11/03 22:26:05 weigon Exp $ ############ Options you really have to take care of #################### ## modules to load # at least mod_access and mod_accesslog should be loaded # all other module should only be loaded if really neccesary # - saves some time # - saves memory server.modules = ( # "mod_rewrite", # "mod_redirect", # "mod_alias", "mod_access", # "mod_trigger_b4_dl", # "mod_auth", # "mod_status", # "mod_setenv", "mod_fastcgi", # "mod_proxy", # "mod_simple_vhost", # "mod_evhost", # "mod_userdir", # "mod_cgi", # "mod_compress", # "mod_ssi", # "mod_usertrack", # "mod_expire", # "mod_secdownload", # "mod_rrdtool", "mod_accesslog" ) ## A static document-root. For virtual hosting take a look at the ## mod_simple_vhost module. server.document-root = "/srv/www/htdocs/" ## where to send error-messages to server.errorlog = "/var/log/lighttpd/error.log" # files to check for if .../ is requested index-file.names = ( "index.php", "index.html", "index.htm", "default.htm" ) ## set the event-handler (read the performance section in the manual) # server.event-handler = "freebsd-kqueue" # needed on OS X # mimetype mapping mimetype.assign = ( ".pdf" => "application/pdf", ".sig" => "application/pgp-signature", ".spl" => "application/futuresplash", ".class" => "application/octet-stream", ".ps" => "application/postscript", ".torrent" => "application/x-bittorrent", ".dvi" => "application/x-dvi", ".gz" => "application/x-gzip", ".pac" => "application/x-ns-proxy-autoconfig", ".swf" => "application/x-shockwave-flash", ".tar.gz" => "application/x-tgz", ".tgz" => "application/x-tgz", ".tar" => "application/x-tar", ".zip" => "application/zip", ".mp3" => "audio/mpeg", ".m3u" => "audio/x-mpegurl", ".wma" => "audio/x-ms-wma", ".wax" => "audio/x-ms-wax", ".ogg" => "application/ogg", ".wav" => "audio/x-wav", ".gif" => "image/gif", ".jar" => "application/x-java-archive", ".jpg" => "image/jpeg", ".jpeg" => "image/jpeg", ".png" => "image/png", ".xbm" => "image/x-xbitmap", ".xpm" => "image/x-xpixmap", ".xwd" => "image/x-xwindowdump", ".css" => "text/css", ".html" => "text/html", ".htm" => "text/html", ".js" => "text/javascript", ".asc" => "text/plain", ".c" => "text/plain", ".cpp" => "text/plain", ".log" => "text/plain", ".conf" => "text/plain", ".text" => "text/plain", ".txt" => "text/plain", ".dtd" => "text/xml", ".xml" => "text/xml", ".mpeg" => "video/mpeg", ".mpg" => "video/mpeg", ".mov" => "video/quicktime", ".qt" => "video/quicktime", ".avi" => "video/x-msvideo", ".asf" => "video/x-ms-asf", ".asx" => "video/x-ms-asf", ".wmv" => "video/x-ms-wmv", ".bz2" => "application/x-bzip", ".tbz" => "application/x-bzip-compressed-tar", ".tar.bz2" => "application/x-bzip-compressed-tar", # default mime type "" => "application/octet-stream", ) # Use the "Content-Type" extended attribute to obtain mime type if possible #mimetype.use-xattr = "enable" ## send a different Server: header ## be nice and keep it at lighttpd # server.tag = "lighttpd" #### accesslog module accesslog.filename = "/var/log/lighttpd/access.log" ## deny access the file-extensions # # ~ is for backupfiles from vi, emacs, joe, ... # .inc is often used for code includes which should in general not be part # of the document-root url.access-deny = ( "~", ".inc" ) $HTTP["url"] =~ "\.pdf$" { server.range-requests = "disable" } ## # which extensions should not be handle via static-file transfer # # .php, .pl, .fcgi are most often handled by mod_fastcgi or mod_cgi static-file.exclude-extensions = ( ".php", ".pl", ".fcgi" ) ######### Options that are good to be but not neccesary to be changed ####### ## bind to port (default: 80) server.port = 9090 ## bind to localhost (default: all interfaces) server.bind = "127.0.0.1" ## error-handler for status 404 #server.error-handler-404 = "/error-handler.html" #server.error-handler-404 = "/error-handler.php" ## to help the rc.scripts #server.pid-file = "/var/run/lighttpd.pid" ###### virtual hosts ## ## If you want name-based virtual hosting add the next three settings and load ## mod_simple_vhost ## ## document-root = ## virtual-server-root + virtual-server-default-host + virtual-server-docroot ## or ## virtual-server-root + http-host + virtual-server-docroot ## #simple-vhost.server-root = "/srv/www/vhosts/" #simple-vhost.default-host = "www.example.org" #simple-vhost.document-root = "/htdocs/" ## ## Format: <errorfile-prefix><status-code>.html ## -> ..../status-404.html for 'File not found' #server.errorfile-prefix = "/usr/share/lighttpd/errors/status-" #server.errorfile-prefix = "/srv/www/errors/status-" ## virtual directory listings #dir-listing.activate = "enable" ## select encoding for directory listings #dir-listing.encoding = "utf-8" ## enable debugging #debug.log-request-header = "enable" #debug.log-response-header = "enable" #debug.log-request-handling = "enable" #debug.log-file-not-found = "enable" ### only root can use these options # # chroot() to directory (default: no chroot() ) #server.chroot = "/" ## change uid to <uid> (default: don't care) #server.username = "wwwrun" ## change uid to <uid> (default: don't care) #server.groupname = "wwwrun" #### compress module #compress.cache-dir = "/var/cache/lighttpd/compress/" #compress.filetype = ("text/plain", "text/html") #### proxy module ## read proxy.txt for more info #proxy.server = ( ".php" => # ( "localhost" => # ( # "host" => "192.168.0.101", # "port" => 80 # ) # ) # ) #### fastcgi module fastcgi.server = ( "/fastcgi_scripts/" => (( "host" => "127.0.0.1", "port" => 1026, "check-local" => "disable", "bin-path" => "/usr/local/bin/cgi-fcgi", #"docroot" => "/" # remote server may use # it's own docroot )) ) ## read fastcgi.txt for more info ## for PHP don't forget to set cgi.fix_pathinfo = 1 in the php.ini #fastcgi.server = ( ".php" => # ( "localhost" => # ( # "socket" => "/var/run/lighttpd/php-fastcgi.s ocket", # "bin-path" => "/usr/local/bin/php-cgi" # ) # ) # ) #### CGI module #cgi.assign = ( ".pl" => "/usr/bin/perl", # ".cgi" => "/usr/bin/perl" ) # #### SSL engine #ssl.engine = "enable" #ssl.pemfile = "/etc/ssl/private/lighttpd.pem" #### status module #status.status-url = "/server-status" #status.config-url = "/server-config" #### auth module ## read authentication.txt for more info #auth.backend = "plain" #auth.backend.plain.userfile = "lighttpd.user" #auth.backend.plain.groupfile = "lighttpd.group" #auth.backend.ldap.hostname = "localhost" #auth.backend.ldap.base-dn = "dc=my-domain,dc=com" #auth.backend.ldap.filter = "(uid=$)" #auth.require = ( "/server-status" => # ( # "method" => "digest", # "realm" => "download archiv", # "require" => "user=jan" # ), # "/server-config" => # ( # "method" => "digest", # "realm" => "download archiv", # "require" => "valid-user" # ) # ) #### url handling modules (rewrite, redirect, access) #url.rewrite = ( "^/$" => "/server-status" ) #url.redirect = ( "^/wishlist/(.+)" => "http://www.123.org/$1" ) #### both rewrite/redirect support back reference to regex conditional using %n #$HTTP["host"] =~ "^www\.(.*)" { # url.redirect = ( "^/(.*)" => "http://%1/$1" ) #} # # define a pattern for the host url finding # %% => % sign # %0 => domain name + tld # %1 => tld # %2 => domain name without tld # %3 => subdomain 1 name # %4 => subdomain 2 name # #evhost.path-pattern = "/srv/www/vhosts/%3/htdocs/" #### expire module #expire.url = ( "/buggy/" => "access 2 hours", "/asdhas/" => "ac cess plus 1 seconds 2 minutes") #### ssi #ssi.extension = ( ".shtml" ) #### rrdtool #rrdtool.binary = "/usr/bin/rrdtool" #rrdtool.db-name = "/var/lib/lighttpd/lighttpd.rrd" #### setenv #setenv.add-request-header = ( "TRAV_ENV" => "mysql://user@host/db" ) #setenv.add-response-header = ( "X-Secret-Message" => "42" ) ## for mod_trigger_b4_dl # trigger-before-download.gdbm-filename = "/var/lib/lighttpd/trigger.db" # trigger-before-download.memcache-hosts = ( "127.0.0.1:11211" ) # trigger-before-download.trigger-url = "^/trigger/" # trigger-before-download.download-url = "^/download/" # trigger-before-download.deny-url = "http://127.0.0.1/index.html" # trigger-before-download.trigger-timeout = 10 #### variable usage: ## variable name without "." is auto prefixed by "var." and becomes "var.bar" #bar = 1 #var.mystring = "foo" ## integer add #bar += 1 ## string concat, with integer cast as string, result: "www.foo1.com" #server.name = "www." + mystring + var.bar + ".com" ## array merge #index-file.names = (foo + ".php") + index-file.names #index-file.names += (foo + ".php") #### include #include /etc/lighttpd/lighttpd-inc.conf ## same as above if you run: "lighttpd -f /etc/lighttpd/lighttpd.conf" #include "lighttpd-inc.conf" #### include_shell #include_shell "echo var.a=1" ## the above is same as: #var.a=1 Thank you for your help.

    Read the article

  • jetty - javax.naming.InvalidNameException: A flat name can only have a single component

    - by Dinesh Pillay
    I have been breaking my head against this for too much time now. I'm trying to get maven + jetty + jotm to play nice but it looks like its too much to ask for :( Below is my jetty.xml:- <?xml version="1.0"?> <!DOCTYPE Configure PUBLIC "-//Jetty//Configure//EN" "http://www.eclipse.org/jetty/configure.dtd"> <Configure id="Server" class="org.mortbay.jetty.Server"> <New id="jotm" class="org.objectweb.jotm.Jotm"> <Arg type="boolean">true</Arg> <Arg type="boolean">false</Arg> <Call id="tm" name="getTransactionManager" /> <Call id="ut" name="getUserTransaction" /> </New> <New class="org.mortbay.jetty.plus.naming.Resource"> <Arg /> <Arg>javax.transaction.TransactionManager</Arg> <Arg><Ref id="ut" /></Arg> </New> <New id="tx" class="org.mortbay.jetty.plus.naming.Transaction"> <Arg><Ref id="ut" /></Arg> </New> <New class="org.mortbay.jetty.plus.naming.Resource"> <Arg>myxadatasource</Arg> <Arg> <New id="myxadatasourceA" class="org.enhydra.jdbc.standard.StandardXADataSource"> <Set name="DriverName">org.apache.derby.jdbc.EmbeddedDriver</Set> <Set name="Url">jdbc:derby:protodb;create=true</Set> <Set name="User"></Set> <Set name="Password"></Set> <Set name="transactionManager"> <Ref id="tm" /> </Set> </New> </Arg> </New> <New id="protodb" class="org.mortbay.jetty.plus.naming.Resource"> <Arg>jdbc/protodb</Arg> <Arg> <New class="org.enhydra.jdbc.pool.StandardXAPoolDataSource"> <Arg> <Ref id="myxadatasourceA" /> </Arg> <Set name="DataSourceName">myxadatasource</Set> </New> </Arg> </New> And this is the maven plugin configuration:- <plugin> <groupId>org.mortbay.jetty</groupId> <artifactId>maven-jetty-plugin</artifactId> <configuration> <scanIntervalSeconds>10</scanIntervalSeconds> <stopKey>ps</stopKey> <stopPort>7777</stopPort> <webAppConfig> <contextPath>/ps</contextPath> </webAppConfig> <connectors> <connector implementation="org.mortbay.jetty.nio.SelectChannelConnector"> <port>7070</port> <maxIdleTime>60000</maxIdleTime> </connector> </connectors> <jettyConfig>src/main/webapp/WEB-INF/jetty.xml</jettyConfig> </configuration> <executions> <execution> <id>start-jetty</id> <phase>pre-integration-test</phase> <goals> <goal>run</goal> </goals> <configuration> <scanIntervalSeconds>0</scanIntervalSeconds> <daemon>true</daemon> </configuration> </execution> <execution> <id>stop-jetty</id> <phase>post-integration-test</phase> <goals> <goal>stop</goal> </goals> </execution> </executions> <dependencies> <dependency> <groupId>org.apache.derby</groupId> <artifactId>derby</artifactId> <version>10.6.1.0</version> </dependency> <dependency> <groupId>jotm</groupId> <artifactId>jotm</artifactId> <version>2.0.10</version> <exclusions> <exclusion> <groupId>javax.resource</groupId> <artifactId>connector</artifactId> </exclusion> </exclusions> </dependency> <dependency> <groupId>com.experlog</groupId> <artifactId>xapool</artifactId> <version>1.5.0</version> </dependency> <dependency> <groupId>javax.resource</groupId> <artifactId>connector-api</artifactId> <version>1.5</version> </dependency> <dependency> <groupId>javax.transaction</groupId> <artifactId>jta</artifactId> <version>1.0.1B</version> </dependency> <!-- <dependency> <groupId>javax.jts</groupId> <artifactId>jts</artifactId> <version>1.0</version> </dependency> --> </dependencies> </plugin> I am using maven-jetty-plugin-6.1.24 cause I couldn't get the later one's to work either. When I execute this I get the following exception:- 2010-06-16 09:03:13.423:WARN::Config error at javax.transaction.TransactionManager java.lang.reflect.InvocationTargetException [INFO] ------------------------------------------------------------------------ [ERROR] BUILD ERROR [INFO] ------------------------------------------------------------------------ [INFO] Failure A flat name can only have a single component [INFO] ------------------------------------------------------------------------ Caused by: javax.naming.InvalidNameException: A flat name can only have a single component at javax.naming.NameImpl.addAll(NameImpl.java:621) at javax.naming.CompoundName.addAll(CompoundName.java:442) at org.mortbay.jetty.plus.naming.NamingEntryUtil.makeNamingEntryName(NamingEntryUtil.java:136) at org.mortbay.jetty.plus.naming.NamingEntry.save(NamingEntry.java:196) at org.mortbay.jetty.plus.naming.NamingEntry.(NamingEntry.java:58) at org.mortbay.jetty.plus.naming.Resource.(Resource.java:34) ... 31 more Help!

    Read the article

  • ServerRoot in my lighttpd.conf

    - by michael
    Hi, I have use the following example lighttpd.conf to launch my lighttpd. Can you please tell me where is my 'ServerRoot'? # lighttpd configuration file # # use it as a base for lighttpd 1.0.0 and above # # $Id: lighttpd.conf,v 1.7 2004/11/03 22:26:05 weigon Exp $ ############ Options you really have to take care of #################### ## modules to load # at least mod_access and mod_accesslog should be loaded # all other module should only be loaded if really neccesary # - saves some time # - saves memory server.modules = ( # "mod_rewrite", # "mod_redirect", # "mod_alias", "mod_access", # "mod_trigger_b4_dl", # "mod_auth", # "mod_status", # "mod_setenv", "mod_fastcgi", # "mod_proxy", # "mod_simple_vhost", # "mod_evhost", # "mod_userdir", # "mod_cgi", # "mod_compress", # "mod_ssi", # "mod_usertrack", # "mod_expire", # "mod_secdownload", # "mod_rrdtool", "mod_accesslog" ) ## A static document-root. For virtual hosting take a look at the ## mod_simple_vhost module. server.document-root = "/srv/www/htdocs/" ## where to send error-messages to server.errorlog = "/var/log/lighttpd/error.log" # files to check for if .../ is requested index-file.names = ( "index.php", "index.html", "index.htm", "default.htm" ) ## set the event-handler (read the performance section in the manual) # server.event-handler = "freebsd-kqueue" # needed on OS X # mimetype mapping mimetype.assign = ( ".pdf" => "application/pdf", ".sig" => "application/pgp-signature", ".spl" => "application/futuresplash", ".class" => "application/octet-stream", ".ps" => "application/postscript", ".torrent" => "application/x-bittorrent", ".dvi" => "application/x-dvi", ".gz" => "application/x-gzip", ".pac" => "application/x-ns-proxy-autoconfig", ".swf" => "application/x-shockwave-flash", ".tar.gz" => "application/x-tgz", ".tgz" => "application/x-tgz", ".tar" => "application/x-tar", ".zip" => "application/zip", ".mp3" => "audio/mpeg", ".m3u" => "audio/x-mpegurl", ".wma" => "audio/x-ms-wma", ".wax" => "audio/x-ms-wax", ".ogg" => "application/ogg", ".wav" => "audio/x-wav", ".gif" => "image/gif", ".jar" => "application/x-java-archive", ".jpg" => "image/jpeg", ".jpeg" => "image/jpeg", ".png" => "image/png", ".xbm" => "image/x-xbitmap", ".xpm" => "image/x-xpixmap", ".xwd" => "image/x-xwindowdump", ".css" => "text/css", ".html" => "text/html", ".htm" => "text/html", ".js" => "text/javascript", ".asc" => "text/plain", ".c" => "text/plain", ".cpp" => "text/plain", ".log" => "text/plain", ".conf" => "text/plain", ".text" => "text/plain", ".txt" => "text/plain", ".dtd" => "text/xml", ".xml" => "text/xml", ".mpeg" => "video/mpeg", ".mpg" => "video/mpeg", ".mov" => "video/quicktime", ".qt" => "video/quicktime", ".avi" => "video/x-msvideo", ".asf" => "video/x-ms-asf", ".asx" => "video/x-ms-asf", ".wmv" => "video/x-ms-wmv", ".bz2" => "application/x-bzip", ".tbz" => "application/x-bzip-compressed-tar", ".tar.bz2" => "application/x-bzip-compressed-tar", # default mime type "" => "application/octet-stream", ) # Use the "Content-Type" extended attribute to obtain mime type if possible #mimetype.use-xattr = "enable" ## send a different Server: header ## be nice and keep it at lighttpd # server.tag = "lighttpd" #### accesslog module accesslog.filename = "/var/log/lighttpd/access.log" ## deny access the file-extensions # # ~ is for backupfiles from vi, emacs, joe, ... # .inc is often used for code includes which should in general not be part # of the document-root url.access-deny = ( "~", ".inc" ) $HTTP["url"] =~ "\.pdf$" { server.range-requests = "disable" } ## # which extensions should not be handle via static-file transfer # # .php, .pl, .fcgi are most often handled by mod_fastcgi or mod_cgi static-file.exclude-extensions = ( ".php", ".pl", ".fcgi" ) ######### Options that are good to be but not neccesary to be changed ####### ## bind to port (default: 80) server.port = 9090 ## bind to localhost (default: all interfaces) server.bind = "127.0.0.1" ## error-handler for status 404 #server.error-handler-404 = "/error-handler.html" #server.error-handler-404 = "/error-handler.php" ## to help the rc.scripts #server.pid-file = "/var/run/lighttpd.pid" ###### virtual hosts ## ## If you want name-based virtual hosting add the next three settings and load ## mod_simple_vhost ## ## document-root = ## virtual-server-root + virtual-server-default-host + virtual-server-docroot ## or ## virtual-server-root + http-host + virtual-server-docroot ## #simple-vhost.server-root = "/srv/www/vhosts/" #simple-vhost.default-host = "www.example.org" #simple-vhost.document-root = "/htdocs/" ## ## Format: <errorfile-prefix><status-code>.html ## -> ..../status-404.html for 'File not found' #server.errorfile-prefix = "/usr/share/lighttpd/errors/status-" #server.errorfile-prefix = "/srv/www/errors/status-" ## virtual directory listings #dir-listing.activate = "enable" ## select encoding for directory listings #dir-listing.encoding = "utf-8" ## enable debugging #debug.log-request-header = "enable" #debug.log-response-header = "enable" #debug.log-request-handling = "enable" #debug.log-file-not-found = "enable" ### only root can use these options # # chroot() to directory (default: no chroot() ) #server.chroot = "/" ## change uid to <uid> (default: don't care) #server.username = "wwwrun" ## change uid to <uid> (default: don't care) #server.groupname = "wwwrun" #### compress module #compress.cache-dir = "/var/cache/lighttpd/compress/" #compress.filetype = ("text/plain", "text/html") #### proxy module ## read proxy.txt for more info #proxy.server = ( ".php" => # ( "localhost" => # ( # "host" => "192.168.0.101", # "port" => 80 # ) # ) # ) #### fastcgi module fastcgi.server = ( "/fastcgi_scripts/" => (( "host" => "127.0.0.1", "port" => 1026, "check-local" => "disable", "bin-path" => "/usr/local/bin/cgi-fcgi", #"docroot" => "/" # remote server may use # it's own docroot )) ) ## read fastcgi.txt for more info ## for PHP don't forget to set cgi.fix_pathinfo = 1 in the php.ini #fastcgi.server = ( ".php" => # ( "localhost" => # ( # "socket" => "/var/run/lighttpd/php-fastcgi.socket", # "bin-path" => "/usr/local/bin/php-cgi" # ) # ) # ) #### CGI module #cgi.assign = ( ".pl" => "/usr/bin/perl", # ".cgi" => "/usr/bin/perl" ) # #### SSL engine #ssl.engine = "enable" #ssl.pemfile = "/etc/ssl/private/lighttpd.pem" #### status module #status.status-url = "/server-status" #status.config-url = "/server-config" #### auth module ## read authentication.txt for more info #auth.backend = "plain" #auth.backend.plain.userfile = "lighttpd.user" #auth.backend.plain.groupfile = "lighttpd.group" #auth.backend.ldap.hostname = "localhost" #auth.backend.ldap.base-dn = "dc=my-domain,dc=com" #auth.backend.ldap.filter = "(uid=$)" #auth.require = ( "/server-status" => # ( # "method" => "digest", # "realm" => "download archiv", # "require" => "user=jan" # ), # "/server-config" => # ( # "method" => "digest", # "realm" => "download archiv", # "require" => "valid-user" # ) # ) #### url handling modules (rewrite, redirect, access) #url.rewrite = ( "^/$" => "/server-status" ) #url.redirect = ( "^/wishlist/(.+)" => "http://www.123.org/$1" ) #### both rewrite/redirect support back reference to regex conditional using %n #$HTTP["host"] =~ "^www\.(.*)" { # url.redirect = ( "^/(.*)" => "http://%1/$1" ) #} # # define a pattern for the host url finding # %% => % sign # %0 => domain name + tld # %1 => tld # %2 => domain name without tld # %3 => subdomain 1 name # %4 => subdomain 2 name # #evhost.path-pattern = "/srv/www/vhosts/%3/htdocs/" #### expire module #expire.url = ( "/buggy/" => "access 2 hours", "/asdhas/" => "access plus 1 seconds 2 minutes") #### ssi #ssi.extension = ( ".shtml" ) #### rrdtool #rrdtool.binary = "/usr/bin/rrdtool" #rrdtool.db-name = "/var/lib/lighttpd/lighttpd.rrd" #### setenv #setenv.add-request-header = ( "TRAV_ENV" => "mysql://user@host/db" ) #setenv.add-response-header = ( "X-Secret-Message" => "42" ) ## for mod_trigger_b4_dl # trigger-before-download.gdbm-filename = "/var/lib/lighttpd/trigger.db" # trigger-before-download.memcache-hosts = ( "127.0.0.1:11211" ) # trigger-before-download.trigger-url = "^/trigger/" # trigger-before-download.download-url = "^/download/" # trigger-before-download.deny-url = "http://127.0.0.1/index.html" # trigger-before-download.trigger-timeout = 10 #### variable usage: ## variable name without "." is auto prefixed by "var." and becomes "var.bar" #bar = 1 #var.mystring = "foo" ## integer add #bar += 1 ## string concat, with integer cast as string, result: "www.foo1.com" #server.name = "www." + mystring + var.bar + ".com" ## array merge #index-file.names = (foo + ".php") + index-file.names #index-file.names += (foo + ".php") #### include #include /etc/lighttpd/lighttpd-inc.conf ## same as above if you run: "lighttpd -f /etc/lighttpd/lighttpd.conf" #include "lighttpd-inc.conf" #### include_shell #include_shell "echo var.a=1" ## the above is same as: #var.a=1 Thank you.

    Read the article

  • force close when assign onclick to button

    - by Lynnooi
    hi, i am very new in android development as well as in java. i had developed an application that gets an image url from a site and wanted to download it into the device and later on i would like to enable users to set it as wallpapers. however, i am met a problem when assigning onclick event to a button. Once i uncomment the line in red, it will pop up a box stating that the application was stopped unexpectedly. Can someone please help me with this? private ImageView imView = null; public void onCreate(Bundle icicle) { super.onCreate(icicle); setContentView(R.layout.main); try { /* Create a URL we want to load some xml-data from. */ URL url = new URL(xmlURL); /* Get a SAXParser from the SAXPArserFactory. */ SAXParserFactory spf = SAXParserFactory.newInstance(); SAXParser sp = spf.newSAXParser(); /* Get the XMLReader of the SAXParser we created. */ XMLReader xr = sp.getXMLReader(); /* Create a new ContentHandler and apply it to the XML-Reader */ ExampleHandler myExampleHandler = new ExampleHandler(); xr.setContentHandler(myExampleHandler); /* Parse the xml-data from our URL. */ xr.parse(new InputSource(url.openStream())); /* Parsing has finished. */ /* Our ExampleHandler now provides the parsed data to us. */ ParsedExampleDataSet parsedExampleDataSet = myExampleHandler .getParsedData(); /* Set the result to be displayed in our GUI. */ if (myExampleHandler.filenames != null) { a = a + "\n" + myExampleHandler.filenames + ", by " + myExampleHandler.authors + "\nhits: " + myExampleHandler.hits + " downloads"; this.ed = myExampleHandler.thumbs; this.imageURL = myExampleHandler.mediafiles; } } catch (Exception e) { a = e.getMessage(); } // get thumbnail Context context = this.getBaseContext(); if (ed.length() != 0) { Drawable image = ImageOperations(context, this.ed, "image.jpg"); ImageView imgView = new ImageView(context); imgView = (ImageView) findViewById(R.id.image1); imgView.setImageDrawable(image); } TextView tv = (TextView) findViewById(R.id.txt_name); tv.setText(a); Button bt3 = (Button) findViewById(R.id.get_imagebt); //bt3.setOnClickListener(getImageBtnOnClick); } OnClickListener getImageBtnOnClick = new OnClickListener() { public void onClick(View view) { downloadFile(imageURL); } }; void downloadFile(String fileUrl) { URL myFileUrl = null; try { myFileUrl = new URL(fileUrl); } catch (MalformedURLException e) { // TODO Auto-generated catch block e.printStackTrace(); } try { HttpURLConnection conn = (HttpURLConnection) myFileUrl .openConnection(); conn.setDoInput(true); conn.connect(); int length = conn.getContentLength(); InputStream is = conn.getInputStream(); bmImg = BitmapFactory.decodeStream(is); // this.imView.setImageBitmap(bmImg); } catch (IOException e) { // TODO Auto-generated catch block e.printStackTrace(); } } private Drawable ImageOperations(Context ctx, String url, String saveFilename) { try { InputStream is = (InputStream) this.fetch(url); Drawable d = Drawable.createFromStream(is, "src"); return d; } catch (MalformedURLException e) { e.printStackTrace(); return null; } catch (IOException e) { e.printStackTrace(); return null; } } public Object fetch(String address) throws MalformedURLException, IOException { URL url = new URL(address); Object content = url.getContent(); return content; } Main.xml <?xml version="1.0" encoding="utf-8"?> <LinearLayout xmlns:android="http://schemas.android.com/apk/res/android" android:orientation="vertical" android:layout_width="fill_parent" android:layout_height="fill_parent" android:id="@+id/viewgroup"> <ImageView android:id="@+id/image1" android:layout_width="wrap_content" android:layout_height="wrap_content" android:layout_gravity="center" /> <ImageView android:id="@+id/image2" android:layout_width="wrap_content" android:layout_height="wrap_content" android:layout_gravity="center" /> <TextView android:id="@+id/txt_name" android:layout_width="wrap_content" android:layout_height="wrap_content" android:layout_gravity="center_horizontal" /> <Button id="@+id/get_imagebt" android:layout_width="wrap_content" android:layout_height="wrap_content" android:text="xxx Get an image" android:layout_gravity="center" /> <ImageView id="@+id/imview" android:layout_width="wrap_content" android:layout_height="wrap_content" android:layout_gravity="center" /> </LinearLayout>

    Read the article

  • problem in loading images from web

    - by Lynnooi
    hi, I am new in android and had developed an app which get images from the website and display it. I got it working in emulator but not in real phones. In some device, it will crash or take very long loading period. Can anyone please help me or guide me in improving it as i'm not sure whether the way i loads the images is correct or not. Here are the code i use to get the images from the web and display accordingly. if (xmlURL.length() != 0) { try { URL url = new URL(xmlURL); SAXParserFactory spf = SAXParserFactory.newInstance(); SAXParser sp = spf.newSAXParser(); /* Get the XMLReader of the SAXParser we created. */ XMLReader xr = sp.getXMLReader(); /* * Create a new ContentHandler and apply it to the * XML-Reader */ xr.setContentHandler(myExampleHandler); /* Parse the xml-data from our URL. */ xr.parse(new InputSource(url.openStream())); /* Parsing has finished. */ /* * Our ExampleHandler now provides the parsed data to * us. */ ParsedExampleDataSet parsedExampleDataSet = myExampleHandler.getParsedData(); } catch (Exception e) { } } if (s.equalsIgnoreCase("wallpapers")) { Context context = helloAndroid.this.getBaseContext(); for (int j = 0; j <= myExampleHandler.filenames.size() - 1; j++) { if (myExampleHandler.filenames.elementAt(j).toString() != null) { helloAndroid.this.ed = myExampleHandler.thumbs.elementAt(j) .toString(); if (helloAndroid.this.ed.length() != 0) { Drawable image = ImageOperations(context, helloAndroid.this.ed, "image.jpg"); file_info = myExampleHandler.filenames .elementAt(j).toString(); author = "\nby " + myExampleHandler.authors.elementAt(j) .toString(); switch (j + 1) { case 1: ImageView imgView1 = new ImageView(context); imgView1 = (ImageView) findViewById(R.id.image1); if (image.getIntrinsicHeight() > 0) { imgView1.setImageDrawable(image); } else imgView1 .setImageResource(R.drawable.empty_wallpaper); tv = (TextView) findViewById(R.id.filename1); tv.setText(file_info); tv = (TextView) findViewById(R.id.author1); tv.setText(author); imgView1 .setOnClickListener(new View.OnClickListener() { public void onClick(View view) { // Perform action on click Intent myIntent1 = new Intent( helloAndroid.this, galleryFile.class); Bundle b = new Bundle(); b.putString("fileID",myExampleHandler.fileid.elementAt(0).toString()); b.putString("page", "1"); b.putString("family", s); b.putString("fi",myExampleHandler.folder_id.elementAt(folder).toString()); b.putString("kw", keyword); myIntent1.putExtras(b); startActivityForResult( myIntent1, 0); } }); break; case 2: ImageView imgView2 = new ImageView(context); imgView2 = (ImageView) findViewById(R.id.image2); imgView2.setImageDrawable(image); tv = (TextView) findViewById(R.id.filename2); tv.setText(file_info); tv = (TextView) findViewById(R.id.author2); tv.setText(author); imgView2 .setOnClickListener(new View.OnClickListener() { public void onClick(View view) { // Perform action on click Intent myIntent1 = new Intent( helloAndroid.this, galleryFile.class); Bundle b = new Bundle(); b.putString("fileID",myExampleHandler.fileid.elementAt(1).toString()); b.putString("page", "1"); b.putString("family", s); b.putString("fi",myExampleHandler.folder_id.elementAt(folder).toString()); b.putString("kw", keyword); myIntent1.putExtras(b); startActivityForResult( myIntent1, 0); } }); break; case 3: //same code break; } } } } } private Drawable ImageOperations(Context ctx, String url, String saveFilename) { try { InputStream is = (InputStream) this.fetch(url); Drawable d = Drawable.createFromStream(is, "src"); return d; } catch (MalformedURLException e) { e.printStackTrace(); return null; } catch (IOException e) { e.printStackTrace(); return null; } } public Object fetch(String address) throws MalformedURLException, IOException { URL url = new URL(address); Object content = url.getContent(); return content; }

    Read the article

  • Spring MVC configuration problems

    - by Smek
    i have some problems with configuring Spring MVC. I made a maven multi module project with the following modules: /api /domain /repositories /webapp I like to share the domain and the repositories between the api and the webapp (both web projects). First i want to configure the webapp to use the repositories module so i added the dependencies in the xml file like this: <dependency> <groupId>${project.groupId}</groupId> <artifactId>domain</artifactId> <version>1.0-SNAPSHOT</version> </dependency> <dependency> <groupId>${project.groupId}</groupId> <artifactId>repositories</artifactId> <version>1.0-SNAPSHOT</version> </dependency> And my controller in the webapp module looks like this: package com.mywebapp.webapp; import com.mywebapp.domain.Person; import com.mywebapp.repositories.services.PersonService; import org.springframework.beans.factory.annotation.Autowired; import org.springframework.context.annotation.ComponentScan; import org.springframework.context.annotation.Configuration; import org.springframework.stereotype.Controller; import org.springframework.ui.ModelMap; import org.springframework.web.bind.annotation.RequestMapping; import org.springframework.web.bind.annotation.RequestMethod; @Controller @RequestMapping("/") @Configuration @ComponentScan("com.mywebapp.repositories") public class PersonController { @Autowired PersonService personservice; @RequestMapping(method = RequestMethod.GET) public String printWelcome(ModelMap model) { Person p = new Person(); p.age = 23; p.firstName = "John"; p.lastName = "Doe"; personservice.createNewPerson(p); model.addAttribute("message", "Hello world!"); return "index"; } } In my webapp module i try to load configuration files in my web.xml like this: <context-param> <param-name>contextConfigLocation</param-name> <param-value>classpath:/META-INF/persistence-context.xml, classpath:/META-INF/service-context.xml</param-value> </context-param> These files cannot be found so i get the following error: org.springframework.beans.factory.BeanDefinitionStoreException: IOException parsing XML document from class path resource [META-INF/persistence-context.xml]; nested exception is java.io.FileNotFoundException: class path resource [META-INF/persistence-context.xml] cannot be opened because it does not exist These files are in the repositories module so my first question is how can i make Spring to find these files? I also have trouble Autowiring the PersonService to my Controller class did i forget to configure something in my XML? Here is the error message: [INFO] [talledLocalContainer] SEVERE: Exception sending context initialized event to listener instance of class org.springframework.web.context.ContextLoaderListener [INFO] [talledLocalContainer] org.springframework.beans.factory.BeanCreationException: Error creating bean with name 'personServiceImpl': Injection of autowired dependencies failed; nested exception is org.springframework.beans.factory.BeanCreationException: Could not autowire field: private com.mywebapp.repositories.repository.PersonRepository com.mywebapp.repositories.services.PersonServiceImpl.personRepository; nested exception is org.springframework.beans.factory.NoSuchBeanDefinitionException: No matching bean of type [com.mywebapp.repositories.repository.PersonRepository] found for dependency: expected at least 1 bean which qualifies as autowire candidate for this dependency. Dependency annotations: {@org.springframework.beans.factory.annotation.Autowired(required=true)} PersonServiceImple.java: package com.mywebapp.repositories.services; import com.mywebapp.domain.Person; import com.mywebapp.repositories.repository.PersonRepository; import org.springframework.beans.factory.annotation.Autowired; import org.springframework.data.mongodb.core.MongoTemplate; import org.springframework.stereotype.Service; @Service public class PersonServiceImpl implements PersonService{ @Autowired public PersonRepository personRepository; @Autowired public MongoTemplate personTemplate; @Override public Person createNewPerson(Person person) { return personRepository.save(person); } } PersonService.java package com.mywebapp.repositories.services; import com.mywebapp.domain.Person; public interface PersonService { Person createNewPerson(Person person); } PersonRepository.java: package com.mywebapp.repositories.repository; import com.mywebapp.domain.Person; import org.springframework.data.mongodb.repository.MongoRepository; import org.springframework.stereotype.Repository; import java.math.BigInteger; @Repository public interface PersonRepository extends MongoRepository<Person, BigInteger> { } persistance-context.xml <?xml version="1.0" encoding="UTF-8"?> <beans xmlns="http://www.springframework.org/schema/beans" xmlns:xsi="http://www.w3.org/2001/XMLSchema-instance" xmlns:context="http://www.springframework.org/schema/context" xmlns:mongo="http://www.springframework.org/schema/data/mongo" xsi:schemaLocation= "http://www.springframework.org/schema/context http://www.springframework.org/schema/context/spring-context-3.0.xsd http://www.springframework.org/schema/data/mongo http://www.springframework.org/schema/data/mongo/spring-mongo-1.0.xsd http://www.springframework.org/schema/beans http://www.springframework.org/schema/beans/spring-beans-3.0.xsd"> <context:property-placeholder location="classpath:mongo.properties"/> <mongo:mongo host="${mongo.host}" port="${mongo.port}" id="mongo"> <mongo:options connections-per-host="${mongo.connectionsPerHost}" threads-allowed-to-block-for-connection-multiplier="${mongo.threadsAllowedToBlockForConnectionMultiplier}" connect-timeout="${mongo.connectTimeout}" max-wait-time="${mongo.maxWaitTime}" auto-connect-retry="${mongo.autoConnectRetry}" socket-keep-alive="${mongo.socketKeepAlive}" socket-timeout="${mongo.socketTimeout}" slave-ok="${mongo.slaveOk}" write-number="1" write-timeout="0" write-fsync="true"/> </mongo:mongo> <mongo:db-factory dbname="person" mongo-ref="mongo" id="mongoDbFactory"/> <bean id="personTemplate" name="personTemplate" class="org.springframework.data.mongodb.core.MongoTemplate"> <constructor-arg name="mongoDbFactory" ref="mongoDbFactory"/> </bean> <mongo:repositories base-package="com.mywebapp.repositories.repository" mongo-template-ref="personTemplate"> <mongo:repository id="personRepository" repository-impl-postfix="PersonRepository" mongo-template-ref="personTemplate" create-query-indexes="true"/> </mongo:repositories> Thanks

    Read the article

  • Spring App error: java.lang.NoClassDefFoundError: org/springframework/security/core/SpringSecurityCoreVersion

    - by Shades88
    I am writing a simple spring mvc login form example. I am getting below error in netbeans 05-Jun-2014 02:11:51.055 SEVERE [http-nio-8084-exec-1] org.apache.catalina.core.StandardContext.listenerStart Exception sending context initialized event to listener instance of class org.springframework.web.context.ContextLoaderListener org.springframework.beans.factory.BeanDefinitionStoreException: Unexpected exception parsing XML document from ServletContext resource [/WEB-INF/SpringSecurity.xml]; nested exception is org.springframework.beans.BeanInstantiationException: Could not instantiate bean class [org.springframework.security.config.SecurityNamespaceHandler]: Constructor threw exception; nested exception is java.lang.NoClassDefFoundError: org/springframework/security/core/SpringSecurityCoreVersion at org.springframework.beans.factory.xml.XmlBeanDefinitionReader.doLoadBeanDefinitions(XmlBeanDefinitionReader.java:413) at org.springframework.beans.factory.xml.XmlBeanDefinitionReader.loadBeanDefinitions(XmlBeanDefinitionReader.java:335) at org.springframework.beans.factory.xml.XmlBeanDefinitionReader.loadBeanDefinitions(XmlBeanDefinitionReader.java:303) at org.springframework.beans.factory.support.AbstractBeanDefinitionReader.loadBeanDefinitions(AbstractBeanDefinitionReader.java:180) at org.springframework.beans.factory.support.AbstractBeanDefinitionReader.loadBeanDefinitions(AbstractBeanDefinitionReader.java:216) at org.springframework.beans.factory.support.AbstractBeanDefinitionReader.loadBeanDefinitions(AbstractBeanDefinitionReader.java:187) at org.springframework.web.context.support.XmlWebApplicationContext.loadBeanDefinitions(XmlWebApplicationContext.java:125) at org.springframework.web.context.support.XmlWebApplicationContext.loadBeanDefinitions(XmlWebApplicationContext.java:94) at org.springframework.context.support.AbstractRefreshableApplicationContext.refreshBeanFactory(AbstractRefreshableApplicationContext.java:129) at org.springframework.context.support.AbstractApplicationContext.obtainFreshBeanFactory(AbstractApplicationContext.java:540) at org.springframework.context.support.AbstractApplicationContext.refresh(AbstractApplicationContext.java:454) at org.springframework.web.context.ContextLoader.configureAndRefreshWebApplicationContext(ContextLoader.java:403) at org.springframework.web.context.ContextLoader.initWebApplicationContext(ContextLoader.java:306) at org.springframework.web.context.ContextLoaderListener.contextInitialized(ContextLoaderListener.java:106) at org.apache.catalina.core.StandardContext.listenerStart(StandardContext.java:4738) at org.apache.catalina.core.StandardContext.startInternal(StandardContext.java:5158) at org.apache.catalina.util.LifecycleBase.start(LifecycleBase.java:150) at org.apache.catalina.core.ContainerBase.addChildInternal(ContainerBase.java:726) at org.apache.catalina.core.ContainerBase.addChild(ContainerBase.java:702) at org.apache.catalina.core.StandardHost.addChild(StandardHost.java:697) at org.apache.catalina.startup.HostConfig.deployDescriptor(HostConfig.java:579) at org.apache.catalina.startup.HostConfig.deployApps(HostConfig.java:455) at org.apache.catalina.startup.HostConfig.check(HostConfig.java:1554) at sun.reflect.GeneratedMethodAccessor53.invoke(Unknown Source) at sun.reflect.DelegatingMethodAccessorImpl.invoke(DelegatingMethodAccessorImpl.java:43) at java.lang.reflect.Method.invoke(Method.java:606) at org.apache.tomcat.util.modeler.BaseModelMBean.invoke(BaseModelMBean.java:300) at com.sun.jmx.interceptor.DefaultMBeanServerInterceptor.invoke(DefaultMBeanServerInterceptor.java:819) at com.sun.jmx.mbeanserver.JmxMBeanServer.invoke(JmxMBeanServer.java:801) at org.apache.catalina.manager.ManagerServlet.check(ManagerServlet.java:1428) at org.apache.catalina.manager.ManagerServlet.deploy(ManagerServlet.java:885) at org.apache.catalina.manager.ManagerServlet.doGet(ManagerServlet.java:343) at javax.servlet.http.HttpServlet.service(HttpServlet.java:618) at javax.servlet.http.HttpServlet.service(HttpServlet.java:725) at org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(ApplicationFilterChain.java:301) at org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterChain.java:206) at org.apache.tomcat.websocket.server.WsFilter.doFilter(WsFilter.java:52) at org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(ApplicationFilterChain.java:239) at org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterChain.java:206) at org.netbeans.modules.web.monitor.server.MonitorFilter.doFilter(MonitorFilter.java:393) at org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(ApplicationFilterChain.java:239) at org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterChain.java:206) at org.apache.catalina.filters.SetCharacterEncodingFilter.doFilter(SetCharacterEncodingFilter.java:108) at org.apache.catalina.core.ApplicationFilterChain.internalDoFilter(ApplicationFilterChain.java:239) at org.apache.catalina.core.ApplicationFilterChain.doFilter(ApplicationFilterChain.java:206) at org.apache.catalina.core.StandardWrapperValve.invoke(StandardWrapperValve.java:219) at org.apache.catalina.core.StandardContextValve.invoke(StandardContextValve.java:106) at org.apache.catalina.authenticator.AuthenticatorBase.invoke(AuthenticatorBase.java:615) at org.apache.catalina.core.StandardHostValve.invoke(StandardHostValve.java:136) at org.apache.catalina.valves.ErrorReportValve.invoke(ErrorReportValve.java:74) at org.apache.catalina.valves.AbstractAccessLogValve.invoke(AbstractAccessLogValve.java:610) at org.apache.catalina.core.StandardEngineValve.invoke(StandardEngineValve.java:88) at org.apache.catalina.connector.CoyoteAdapter.service(CoyoteAdapter.java:516) at org.apache.coyote.http11.AbstractHttp11Processor.process(AbstractHttp11Processor.java:1015) at org.apache.coyote.AbstractProtocol$AbstractConnectionHandler.process(AbstractProtocol.java:652) at org.apache.coyote.http11.Http11NioProtocol$Http11ConnectionHandler.process(Http11NioProtocol.java:222) at org.apache.tomcat.util.net.NioEndpoint$SocketProcessor.doRun(NioEndpoint.java:1575) at org.apache.tomcat.util.net.NioEndpoint$SocketProcessor.run(NioEndpoint.java:1533) at java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1145) at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:615) at java.lang.Thread.run(Thread.java:744) Caused by: org.springframework.beans.BeanInstantiationException: Could not instantiate bean class [org.springframework.security.config.SecurityNamespaceHandler]: Constructor threw exception; nested exception is java.lang.NoClassDefFoundError: org/springframework/security/core/SpringSecurityCoreVersion at org.springframework.beans.BeanUtils.instantiateClass(BeanUtils.java:164) at org.springframework.beans.BeanUtils.instantiateClass(BeanUtils.java:105) at org.springframework.beans.factory.xml.DefaultNamespaceHandlerResolver.resolve(DefaultNamespaceHandlerResolver.java:130) at org.springframework.beans.factory.xml.BeanDefinitionParserDelegate.parseCustomElement(BeanDefinitionParserDelegate.java:1419) at org.springframework.beans.factory.xml.BeanDefinitionParserDelegate.parseCustomElement(BeanDefinitionParserDelegate.java:1414) at org.springframework.beans.factory.xml.DefaultBeanDefinitionDocumentReader.parseBeanDefinitions(DefaultBeanDefinitionDocumentReader.java:187) at org.springframework.beans.factory.xml.DefaultBeanDefinitionDocumentReader.doRegisterBeanDefinitions(DefaultBeanDefinitionDocumentReader.java:141) at org.springframework.beans.factory.xml.DefaultBeanDefinitionDocumentReader.registerBeanDefinitions(DefaultBeanDefinitionDocumentReader.java:110) at org.springframework.beans.factory.xml.XmlBeanDefinitionReader.registerBeanDefinitions(XmlBeanDefinitionReader.java:508) at org.springframework.beans.factory.xml.XmlBeanDefinitionReader.doLoadBeanDefinitions(XmlBeanDefinitionReader.java:391) ... 60 more Caused by: java.lang.NoClassDefFoundError: org/springframework/security/core/SpringSecurityCoreVersion at org.springframework.security.config.SecurityNamespaceHandler.<init>(SecurityNamespaceHandler.java:65) at sun.reflect.NativeConstructorAccessorImpl.newInstance0(Native Method) at sun.reflect.NativeConstructorAccessorImpl.newInstance(NativeConstructorAccessorImpl.java:57) at sun.reflect.DelegatingConstructorAccessorImpl.newInstance(DelegatingConstructorAccessorImpl.java:45) at java.lang.reflect.Constructor.newInstance(Constructor.java:526) at org.springframework.beans.BeanUtils.instantiateClass(BeanUtils.java:148) ... 69 more Caused by: java.lang.ClassNotFoundException: org.springframework.security.core.SpringSecurityCoreVersion at org.apache.catalina.loader.WebappClassLoader.loadClass(WebappClassLoader.java:1284) at org.apache.catalina.loader.WebappClassLoader.loadClass(WebappClassLoader.java:1132) ... 75 more I am using spring 3.2.7. It was not having spring security jar. So I got it downloaded using maven. It's version is 3.2.4. What is this error? There's no error in code. What must have gone wrong? For last 3 hours I have been trying to run a simple example, but totally hammered by this error. Please help

    Read the article

  • Problem with XML parser

    - by zp26
    Hi, I have a problem with parsing XML. I have created a program which write a file xml in the project directory. The file XML are correct. (i checked). When i try to read this XML the program crash and return 1 status. I have controlled my 2 path and they are equals. Can you help me please? Thanks so much. #import "PositionIdentifierViewController.h" #import "WriterXML.h" @implementation PositionIdentifierViewController - (void)parser:(NSXMLParser *)parser foundCharacters:(NSString *)string { NSString *stringa = [NSString stringWithFormat:@"%@",string]; textArea.text = [textArea.text stringByAppendingString:@"\n"]; textArea.text = [textArea.text stringByAppendingString:stringa]; } -(IBAction)startParsing { NSURL *xmlURL = [NSURL fileURLWithPath:path]; NSXMLParser *parser = [[NSXMLParser alloc] initWithContentsOfURL:xmlURL]; [parser setDelegate:self]; BOOL success = [parser parse]; if(success == YES){ // } [parser release]; } // Implement viewDidLoad to do additional setup after loading the view, typically from a nib. - (void)viewDidLoad { [super viewDidLoad]; NSArray *tempPaths = NSSearchPathForDirectoriesInDomains(NSDocumentDirectory, NSUserDomainMask, YES); NSString *documentsDirectoryPath = [tempPaths objectAtIndex:0]; path = [documentsDirectoryPath stringByAppendingPathComponent:@"filePosizioni.xml"]; WriterXML *newWriter; newWriter = [[WriterXML alloc]init]; [newWriter saveXML:(NSString*)@"ciao":(float)10:(float)40:(float)70]; [newWriter saveXML:(NSString*)@"pippo":(float)20:(float)50:(float)80]; [newWriter saveXML:(NSString*)@"pluto":(float)30:(float)60:(float)90]; NSLog(path); } - (void)didReceiveMemoryWarning { // Releases the view if it doesn't have a superview. [super didReceiveMemoryWarning]; // Release any cached data, images, etc that aren't in use. } - (void)viewDidUnload { // Release any retained subviews of the main view. // e.g. self.myOutlet = nil; } - (void)dealloc { [super dealloc]; } @end #import "WriterXML.h" @implementation WriterXML -(void)saveXML:(NSString*)name:(float)x:(float)y:(float)z{ NSArray *paths = NSSearchPathForDirectoriesInDomains(NSDocumentDirectory, NSUserDomainMask, YES); NSString *documentsDirectoryPath = [paths objectAtIndex:0]; NSString *filePath = [documentsDirectoryPath stringByAppendingPathComponent:@"filePosizioni.xml"]; NSFileHandle *myHandle; NSFileManager *fileManager = [NSFileManager defaultManager]; NSString *titoloXML = [NSString stringWithFormat:@"<?xml version=1.0 encoding=UTF-8 ?>"]; NSString *inizioTag = [NSString stringWithFormat:@"\n\n\n<position>"]; NSString *tagName = [NSString stringWithFormat:@"\n <name>%@</name>", name]; NSString *tagX = [NSString stringWithFormat:@"\n <x>%f</x>", x]; NSString *tagY = [NSString stringWithFormat:@"\n <y>%f</y>", y]; NSString *tagZ = [NSString stringWithFormat:@"\n <z>%f</z>", z]; NSString *fineTag= [NSString stringWithFormat:@"\n</position>"]; NSData* dataTitoloXML = [titoloXML dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataInizioTag = [inizioTag dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataName = [tagName dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataX = [tagX dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataY = [tagY dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataZ = [tagZ dataUsingEncoding: NSASCIIStringEncoding]; NSData* dataFineTag = [fineTag dataUsingEncoding: NSASCIIStringEncoding]; if(![fileManager fileExistsAtPath:filePath]) [fileManager createFileAtPath:filePath contents:dataTitoloXML attributes:nil]; myHandle = [NSFileHandle fileHandleForUpdatingAtPath:filePath]; [myHandle seekToEndOfFile]; [myHandle writeData:dataInizioTag]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataName]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataX]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataY]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataZ]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; [myHandle writeData:dataFineTag]; NSLog(@"writeok"); [myHandle seekToEndOfFile]; NSLog(@"zp26 %@",filePath); } @end

    Read the article

  • Is there an equivalent to Java's ClassFileTransformer in .NET? (a way to replace a class)

    - by Alix
    I've been searching for this for quite a while with no luck so far. Is there an equivalent to Java's ClassFileTransformer in .NET? Basically, I want to create a class CustomClassFileTransformer (which in Java would implement the interface ClassFileTransformer) that gets called whenever a class is loaded, and is allowed to tweak it and replace it with the tweaked version. I know there are frameworks that do similar things, but I was looking for something more straightforward, like implementing my own ClassFileTransformer. Is it possible? EDIT #1. More details about why I need this: Basically, I have a C# application and I need to monitor the instructions it wants to run in order to detect read or write operations to fields (operations Ldfld and Stfld) and insert some instructions before the read/write takes place. I know how to do this (except for the part where I need to be invoked to replace the class): for every method whose code I want to monitor, I must: Get the method's MethodBody using MethodBase.GetMethodBody() Transform it to byte array with MethodBody.GetILAsByteArray(). The byte[] it returns contains the bytecode. Analyse the bytecode as explained here, possibly inserting new instructions or deleting/modifying existing ones by changing the contents of the array. Create a new method and use the new bytecode to create its body, with MethodBuilder.CreateMethodBody(byte[] il, int count), where il is the array with the bytecode. I put all these tweaked methods in a new class and use the new class to replace the one that was originally going to be loaded. An alternative to replacing classes would be somehow getting notified whenever a method is invoked. Then I'd replace the call to that method with a call to my own tweaked method, which I would tweak only the first time is invoked and then I'd put it in a dictionary for future uses, to reduce overhead (for future calls I'll just look up the method and invoke it; I won't need to analyse the bytecode again). I'm currently investigating ways to do this and LinFu looks pretty interesting, but if there was something like a ClassFileTransformer it would be much simpler: I just rewrite the class, replace it, and let the code run without monitoring anything. An additional note: the classes may be sealed. I want to be able to replace any kind of class, I cannot impose restrictions on their attributes. EDIT #2. Why I need to do this at runtime. I need to monitor everything that is going on so that I can detect every access to data. This applies to the code of library classes as well. However, I cannot know in advance which classes are going to be used, and even if I knew every possible class that may get loaded it would be a huge performance hit to tweak all of them instead of waiting to see whether they actually get invoked or not. POSSIBLE (BUT PRETTY HARDCORE) SOLUTION. In case anyone is interested (and I see the question has been faved, so I guess someone is), this is what I'm looking at right now. Basically I'd have to implement the profiling API and I'll register for the events that I'm interested in, in my case whenever a JIT compilation starts. An extract of the blogpost: In your ICorProfilerCallback2::ModuleLoadFinished callback, you call ICorProfilerInfo2::GetModuleMetadata to get a pointer to a metadata interface on that module. QI for the metadata interface you want. Search MSDN for "IMetaDataImport", and grope through the table of contents to find topics on the metadata interfaces. Once you're in metadata-land, you have access to all the types in the module, including their fields and function prototypes. You may need to parse metadata signatures and this signature parser may be of use to you. In your ICorProfilerCallback2::JITCompilationStarted callback, you may use ICorProfilerInfo2::GetILFunctionBody to inspect the original IL, and ICorProfilerInfo2::GetILFunctionBodyAllocator and then ICorProfilerInfo2::SetILFunctionBody to replace that IL with your own. The great news: I get notified when a JIT compilation starts and I can replace the bytecode right there, without having to worry about replacing the class, etc. The not-so-great news: you cannot invoke managed code from the API's callback methods, which makes sense but means I'm on my own parsing the IL code, etc, as opposed to be able to use Cecil, which would've been a breeze. I don't think there's a simpler way to do this without using AOP frameworks (such as PostSharp). If anyone has any other idea please let me know. I'm not marking the question as answered yet.

    Read the article

  • Google Web Toolkit Deferred Binding Issue

    - by snctln
    I developed a web app using GWT about 2 years ago, since then the application has evolved. In its current state it relies on fetching a single XML file and parsing the information from it. Overall this works great. A requirement of this app is that it needs to be able to be ran from the filesystem (file:///..) as well as the traditional model of running from a webserver (http://...) Fetching this file from a webserver works exactly as expected using a RequestBuilder object. When running the app from the filesystem Firefox, Opera, Safari, and Chrome all behave as expected. When running the app from the filesystem using IE7 or IE8 the RequestBuilder.send() call fails, the information about the error suggests that there is a problem accessing the file due to violating the same origin policy. The app worked as expected in IE6 but not in IE7 or IE8. So I looked at the source code of RequestBuilder.java and saw that the actual request was being executed with an XMLHttpRequest GWT object. So I looked at the source code for XMLHttpRequest.java and found out some information. Here is the code (starts at line 83 in XMLHttpRequest.java) public static native XMLHttpRequest create() /*-{ if ($wnd.XMLHttpRequest) { return new XMLHttpRequest(); } else { try { return new ActiveXObject('MSXML2.XMLHTTP.3.0'); } catch (e) { return new ActiveXObject("Microsoft.XMLHTTP"); } } }-*/; So basically if an XMLHttpRequest cannot be created (like in IE6 because it is not available) an ActiveXObject is used instead. I read up a little bit more on the IE implementation of XMLHttpRequest, and it appears that it is only supported for interacting with files on a webserver. I found a setting in IE8 (Tools-Internet Options-Advanced-Security-Enable native XMLHTTP support), when I uncheck this box my app works. I assume this is because I am more of less telling IE to not use their implementation of XmlHttpRequest, so GWT just uses an ActiveXObject because it doesn't think the native XmlHttpRequest is available. This fixes the problem, but is hardly a long term solution. I can currently catch a failed send request and verify that it was trying to fetch the XML file from the filesystem using normal GWT. What I would like to do in this case is catch the IE7 and IE8 case and have them use a ActiveXObject instead of a native XmlHttpRequest object. There was a posting on the GWT google group that had a supposed solution for this problem (link). Looking at it I can tell that it was created for an older version of GWT. I am using the latest release and think that this is more or less what I would like to do (use GWT deferred binding to detect a specific browser type and run my own implementation of XMLHttpRequest.java in place of the built in GWT implementation). Here is the code that I am trying to use package com.mycompany.myapp.client; import com.google.gwt.xhr.client.XMLHttpRequest; public class XMLHttpRequestIE7or8 extends XMLHttpRequest { // commented out the "override" so that eclipse and the ant build script don't throw errors //@Override public static native XMLHttpRequest create() /*-{ try { return new ActiveXObject('MSXML2.XMLHTTP.3.0'); } catch (e) { return new ActiveXObject("Microsoft.XMLHTTP"); } }-*/; // have an empty protected constructor so the ant build script doesn't throw errors // the actual XMLHttpRequest constructor is empty as well so this shouldn't cause any problems protected XMLHttpRequestIE7or8() { } }; And here are the lines that I added to my module xml <replace-with class="com.mycompany.myapp.client.XMLHttpRequestIE7or8"> <when-type-is class="com.google.gwt.xhr.client.XMLHttpRequest"/> <any> <when-property-is name="user.agent" value="ie7" /> <when-property-is name="user.agent" value="ie8" /> </any> </replace-with> From what I can tell this should work, but my code never runs. Does anyone have any idea of what I am doing wrong? Should I not do this via deferred binding and just use native javascript when I catch the fail case instead? Is there a different way of approaching this problem that I have not mentioned? All replies are welcome.

    Read the article

  • Parse a text file into multiple text file

    - by Vijay Kumar Singh
    I want to get multiple file by parsing a input file Through Java. The Input file contains many fasta format of thousands of protein sequence and I want to generate raw format(i.e., without any comma semicolon and without any extra symbol like "", "[", "]" etc) of each protein sequence. A fasta sequence starts form "" symbol followed by description of protein and then sequence of protein. For example ? lcl|NC_000001.10_cdsid_XP_003403591.1 [gene=LOC100652771] [protein=hypothetical protein LOC100652771] [protein_id=XP_003403591.1] [location=join(12190..12227,12595..12721,13403..13639)] MSESINFSHNLGQLLSPPRCVVMPGMPFPSIRSPELQKTTADLDHTLVSVPSVAESLHHPEITFLTAFCL PSFTRSRPLPDRQLHHCLALCPSFALPAGDGVCHGPGLQGSCYKGETQESVESRVLPGPRHRH Like above formate the input file contains 1000s of protein sequence. I have to generate thousands of raw file containing only individual protein sequence without any special symbol or gaps. I have developed the code for it in Java but out put is : Cannot open a file followed by cannot find file. Please help me to solve my problem. Regards Vijay Kumar Garg Varanasi Bharat (India) The code is /*Java code to convert FASTA format to a raw format*/ import java.io.*; import java.util.*; import java.util.regex.*; import java.io.FileInputStream; // java package for using regular expression public class Arrayren { public static void main(String args[]) throws IOException { String a[]=new String[1000]; String b[][] =new String[1000][1000]; /*open the id file*/ try { File f = new File ("input.txt"); //opening the text document containing genbank ids FileInputStream fis = new FileInputStream("input.txt"); //Reading the file contents through inputstream BufferedInputStream bis = new BufferedInputStream(fis); // Writing the contents to a buffered stream DataInputStream dis = new DataInputStream(bis); //Method for reading Java Standard data types String inputline; String line; String separator = System.getProperty("line.separator"); // reads a line till next line operator is found int i=0; while ((inputline=dis.readLine()) != null) { i++; a[i]=inputline; a[i]=a[i].replaceAll(separator,""); //replaces unwanted patterns like /n with space a[i]=a[i].trim(); // trims out if any space is available a[i]=a[i]+".txt"; //takes the file name into an array try // to handle run time error /*take the sequence in to an array*/ { BufferedReader in = new BufferedReader (new FileReader(a[i])); String inline = null; int j=0; while((inline=in.readLine()) != null) { j++; b[i][j]=inline; Pattern q=Pattern.compile(">"); //Compiling the regular expression Matcher n=q.matcher(inline); //creates the matcher for the above pattern if(n.find()) { /*appending the comment line*/ b[i][j]=b[i][j].replaceAll(">gi",""); //identify the pattern and replace it with a space b[i][j]=b[i][j].replaceAll("[a-zA-Z]",""); b[i][j]=b[i][j].replaceAll("|",""); b[i][j]=b[i][j].replaceAll("\\d{1,15}",""); b[i][j]=b[i][j].replaceAll(".",""); b[i][j]=b[i][j].replaceAll("_",""); b[i][j]=b[i][j].replaceAll("\\(",""); b[i][j]=b[i][j].replaceAll("\\)",""); } /*printing the sequence in to a text file*/ b[i][j]=b[i][j].replaceAll(separator,""); b[i][j]=b[i][j].trim(); // trims out if any space is available File create = new File(inputline+"R.txt"); try { if(!create.exists()) { create.createNewFile(); // creates a new file } else { System.out.println("file already exists"); } } catch(IOException e) // to catch the exception and print the error if cannot open a file { System.err.println("cannot create a file"); } BufferedWriter outt = new BufferedWriter(new FileWriter(inputline+"R.txt", true)); outt.write(b[i][j]); // printing the contents to a text file outt.close(); // closing the text file System.out.println(b[i][j]); } } catch(Exception e) { System.out.println("cannot open a file"); } } } catch(Exception ex) // catch the exception and prints the error if cannot find file { System.out.println("cannot find file "); } } } If you provide me correct it will be much easier to understand.

    Read the article

  • [Android] Force close when trying to parse JSON with AsyncTask in the background

    - by robs
    Hello everyone, i'm new to android development and i'm playing around with json data. I managed to get the parsing to work. I want to show a ProgressDialog and i read that i need to use AsyncTask that. But for some reason i get a force close as soon as i put the same working code inside doInBackground() eventhough eclipse says everything is fine. Here is the source code: public class HomeActivity extends Activity { public class BackgroundAsyncTask extends AsyncTask<Void, Integer, Void> { ProgressDialog dialog = new ProgressDialog (HomeActivity.this); @Override protected void onPreExecute() { dialog.setMessage("Loading...please wait"); dialog.setIndeterminate(true); dialog.setCancelable(false); dialog.show(); } protected void onPostExecute() { dialog.dismiss(); } @Override protected Void doInBackground(Void... params) { try { URL json = new URL("http://www.corps-marchia.de/jsontest.php"); URLConnection tc = json.openConnection(); BufferedReader in = new BufferedReader(new InputStreamReader(tc.getInputStream())); String line; while ((line = in.readLine()) != null) { JSONArray ja = new JSONArray(line); JSONObject jo = (JSONObject) ja.get(0); TextView txtView = (TextView)findViewById(R.id.TextView01); txtView.setText(jo.getString("text")); } } catch (MalformedURLException e) { e.printStackTrace(); } catch (IOException e) { e.printStackTrace(); } catch (JSONException e) { e.printStackTrace(); } return null; } } @Override public void onCreate(Bundle savedInstanceState) { super.onCreate(savedInstanceState); setContentView(R.layout.main); new BackgroundAsyncTask().execute(); } } Here is the error log: 01-08 12:33:48.225: ERROR/AndroidRuntime(815): FATAL EXCEPTION: AsyncTask #1 01-08 12:33:48.225: ERROR/AndroidRuntime(815): java.lang.RuntimeException: An error occured while executing doInBackground() 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.os.AsyncTask$3.done(AsyncTask.java:200) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask$Sync.innerSetException(FutureTask.java:274) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask.setException(FutureTask.java:125) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:308) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask.run(FutureTask.java:138) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.ThreadPoolExecutor.runWorker(ThreadPoolExecutor.java:1088) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.ThreadPoolExecutor$Worker.run(ThreadPoolExecutor.java:581) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.lang.Thread.run(Thread.java:1019) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): Caused by: android.view.ViewRoot$CalledFromWrongThreadException: Only the original thread that created a view hierarchy can touch its views. 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.ViewRoot.checkThread(ViewRoot.java:2932) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.ViewRoot.requestLayout(ViewRoot.java:629) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.view.View.requestLayout(View.java:8267) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.checkForRelayout(TextView.java:5521) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.setText(TextView.java:2724) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.setText(TextView.java:2592) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.widget.TextView.setText(TextView.java:2567) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at net.ajzele.demo.andy1.HomeActivity$BackgroundAsyncTask.doInBackground(HomeActivity.java:52) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at net.ajzele.demo.andy1.HomeActivity$BackgroundAsyncTask.doInBackground(HomeActivity.java:1) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at android.os.AsyncTask$2.call(AsyncTask.java:185) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): at java.util.concurrent.FutureTask$Sync.innerRun(FutureTask.java:306) 01-08 12:33:48.225: ERROR/AndroidRuntime(815): ... 4 more 01-08 12:33:51.605: ERROR/WindowManager(815): Activity net.ajzele.demo.andy1.HomeActivity has leaked window com.android.internal.policy.impl.PhoneWindow$DecorView@4051d0c0 that was originally added here 01-08 12:33:51.605: ERROR/WindowManager(815): android.view.WindowLeaked: Activity net.ajzele.demo.andy1.HomeActivity has leaked window com.android.internal.policy.impl.PhoneWindow$DecorView@4051d0c0 that was originally added here 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.ViewRoot.<init>(ViewRoot.java:258) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.WindowManagerImpl.addView(WindowManagerImpl.java:148) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.WindowManagerImpl.addView(WindowManagerImpl.java:91) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.view.Window$LocalWindowManager.addView(Window.java:424) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.Dialog.show(Dialog.java:241) 01-08 12:33:51.605: ERROR/WindowManager(815): at net.ajzele.demo.andy1.HomeActivity$BackgroundAsyncTask.onPreExecute(HomeActivity.java:33) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.os.AsyncTask.execute(AsyncTask.java:391) 01-08 12:33:51.605: ERROR/WindowManager(815): at net.ajzele.demo.andy1.HomeActivity.onCreate(HomeActivity.java:72) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.Instrumentation.callActivityOnCreate(Instrumentation.java:1047) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.performLaunchActivity(ActivityThread.java:1586) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.handleLaunchActivity(ActivityThread.java:1638) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.access$1500(ActivityThread.java:117) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread$H.handleMessage(ActivityThread.java:928) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.os.Handler.dispatchMessage(Handler.java:99) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.os.Looper.loop(Looper.java:123) 01-08 12:33:51.605: ERROR/WindowManager(815): at android.app.ActivityThread.main(ActivityThread.java:3647) 01-08 12:33:51.605: ERROR/WindowManager(815): at java.lang.reflect.Method.invokeNative(Native Method) 01-08 12:33:51.605: ERROR/WindowManager(815): at java.lang.reflect.Method.invoke(Method.java:507) 01-08 12:33:51.605: ERROR/WindowManager(815): at com.android.internal.os.ZygoteInit$MethodAndArgsCaller.run(ZygoteInit.java:839) 01-08 12:33:51.605: ERROR/WindowManager(815): at com.android.internal.os.ZygoteInit.main(ZygoteInit.java:597) 01-08 12:33:51.605: ERROR/WindowManager(815): at dalvik.system.NativeStart.main(Native Method) Any hints? I hope you can help me out ive searched the net and didnt find any working solution...Thanks in advance

    Read the article

  • Fastest way to parse XML files in C#?

    - by LifeH2O
    I have to load many XML files from internet. But for testing with better speed i downloaded all of them (more than 500 files) of the following format. <player-profile> <personal-information> <id>36</id> <fullname>Adam Gilchrist</fullname> <majorteam>Australia</majorteam> <nickname>Gilchrist</nickname> <shortName>A Gilchrist</shortName> <dateofbirth>Nov 14, 1971</dateofbirth> <battingstyle>Left-hand bat</battingstyle> <bowlingstyle>Right-arm offbreak</bowlingstyle> <role>Wicket-Keeper</role> <teams-played-for>Western Australia, New South Wales, ICC World XI, Deccan Chargers, Australia</teams-played-for> <iplteam>Deccan Chargers</iplteam> </personal-information> <batting-statistics> <odi-stats> <matchtype>ODI</matchtype> <matches>287</matches> <innings>279</innings> <notouts>11</notouts> <runsscored>9619</runsscored> <highestscore>172</highestscore> <ballstaken>9922</ballstaken> <sixes>149</sixes> <fours>1000+</fours> <ducks>0</ducks> <fifties>55</fifties> <catches>417</catches> <stumpings>55</stumpings> <hundreds>16</hundreds> <strikerate>96.95</strikerate> <average>35.89</average> </odi-stats> <test-stats> . . . </test-stats> <t20-stats> . . . </t20-stats> <ipl-stats> . . . </ipl-stats> </batting-statistics> <bowling-statistics> <odi-stats> . . . </odi-stats> <test-stats> . . . </test-stats> <t20-stats> . . . </t20-stats> <ipl-stats> . . . </ipl-stats> </bowling-statistics> </player-profile> I am using XmlNodeList list = _document.SelectNodes("/player-profile/batting-statistics/odi-stats"); And then loop this list with foreach as foreach (XmlNode stats in list) { _btMatchType = GetInnerString(stats, "matchtype"); //it returns null string if node not availible . . . . _btAvg = Convert.ToDouble(stats["average"].InnerText); } Even i am loading all files offline, parsing is very slow Is there any good faster way to parse them? Or is it problem with SQL? I am saving all extracted data from XML to database using DataSets, TableAdapters with insert command. I

    Read the article

< Previous Page | 161 162 163 164 165 166 167 168 169  | Next Page >